libtranslate-0.99000777 001750 001750 00000000000 10176431053 015622 5ustar00jylefortjylefort000000 000000 libtranslate-0.99/data000777 001750 001750 00000000000 10176431051 016531 5ustar00jylefortjylefort000000 000000 libtranslate-0.99/data/Makefile.am000644 001750 001750 00000000566 10172237632 020654 0ustar00jylefortjylefort000000 000000 pkgconfigdir = $(libdir)/pkgconfig pkgconfig_DATA = libtranslate.pc if WITH_GENERIC pkgdata_in_files = services.xml.in pkgdata_DATA = services.dtd services.xml endif @INTLTOOL_XML_NOMERGE_RULE@ DISTCLEANFILES = \ libtranslate.pc \ services.xml EXTRA_DIST = \ iso639-2 \ rfc3066.sh \ services.dtd \ services.xml.in dist-hook: xmllint --noout --valid services.xml libtranslate-0.99/data/Makefile.in000644 001750 001750 00000032333 10176430637 020666 0ustar00jylefortjylefort000000 000000 # Makefile.in generated by automake 1.9.2 from Makefile.am. # @configure_input@ # Copyright (C) 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001, 2002, # 2003, 2004 Free Software Foundation, Inc. # This Makefile.in is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY, to the extent permitted by law; without # even the implied warranty of MERCHANTABILITY or FITNESS FOR A # PARTICULAR PURPOSE. @SET_MAKE@ srcdir = @srcdir@ top_srcdir = @top_srcdir@ VPATH = @srcdir@ pkgdatadir = $(datadir)/@PACKAGE@ pkglibdir = $(libdir)/@PACKAGE@ pkgincludedir = $(includedir)/@PACKAGE@ top_builddir = .. am__cd = CDPATH="$${ZSH_VERSION+.}$(PATH_SEPARATOR)" && cd INSTALL = @INSTALL@ install_sh_DATA = $(install_sh) -c -m 644 install_sh_PROGRAM = $(install_sh) -c install_sh_SCRIPT = $(install_sh) -c INSTALL_HEADER = $(INSTALL_DATA) transform = $(program_transform_name) NORMAL_INSTALL = : PRE_INSTALL = : POST_INSTALL = : NORMAL_UNINSTALL = : PRE_UNINSTALL = : POST_UNINSTALL = : build_triplet = @build@ host_triplet = @host@ subdir = data DIST_COMMON = $(srcdir)/Makefile.am $(srcdir)/Makefile.in \ $(srcdir)/libtranslate.pc.in ACLOCAL_M4 = $(top_srcdir)/aclocal.m4 am__aclocal_m4_deps = $(top_srcdir)/m4/talkfilters.m4 \ $(top_srcdir)/acinclude.m4 $(top_srcdir)/configure.ac am__configure_deps = $(am__aclocal_m4_deps) $(CONFIGURE_DEPENDENCIES) \ $(ACLOCAL_M4) mkinstalldirs = $(SHELL) $(top_srcdir)/mkinstalldirs CONFIG_HEADER = $(top_builddir)/config.h CONFIG_CLEAN_FILES = libtranslate.pc SOURCES = DIST_SOURCES = am__vpath_adj_setup = srcdirstrip=`echo "$(srcdir)" | sed 's|.|.|g'`; am__vpath_adj = case $$p in \ $(srcdir)/*) f=`echo "$$p" | sed "s|^$$srcdirstrip/||"`;; \ *) f=$$p;; \ esac; am__strip_dir = `echo $$p | sed -e 's|^.*/||'`; am__installdirs = "$(DESTDIR)$(pkgconfigdir)" \ "$(DESTDIR)$(pkgdatadir)" pkgconfigDATA_INSTALL = $(INSTALL_DATA) pkgdataDATA_INSTALL = $(INSTALL_DATA) DATA = $(pkgconfig_DATA) $(pkgdata_DATA) DISTFILES = $(DIST_COMMON) $(DIST_SOURCES) $(TEXINFOS) $(EXTRA_DIST) ACLOCAL = @ACLOCAL@ AMDEP_FALSE = @AMDEP_FALSE@ AMDEP_TRUE = @AMDEP_TRUE@ AMTAR = @AMTAR@ AR = @AR@ AUTOCONF = @AUTOCONF@ AUTOHEADER = @AUTOHEADER@ AUTOMAKE = @AUTOMAKE@ AWK = @AWK@ CATALOGS = @CATALOGS@ CATOBJEXT = @CATOBJEXT@ CC = @CC@ CCDEPMODE = @CCDEPMODE@ CFLAGS = @CFLAGS@ CPP = @CPP@ CPPFLAGS = @CPPFLAGS@ CXX = @CXX@ CXXCPP = @CXXCPP@ CXXDEPMODE = @CXXDEPMODE@ CXXFLAGS = @CXXFLAGS@ CYGPATH_W = @CYGPATH_W@ DATADIRNAME = @DATADIRNAME@ DEFS = @DEFS@ DEPDIR = @DEPDIR@ ECHO = @ECHO@ ECHO_C = @ECHO_C@ ECHO_N = @ECHO_N@ ECHO_T = @ECHO_T@ EGREP = @EGREP@ ENABLE_GTK_DOC_FALSE = @ENABLE_GTK_DOC_FALSE@ ENABLE_GTK_DOC_TRUE = @ENABLE_GTK_DOC_TRUE@ EXEEXT = @EXEEXT@ F77 = @F77@ FFLAGS = @FFLAGS@ GETTEXT_PACKAGE = @GETTEXT_PACKAGE@ GLIB_CFLAGS = @GLIB_CFLAGS@ GLIB_LIBS = @GLIB_LIBS@ GMOFILES = @GMOFILES@ GMSGFMT = @GMSGFMT@ GTK_DOC_USE_LIBTOOL_FALSE = @GTK_DOC_USE_LIBTOOL_FALSE@ GTK_DOC_USE_LIBTOOL_TRUE = @GTK_DOC_USE_LIBTOOL_TRUE@ HTML_DIR = @HTML_DIR@ ICONV = @ICONV@ INSTALL_DATA = @INSTALL_DATA@ INSTALL_PROGRAM = @INSTALL_PROGRAM@ INSTALL_SCRIPT = @INSTALL_SCRIPT@ INSTALL_STRIP_PROGRAM = @INSTALL_STRIP_PROGRAM@ INSTOBJEXT = @INSTOBJEXT@ INTLLIBS = @INTLLIBS@ INTLTOOL_CAVES_RULE = @INTLTOOL_CAVES_RULE@ INTLTOOL_DESKTOP_RULE = @INTLTOOL_DESKTOP_RULE@ INTLTOOL_DIRECTORY_RULE = @INTLTOOL_DIRECTORY_RULE@ INTLTOOL_EXTRACT = @INTLTOOL_EXTRACT@ INTLTOOL_KBD_RULE = @INTLTOOL_KBD_RULE@ INTLTOOL_KEYS_RULE = @INTLTOOL_KEYS_RULE@ INTLTOOL_MERGE = @INTLTOOL_MERGE@ INTLTOOL_OAF_RULE = @INTLTOOL_OAF_RULE@ INTLTOOL_PERL = @INTLTOOL_PERL@ INTLTOOL_PONG_RULE = @INTLTOOL_PONG_RULE@ INTLTOOL_PROP_RULE = @INTLTOOL_PROP_RULE@ INTLTOOL_SCHEMAS_RULE = @INTLTOOL_SCHEMAS_RULE@ INTLTOOL_SERVER_RULE = @INTLTOOL_SERVER_RULE@ INTLTOOL_SHEET_RULE = @INTLTOOL_SHEET_RULE@ INTLTOOL_SOUNDLIST_RULE = @INTLTOOL_SOUNDLIST_RULE@ INTLTOOL_THEME_RULE = @INTLTOOL_THEME_RULE@ INTLTOOL_UI_RULE = @INTLTOOL_UI_RULE@ INTLTOOL_UPDATE = @INTLTOOL_UPDATE@ INTLTOOL_XAM_RULE = @INTLTOOL_XAM_RULE@ INTLTOOL_XML_NOMERGE_RULE = @INTLTOOL_XML_NOMERGE_RULE@ INTLTOOL_XML_RULE = @INTLTOOL_XML_RULE@ LDFLAGS = @LDFLAGS@ LIBOBJS = @LIBOBJS@ LIBS = @LIBS@ LIBTOOL = @LIBTOOL@ LIBXML_CFLAGS = @LIBXML_CFLAGS@ LIBXML_LIBS = @LIBXML_LIBS@ LN_S = @LN_S@ LTLIBOBJS = @LTLIBOBJS@ MAINT = @MAINT@ MAINTAINER_MODE_FALSE = @MAINTAINER_MODE_FALSE@ MAINTAINER_MODE_TRUE = @MAINTAINER_MODE_TRUE@ MAKEINFO = @MAKEINFO@ MKINSTALLDIRS = @MKINSTALLDIRS@ MSGFMT = @MSGFMT@ MSGMERGE = @MSGMERGE@ OBJEXT = @OBJEXT@ PACKAGE = @PACKAGE@ PACKAGE_BUGREPORT = @PACKAGE_BUGREPORT@ PACKAGE_NAME = @PACKAGE_NAME@ PACKAGE_STRING = @PACKAGE_STRING@ PACKAGE_TARNAME = @PACKAGE_TARNAME@ PACKAGE_VERSION = @PACKAGE_VERSION@ PATH_SEPARATOR = @PATH_SEPARATOR@ PKG_CONFIG = @PKG_CONFIG@ POFILES = @POFILES@ POSUB = @POSUB@ PO_IN_DATADIR_FALSE = @PO_IN_DATADIR_FALSE@ PO_IN_DATADIR_TRUE = @PO_IN_DATADIR_TRUE@ RANLIB = @RANLIB@ SET_MAKE = @SET_MAKE@ SHELL = @SHELL@ SOUP_CFLAGS = @SOUP_CFLAGS@ SOUP_LIBS = @SOUP_LIBS@ STRIP = @STRIP@ TALKFILTERS_CFLAGS = @TALKFILTERS_CFLAGS@ TALKFILTERS_LIBS = @TALKFILTERS_LIBS@ USE_NLS = @USE_NLS@ VERSION = @VERSION@ WARN_CFLAGS = @WARN_CFLAGS@ WITH_GENERIC_FALSE = @WITH_GENERIC_FALSE@ WITH_GENERIC_TRUE = @WITH_GENERIC_TRUE@ WITH_REGRESSION_TESTS_FALSE = @WITH_REGRESSION_TESTS_FALSE@ WITH_REGRESSION_TESTS_TRUE = @WITH_REGRESSION_TESTS_TRUE@ WITH_TALKFILTERS_FALSE = @WITH_TALKFILTERS_FALSE@ WITH_TALKFILTERS_TRUE = @WITH_TALKFILTERS_TRUE@ XGETTEXT = @XGETTEXT@ ac_ct_AR = @ac_ct_AR@ ac_ct_CC = @ac_ct_CC@ ac_ct_CXX = @ac_ct_CXX@ ac_ct_F77 = @ac_ct_F77@ ac_ct_RANLIB = @ac_ct_RANLIB@ ac_ct_STRIP = @ac_ct_STRIP@ am__fastdepCC_FALSE = @am__fastdepCC_FALSE@ am__fastdepCC_TRUE = @am__fastdepCC_TRUE@ am__fastdepCXX_FALSE = @am__fastdepCXX_FALSE@ am__fastdepCXX_TRUE = @am__fastdepCXX_TRUE@ am__include = @am__include@ am__leading_dot = @am__leading_dot@ am__quote = @am__quote@ am__tar = @am__tar@ am__untar = @am__untar@ bindir = @bindir@ build = @build@ build_alias = @build_alias@ build_cpu = @build_cpu@ build_os = @build_os@ build_vendor = @build_vendor@ datadir = @datadir@ exec_prefix = @exec_prefix@ host = @host@ host_alias = @host_alias@ host_cpu = @host_cpu@ host_os = @host_os@ host_vendor = @host_vendor@ includedir = @includedir@ infodir = @infodir@ install_sh = @install_sh@ libdir = @libdir@ libexecdir = @libexecdir@ localstatedir = @localstatedir@ mandir = @mandir@ mkdir_p = @mkdir_p@ oldincludedir = @oldincludedir@ prefix = @prefix@ program_transform_name = @program_transform_name@ sbindir = @sbindir@ sharedstatedir = @sharedstatedir@ sysconfdir = @sysconfdir@ target_alias = @target_alias@ pkgconfigdir = $(libdir)/pkgconfig pkgconfig_DATA = libtranslate.pc @WITH_GENERIC_TRUE@pkgdata_in_files = services.xml.in @WITH_GENERIC_TRUE@pkgdata_DATA = services.dtd services.xml DISTCLEANFILES = \ libtranslate.pc \ services.xml EXTRA_DIST = \ iso639-2 \ rfc3066.sh \ services.dtd \ services.xml.in all: all-am .SUFFIXES: $(srcdir)/Makefile.in: @MAINTAINER_MODE_TRUE@ $(srcdir)/Makefile.am $(am__configure_deps) @for dep in $?; do \ case '$(am__configure_deps)' in \ *$$dep*) \ cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh \ && exit 0; \ exit 1;; \ esac; \ done; \ echo ' cd $(top_srcdir) && $(AUTOMAKE) --foreign data/Makefile'; \ cd $(top_srcdir) && \ $(AUTOMAKE) --foreign data/Makefile .PRECIOUS: Makefile Makefile: $(srcdir)/Makefile.in $(top_builddir)/config.status @case '$?' in \ *config.status*) \ cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh;; \ *) \ echo ' cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe)'; \ cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe);; \ esac; $(top_builddir)/config.status: $(top_srcdir)/configure $(CONFIG_STATUS_DEPENDENCIES) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh $(top_srcdir)/configure: @MAINTAINER_MODE_TRUE@ $(am__configure_deps) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh $(ACLOCAL_M4): @MAINTAINER_MODE_TRUE@ $(am__aclocal_m4_deps) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh libtranslate.pc: $(top_builddir)/config.status $(srcdir)/libtranslate.pc.in cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ mostlyclean-libtool: -rm -f *.lo clean-libtool: -rm -rf .libs _libs distclean-libtool: -rm -f libtool uninstall-info-am: install-pkgconfigDATA: $(pkgconfig_DATA) @$(NORMAL_INSTALL) test -z "$(pkgconfigdir)" || $(mkdir_p) "$(DESTDIR)$(pkgconfigdir)" @list='$(pkgconfig_DATA)'; for p in $$list; do \ if test -f "$$p"; then d=; else d="$(srcdir)/"; fi; \ f=$(am__strip_dir) \ echo " $(pkgconfigDATA_INSTALL) '$$d$$p' '$(DESTDIR)$(pkgconfigdir)/$$f'"; \ $(pkgconfigDATA_INSTALL) "$$d$$p" "$(DESTDIR)$(pkgconfigdir)/$$f"; \ done uninstall-pkgconfigDATA: @$(NORMAL_UNINSTALL) @list='$(pkgconfig_DATA)'; for p in $$list; do \ f=$(am__strip_dir) \ echo " rm -f '$(DESTDIR)$(pkgconfigdir)/$$f'"; \ rm -f "$(DESTDIR)$(pkgconfigdir)/$$f"; \ done install-pkgdataDATA: $(pkgdata_DATA) @$(NORMAL_INSTALL) test -z "$(pkgdatadir)" || $(mkdir_p) "$(DESTDIR)$(pkgdatadir)" @list='$(pkgdata_DATA)'; for p in $$list; do \ if test -f "$$p"; then d=; else d="$(srcdir)/"; fi; \ f=$(am__strip_dir) \ echo " $(pkgdataDATA_INSTALL) '$$d$$p' '$(DESTDIR)$(pkgdatadir)/$$f'"; \ $(pkgdataDATA_INSTALL) "$$d$$p" "$(DESTDIR)$(pkgdatadir)/$$f"; \ done uninstall-pkgdataDATA: @$(NORMAL_UNINSTALL) @list='$(pkgdata_DATA)'; for p in $$list; do \ f=$(am__strip_dir) \ echo " rm -f '$(DESTDIR)$(pkgdatadir)/$$f'"; \ rm -f "$(DESTDIR)$(pkgdatadir)/$$f"; \ done tags: TAGS TAGS: ctags: CTAGS CTAGS: distdir: $(DISTFILES) @srcdirstrip=`echo "$(srcdir)" | sed 's|.|.|g'`; \ topsrcdirstrip=`echo "$(top_srcdir)" | sed 's|.|.|g'`; \ list='$(DISTFILES)'; for file in $$list; do \ case $$file in \ $(srcdir)/*) file=`echo "$$file" | sed "s|^$$srcdirstrip/||"`;; \ $(top_srcdir)/*) file=`echo "$$file" | sed "s|^$$topsrcdirstrip/|$(top_builddir)/|"`;; \ esac; \ if test -f $$file || test -d $$file; then d=.; else d=$(srcdir); fi; \ dir=`echo "$$file" | sed -e 's,/[^/]*$$,,'`; \ if test "$$dir" != "$$file" && test "$$dir" != "."; then \ dir="/$$dir"; \ $(mkdir_p) "$(distdir)$$dir"; \ else \ dir=''; \ fi; \ if test -d $$d/$$file; then \ if test -d $(srcdir)/$$file && test $$d != $(srcdir); then \ cp -pR $(srcdir)/$$file $(distdir)$$dir || exit 1; \ fi; \ cp -pR $$d/$$file $(distdir)$$dir || exit 1; \ else \ test -f $(distdir)/$$file \ || cp -p $$d/$$file $(distdir)/$$file \ || exit 1; \ fi; \ done $(MAKE) $(AM_MAKEFLAGS) \ top_distdir="$(top_distdir)" distdir="$(distdir)" \ dist-hook check-am: all-am check: check-am all-am: Makefile $(DATA) installdirs: for dir in "$(DESTDIR)$(pkgconfigdir)" "$(DESTDIR)$(pkgdatadir)"; do \ test -z "$$dir" || $(mkdir_p) "$$dir"; \ done install: install-am install-exec: install-exec-am install-data: install-data-am uninstall: uninstall-am install-am: all-am @$(MAKE) $(AM_MAKEFLAGS) install-exec-am install-data-am installcheck: installcheck-am install-strip: $(MAKE) $(AM_MAKEFLAGS) INSTALL_PROGRAM="$(INSTALL_STRIP_PROGRAM)" \ install_sh_PROGRAM="$(INSTALL_STRIP_PROGRAM)" INSTALL_STRIP_FLAG=-s \ `test -z '$(STRIP)' || \ echo "INSTALL_PROGRAM_ENV=STRIPPROG='$(STRIP)'"` install mostlyclean-generic: clean-generic: distclean-generic: -test -z "$(CONFIG_CLEAN_FILES)" || rm -f $(CONFIG_CLEAN_FILES) -test -z "$(DISTCLEANFILES)" || rm -f $(DISTCLEANFILES) maintainer-clean-generic: @echo "This command is intended for maintainers to use" @echo "it deletes files that may require special tools to rebuild." clean: clean-am clean-am: clean-generic clean-libtool mostlyclean-am distclean: distclean-am -rm -f Makefile distclean-am: clean-am distclean-generic distclean-libtool dvi: dvi-am dvi-am: html: html-am info: info-am info-am: install-data-am: install-pkgconfigDATA install-pkgdataDATA install-exec-am: install-info: install-info-am install-man: installcheck-am: maintainer-clean: maintainer-clean-am -rm -f Makefile maintainer-clean-am: distclean-am maintainer-clean-generic mostlyclean: mostlyclean-am mostlyclean-am: mostlyclean-generic mostlyclean-libtool pdf: pdf-am pdf-am: ps: ps-am ps-am: uninstall-am: uninstall-info-am uninstall-pkgconfigDATA \ uninstall-pkgdataDATA .PHONY: all all-am check check-am clean clean-generic clean-libtool \ dist-hook distclean distclean-generic distclean-libtool \ distdir dvi dvi-am html html-am info info-am install \ install-am install-data install-data-am install-exec \ install-exec-am install-info install-info-am install-man \ install-pkgconfigDATA install-pkgdataDATA install-strip \ installcheck installcheck-am installdirs maintainer-clean \ maintainer-clean-generic mostlyclean mostlyclean-generic \ mostlyclean-libtool pdf pdf-am ps ps-am uninstall uninstall-am \ uninstall-info-am uninstall-pkgconfigDATA \ uninstall-pkgdataDATA @INTLTOOL_XML_NOMERGE_RULE@ dist-hook: xmllint --noout --valid services.xml # Tell versions [3.59,3.63) of GNU make to not export all variables. # Otherwise a system limit (for SysV at least) may be exceeded. .NOEXPORT: libtranslate-0.99/data/libtranslate.pc.in000644 001750 001750 00000000417 10165776315 022240 0ustar00jylefortjylefort000000 000000 prefix=@prefix@ exec_prefix=@exec_prefix@ libdir=@libdir@ includedir=@includedir@/libtranslate Name: @PACKAGE@ Description: a natural language translation library Version: @VERSION@ Requires: gobject-2.0 gthread-2.0 Cflags: -I${includedir} Libs: -L${libdir} -ltranslate libtranslate-0.99/data/iso639-2000644 001750 001750 00000034750 10166104657 017743 0ustar00jylefortjylefort000000 000000 aar||aa|Afar|afar abk||ab|Abkhazian|abkhaze ace|||Achinese|aceh ach|||Acoli|acoli ada|||Adangme|adangme ady|||Adyghe; Adygei|adyghe afa|||Afro-Asiatic (Other)|afro-asiatiques, autres langues afh|||Afrihili|afrihili afr||af|Afrikaans|afrikaans aka||ak|Akan|akan akk|||Akkadian|akkadien alb|sqi|sq|Albanian|albanais alb|sqi|sq|Albanian|albanais ale|||Aleut|aléoute alg|||Algonquian languages|algonquines, langues amh||am|Amharic|amharique ang|||English, Old (ca.450-1100)|anglo-saxon (ca.450-1100) apa|||Apache languages|apache ara||ar|Arabic|arabe arc|||Aramaic|araméen arg||an|Aragonese|aragonais arm|hye|hy|Armenian|arménien arm|hye|hy|Armenian|arménien arn|||Araucanian|araucan arp|||Arapaho|arapaho art|||Artificial (Other)|artificielles, autres langues arw|||Arawak|arawak asm||as|Assamese|assamais ast|||Asturian; Bable|asturien; bable ath|||Athapascan languages|athapascanes, langues aus|||Australian languages|australiennes, langues ava||av|Avaric|avar ave||ae|Avestan|avestique awa|||Awadhi|awadhi aym||ay|Aymara|aymara aze||az|Azerbaijani|azéri bad|||Banda|banda bai|||Bamileke languages|bamilékés, langues bak||ba|Bashkir|bachkir bal|||Baluchi|baloutchi bam||bm|Bambara|bambara ban|||Balinese|balinais baq|eus|eu|Basque|basque baq|eus|eu|Basque|basque bas|||Basa|basa bat|||Baltic (Other)|baltiques, autres langues bej|||Beja|bedja bel||be|Belarusian|biélorusse bem|||Bemba|bemba ben||bn|Bengali|bengali ber|||Berber (Other)|berbères, autres langues bho|||Bhojpuri|bhojpuri bih||bh|Bihari|bihari bik|||Bikol|bikol bin|||Bini|bini bis||bi|Bislama|bichlamar bla|||Siksika|blackfoot bnt|||Bantu (Other)|bantoues, autres langues bos||bs|Bosnian|bosniaque bra|||Braj|braj bre||br|Breton|breton btk|||Batak (Indonesia)|batak (Indonésie) bua|||Buriat|bouriate bug|||Buginese|bugi bul||bg|Bulgarian|bulgare bur|mya|my|Burmese|birman bur|mya|my|Burmese|birman byn|||Blin; Bilin|blin; bilen cad|||Caddo|caddo cai|||Central American Indian (Other)|indiennes d'Amérique centrale, autres langues car|||Carib|caribe cat||ca|Catalan; Valencian|catalan; valencien cau|||Caucasian (Other)|caucasiennes, autres langues ceb|||Cebuano|cebuano cel|||Celtic (Other)|celtiques, autres langues cha||ch|Chamorro|chamorro chb|||Chibcha|chibcha che||ce|Chechen|tchétchène chg|||Chagatai|djaghataï chi|zho|zh|Chinese|chinois chi|zho|zh|Chinese|chinois chk|||Chuukese|chuuk chm|||Mari|mari chn|||Chinook jargon|chinook, jargon cho|||Choctaw|choctaw chp|||Chipewyan|chipewyan chr|||Cherokee|cherokee chu||cu|Church Slavic; Old Slavonic; Church Slavonic; Old Bulgarian; Old Church Slavonic|slavon d'église; vieux slave; slavon liturgique; vieux bulgare chv||cv|Chuvash|tchouvache chy|||Cheyenne|cheyenne cmc|||Chamic languages|chames, langues cop|||Coptic|copte cor||kw|Cornish|cornique cos||co|Corsican|corse cpe|||Creoles and pidgins, English based (Other)|créoles et pidgins anglais, autres cpf|||Creoles and pidgins, French-based (Other)|créoles et pidgins français, autres cpp|||Creoles and pidgins, Portuguese-based (Other)|créoles et pidgins portugais, autres cre||cr|Cree|cree crh|||Crimean Tatar; Crimean Turkish|tatar de Crimé crp|||Creoles and pidgins (Other)|créoles et pidgins divers csb|||Kashubian|kachoube cus|||Cushitic (Other)|couchitiques, autres langues cze|ces|cs|Czech|tchèque cze|ces|cs|Czech|tchèque dak|||Dakota|dakota dan||da|Danish|danois dar|||Dargwa|dargwa day|||Dayak|dayak del|||Delaware|delaware den|||Slave (Athapascan)|esclave (athapascan) dgr|||Dogrib|dogrib din|||Dinka|dinka div||dv|Divehi|maldivien doi|||Dogri|dogri dra|||Dravidian (Other)|dravidiennes, autres langues dsb|||Lower Sorbian|bas-sorabe dua|||Duala|douala dum|||Dutch, Middle (ca.1050-1350)|néerlandais moyen (ca. 1050-1350) dut|nld|nl|Dutch; Flemish|néerlandais; flamand dut|nld|nl|Dutch; Flemish|néerlandais; flamand dyu|||Dyula|dioula dzo||dz|Dzongkha|dzongkha efi|||Efik|efik egy|||Egyptian (Ancient)|égyptien eka|||Ekajuk|ekajuk elx|||Elamite|élamite eng||en|English|anglais enm|||English, Middle (1100-1500)|anglais moyen (1100-1500) epo||eo|Esperanto|espéranto est||et|Estonian|estonien ewe||ee|Ewe|éwé ewo|||Ewondo|éwondo fan|||Fang|fang fao||fo|Faroese|féroïen fat|||Fanti|fanti fij||fj|Fijian|fidjien fil|||Filipino; Pilipino|filipino; pilipino fin||fi|Finnish|finnois fiu|||Finno-Ugrian (Other)|finno-ougriennes, autres langues fon|||Fon|fon fre|fra|fr|French|français frm|||French, Middle (ca.1400-1800)|français moyen (1400-1800) fro|||French, Old (842-ca.1400)|français ancien (842-ca.1400) fry||fy|Frisian|frison ful||ff|Fulah|peul fur|||Friulian|frioulan gaa|||Ga|ga gay|||Gayo|gayo gba|||Gbaya|gbaya gem|||Germanic (Other)|germaniques, autres langues geo|kat|ka|Georgian|géorgien geo|kat|ka|Georgian|géorgien ger|deu|de|German|allemand ger|deu|de|German|allemand gez|||Geez|guèze gil|||Gilbertese|kiribati gla||gd|Gaelic; Scottish Gaelic|gaélique; gaélique écossais gle||ga|Irish|irlandais glg||gl|Gallegan|galicien glv||gv|Manx|manx; mannois gmh|||German, Middle High (ca.1050-1500)|allemand, moyen haut (ca. 1050-1500) goh|||German, Old High (ca.750-1050)|allemand, vieux haut (ca. 750-1050) gon|||Gondi|gond gor|||Gorontalo|gorontalo got|||Gothic|gothique grb|||Grebo|grebo grc|||Greek, Ancient (to 1453)|grec ancien (jusqu'à 1453) gre|ell|el|Greek, Modern (1453-)|grec moderne (après 1453) gre|ell|el|Greek, Modern (1453-)|grec moderne (après 1453) grn||gn|Guarani|guarani guj||gu|Gujarati|goudjrati gwi|||Gwich´in|gwich´in hai|||Haida|haida hat||ht|Haitian; Haitian Creole|haïtien; créole haïtien hau||ha|Hausa|haoussa haw|||Hawaiian|hawaïen heb||he|Hebrew|hébreu her||hz|Herero|herero hil|||Hiligaynon|hiligaynon him|||Himachali|himachali hin||hi|Hindi|hindi hit|||Hittite|hittite hmn|||Hmong|hmong hmo||ho|Hiri Motu|hiri motu hsb|||Upper Sorbian|haut-sorabe hun||hu|Hungarian|hongrois hup|||Hupa|hupa iba|||Iban|iban ibo||ig|Igbo|igbo ice|isl|is|Icelandic|islandais ice|isl|is|Icelandic|islandais ido||io|Ido|ido iii||ii|Sichuan Yi|yi de Sichuan ijo|||Ijo|ijo iku||iu|Inuktitut|inuktitut ile||ie|Interlingue|interlingue ilo|||Iloko|ilocano ina||ia|Interlingua (International Auxiliary Language Association)|interlingua (langue auxiliaire internationale) inc|||Indic (Other)|indo-aryennes, autres langues ind||id|Indonesian|indonésien ine|||Indo-European (Other)|indo-européennes, autres langues inh|||Ingush|ingouche ipk||ik|Inupiaq|inupiaq ira|||Iranian (Other)|iraniennes, autres langues iro|||Iroquoian languages|iroquoises, langues (famille) ita||it|Italian|italien jav||jv|Javanese|javanais jbo|||Lojban|lojban jpn||ja|Japanese|japonais jpr|||Judeo-Persian|judéo-persan jrb|||Judeo-Arabic|judéo-arabe kaa|||Kara-Kalpak|karakalpak kab|||Kabyle|kabyle kac|||Kachin|kachin kal||kl|Kalaallisut; Greenlandic|groenlandais kam|||Kamba|kamba kan||kn|Kannada|kannada kar|||Karen|karen kas||ks|Kashmiri|kashmiri kau||kr|Kanuri|kanouri kaw|||Kawi|kawi kaz||kk|Kazakh|kazakh kbd|||Kabardian|kabardien kha|||Khasi|khasi khi|||Khoisan (Other)|khoisan, autres langues khm||km|Khmer|khmer kho|||Khotanese|khotanais kik||ki|Kikuyu; Gikuyu|kikuyu kin||rw|Kinyarwanda|rwanda kir||ky|Kirghiz|kirghize kmb|||Kimbundu|kimbundu kok|||Konkani|konkani kom||kv|Komi|kom kon||kg|Kongo|kongo kor||ko|Korean|coréen kos|||Kosraean|kosrae kpe|||Kpelle|kpellé krc|||Karachay-Balkar|karatchai balkar kro|||Kru|krou kru|||Kurukh|kurukh kua||kj|Kuanyama; Kwanyama|kuanyama; kwanyama kum|||Kumyk|koumyk kur||ku|Kurdish|kurde kut|||Kutenai|kutenai lad|||Ladino|judéo-espagnol lah|||Lahnda|lahnda lam|||Lamba|lamba lao||lo|Lao|lao lat||la|Latin|latin lav||lv|Latvian|letton lez|||Lezghian|lezghien lim||li|Limburgan; Limburger; Limburgish|limbourgeois lin||ln|Lingala|lingala lit||lt|Lithuanian|lituanien lol|||Mongo|mongo loz|||Lozi|lozi ltz||lb|Luxembourgish; Letzeburgesch|luxembourgeois lua|||Luba-Lulua|luba-lulua lub||lu|Luba-Katanga|luba-katanga lug||lg|Ganda|ganda lui|||Luiseno|luiseno lun|||Lunda|lunda luo|||Luo (Kenya and Tanzania)|luo (Kenya et Tanzanie) lus|||lushai|Lushai mac|mkd|mk|Macedonian|macédonien mac|mkd|mk|Macedonian|macédonien mad|||Madurese|madourais mag|||Magahi|magahi mah||mh|Marshallese|marshall mai|||Maithili|maithili mak|||Makasar|makassar mal||ml|Malayalam|malayalam man|||Mandingo|mandingue mao|mri|mi|Maori|maori mao|mri|mi|Maori|maori map|||Austronesian (Other)|malayo-polynésiennes, autres langues mar||mr|Marathi|marathe mas|||Masai|massaï may|msa|ms|Malay|malais may|msa|ms|Malay|malais mdf|||Moksha|moksa mdr|||Mandar|mandar men|||Mende|mendé mga|||Irish, Middle (900-1200)|irlandais moyen (900-1200) mic|||Mi'kmaq; Micmac|mi'kmaq; micmac min|||Minangkabau|minangkabau mis|||Miscellaneous languages|diverses, langues mkh|||Mon-Khmer (Other)|môn-khmer, autres langues mlg||mg|Malagasy|malgache mlt||mt|Maltese|maltais mnc|||Manchu|mandchou mni|||Manipuri|manipuri mno|||Manobo languages|manobo, langues moh|||Mohawk|mohawk mol||mo|Moldavian|moldave mon||mn|Mongolian|mongol mos|||Mossi|moré mul|||Multiple languages|multilingue mun|||Munda languages|mounda, langues mus|||Creek|muskogee mwl|||Mirandese|mirandais mwr|||Marwari|marvari myn|||Mayan languages|maya, langues myv|||Erzya|erza nah|||Nahuatl|nahuatl nai|||North American Indian|indiennes d'Amérique du Nord, autres langues nap|||Neapolitan|napolitain nau||na|Nauru|nauruan nav||nv|Navajo; Navaho|navaho nbl||nr|Ndebele, South; South Ndebele|ndébélé du Sud nde||nd|Ndebele, North; North Ndebele|ndébélé du Nord ndo||ng|Ndonga|ndonga nds|||Low German; Low Saxon; German, Low; Saxon, Low|bas allemand; bas saxon; allemand, bas; saxon, bas nep||ne|Nepali|népalais new|||Nepal Bhasa; Newari|nepal bhasa; newari nia|||Nias|nias nic|||Niger-Kordofanian (Other)|nigéro-congolaises, autres langues niu|||Niuean|niué nno||nn|Norwegian Nynorsk|norvégien nynorsk nob||nb|Norwegian Bokmål|norvégien bokmål nog|||Nogai|nogaï; nogay non|||Norse, Old|norrois, vieux nor||no|Norwegian|norvégien nso|||Northern Sotho; Pedi; Sepedi|sotho du Nord; pedi; sepedi nub|||Nubian languages|nubiennes, langues nwc|||Classical Newari; Old Newari; Classical Nepal Bhasa|newari classique nya||ny|Chichewa; Chewa; Nyanja|chichewa; chewa; nyanja nym|||Nyamwezi|nyamwezi nyn|||Nyankole|nyankolé nyo|||Nyoro|nyoro nzi|||Nzima|nzema oci||oc|Occitan (post 1500); Provençal|occitan (après 1500); provençal oji||oj|Ojibwa|ojibwa ori||or|Oriya|oriya orm||om|Oromo|galla osa|||Osage|osage oss||os|Ossetian; Ossetic|ossète ota|||Turkish, Ottoman (1500-1928)|turc ottoman (1500-1928) oto|||Otomian languages|otomangue, langues paa|||Papuan (Other)|papoues, autres langues pag|||Pangasinan|pangasinan pal|||Pahlavi|pahlavi pam|||Pampanga|pampangan pan||pa|Panjabi; Punjabi|pendjabi pap|||Papiamento|papiamento pau|||Palauan|palau peo|||Persian, Old (ca.600-400 B.C.)|perse, vieux (ca. 600-400 av. J.-C.) per|fas|fa|Persian|persan per|fas|fa|Persian|persan phi|||Philippine (Other)|philippines, autres langues phn|||Phoenician|phénicien pli||pi|Pali|pali pol||pl|Polish|polonais pon|||Pohnpeian|pohnpei por||pt|Portuguese|portugais pra|||Prakrit languages|prâkrit pro|||Provençal, Old (to 1500)|provençal ancien (jusqu'à 1500) pus||ps|Pushto|pachto qaa-qtz |||Reserved for local use|réservée à l'usage local que||qu|Quechua|quechua raj|||Rajasthani|rajasthani rap|||Rapanui|rapanui rar|||Rarotongan|rarotonga roa|||Romance (Other)|romanes, autres langues roh||rm|Raeto-Romance|rhéto-roman rom|||Romany|tsigane rum|ron|ro|Romanian|roumain run||rn|Rundi|rundi rus||ru|Russian|russe sad|||Sandawe|sandawe sag||sg|Sango|sango sah|||Yakut|iakoute sai|||South American Indian (Other)|indiennes d'Amérique du Sud, autres langues sal|||Salishan languages|salish, langues sam|||Samaritan Aramaic|samaritain san||sa|Sanskrit|sanskrit sas|||Sasak|sasak sat|||Santali|santal scc|srp|sr|Serbian|serbe scc|srp|sr|Serbian|serbe scn|||Sicilian|sicilien sco|||Scots|écossais scr|hrv|hr|Croatian|croate scr|hrv|hr|Croatian|croate sel|||Selkup|selkoupe sem|||Semitic (Other)|sémitiques, autres langues sga|||Irish, Old (to 900)|irlandais ancien (jusqu'à 900) sgn|||Sign Languages|langues des signes shn|||Shan|chan sid|||Sidamo|sidamo sin||si|Sinhala; Sinhalese|singhalais sio|||Siouan languages|sioux, langues sit|||Sino-Tibetan (Other)|sino-tibétaines, autres langues sla|||Slavic (Other)|slaves, autres langues slo|slk|sk|Slovak|slovaque slv||sl|Slovenian|slovène sma|||Southern Sami|sami du Sud sme||se|Northern Sami|sami du Nord smi|||Sami languages (Other)|sami, autres langues smj|||Lule Sami|sami de Lule smn|||Inari Sami|sami d'Inari smo||sm|Samoan|samoan sms|||Skolt Sami|sami skolt sna||sn|Shona|shona snd||sd|Sindhi|sindhi snk|||Soninke|soninké sog|||Sogdian|sogdien som||so|Somali|somali son|||Songhai|songhai sot||st|Sotho, Southern|sotho du Sud spa||es|Spanish; Castilian|espagnol; castillan srd||sc|Sardinian|sarde srr|||Serer|sérère ssa|||Nilo-Saharan (Other)|nilo-sahariennes, autres langues ssw||ss|Swati|swati suk|||Sukuma|sukuma sun||su|Sundanese|soundanais sus|||Susu|soussou sux|||Sumerian|sumérien swa||sw|Swahili|swahili swe||sv|Swedish|suédois syr|||Syriac|syriaque tah||ty|Tahitian|tahitien tai|||Tai (Other)|thaïes, autres langues tam||ta|Tamil|tamoul tat||tt|Tatar|tatar tel||te|Telugu|télougou tem|||Timne|temne ter|||Tereno|tereno tet|||Tetum|tetum tgk||tg|Tajik|tadjik tgl||tl|Tagalog|tagalog tha||th|Thai|thaï tib|bod|bo|Tibetan|tibétain tib|bod|bo|Tibetan|tibétain tig|||Tigre|tigré tir||ti|Tigrinya|tigrigna tiv|||Tiv|tiv tkl|||Tokelau|tokelau tlh|||Klingon; tlhIngan-Hol|klingon tli|||Tlingit|tlingit tmh|||Tamashek|tamacheq tog|||Tonga (Nyasa)|tonga (Nyasa) ton||to|Tonga (Tonga Islands)|tongan (Îles Tonga) tpi|||Tok Pisin|tok pisin tsi|||Tsimshian|tsimshian tsn||tn|Tswana|tswana tso||ts|Tsonga|tsonga tuk||tk|Turkmen|turkmène tum|||Tumbuka|tumbuka tup|||Tupi languages|tupi, langues tur||tr|Turkish|turc tut|||Altaic (Other)|altaïques, autres langues tvl|||Tuvalu|tuvalu twi||tw|Twi|twi tyv|||Tuvinian|touva udm|||Udmurt|oudmourte uga|||Ugaritic|ougaritique uig||ug|Uighur; Uyghur|ouïgour ukr||uk|Ukrainian|ukrainien umb|||Umbundu|umbundu und|||Undetermined|indéterminée urd||ur|Urdu|ourdou uzb||uz|Uzbek|ouszbek vai|||Vai|vaï ven||ve|Venda|venda vie||vi|Vietnamese|vietnamien vol||vo|Volapük|volapük vot|||Votic|vote wak|||Wakashan languages|wakashennes, langues wal|||Walamo|walamo war|||Waray|waray was|||Washo|washo wel|cym|cy|Welsh|gallois wel|cym|cy|Welsh|gallois wen|||Sorbian languages|sorabes, langues wln||wa|Walloon|wallon wol||wo|Wolof|wolof xal|||Kalmyk|kalmouk xho||xh|Xhosa|xhosa yao|||Yao|yao yap|||Yapese|yapois yid||yi|Yiddish|yiddish yor||yo|Yoruba|yoruba ypk|||Yupik languages|yupik, langues zap|||Zapotec|zapotèque zen|||Zenaga|zenaga zha||za|Zhuang; Chuang|zhuang; chuang znd|||Zande|zandé zul||zu|Zulu|zoulou zun|||Zuni|zuni libtranslate-0.99/data/rfc3066.sh000755 001750 001750 00000004005 10172766146 020247 0ustar00jylefortjylefort000000 000000 #!/bin/sh # # rfc3066.sh - convert the ISO639-2 language table to a RFC 3066 table # # Copyright (C) 2005 Jean-Yves Lefort # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. Neither the name of Jean-Yves Lefort nor the names of its contributors # may be used to endorse or promote products derived from this software # without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND # CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, # INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE # DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS # BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, # EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED # TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON # ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, # OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY # OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. IFS="|" uniq | while read alpha3_bibliographic alpha3_terminologic alpha2 english_name french_name; do # use rules from RFC 3066 2.3 if [ -n "$alpha2" ]; then tag="$alpha2" elif [ -n "$alpha3_terminologic" ]; then tag="$alpha3_terminologic" elif [ -n "$alpha3_bibliographic" ]; then tag="$alpha3_bibliographic" else tag="" fi [ -n "$tag" ] && echo "$tag|$english_name|$french_name" done libtranslate-0.99/data/services.dtd000644 001750 001750 00000005613 10172766606 021146 0ustar00jylefortjylefort000000 000000 libtranslate-0.99/data/services.xml.in000644 001750 001750 00000026545 10172766703 021605 0ustar00jylefortjylefort000000 000000 libtranslate-0.99/docs000777 001750 001750 00000000000 10176431055 016554 5ustar00jylefortjylefort000000 000000 libtranslate-0.99/docs/man000777 001750 001750 00000000000 10176431054 017326 5ustar00jylefortjylefort000000 000000 libtranslate-0.99/docs/man/Makefile.am000644 001750 001750 00000001146 10172242124 021431 0ustar00jylefortjylefort000000 000000 if WITH_GENERIC services_xml_5 = services.xml.5 endif man_MANS = translate.1 $(services_xml_5) translate.1: translate.1.xml xsltproc /usr/local/share/xsl/docbook/manpages/docbook.xsl $< services.xml.5.in: services.xml.5.xml xsltproc /usr/local/share/xsl/docbook/manpages/docbook.xsl $< mv services.xml.5 services.xml.5.in services.xml.5: services.xml.5.in sed -e 's,@pkgdatadir\@,$(pkgdatadir),g' $< > $@ MAINTAINERCLEANFILES = translate.1 services.xml.5.in DISTCLEANFILES = version.xml CLEANFILES = services.xml.5 EXTRA_DIST = \ services.xml.5.in \ services.xml.5.xml \ translate.1.xml \ translate.1 libtranslate-0.99/docs/man/Makefile.in000644 001750 001750 00000035424 10176430640 021456 0ustar00jylefortjylefort000000 000000 # Makefile.in generated by automake 1.9.2 from Makefile.am. # @configure_input@ # Copyright (C) 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001, 2002, # 2003, 2004 Free Software Foundation, Inc. # This Makefile.in is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY, to the extent permitted by law; without # even the implied warranty of MERCHANTABILITY or FITNESS FOR A # PARTICULAR PURPOSE. @SET_MAKE@ srcdir = @srcdir@ top_srcdir = @top_srcdir@ VPATH = @srcdir@ pkgdatadir = $(datadir)/@PACKAGE@ pkglibdir = $(libdir)/@PACKAGE@ pkgincludedir = $(includedir)/@PACKAGE@ top_builddir = ../.. am__cd = CDPATH="$${ZSH_VERSION+.}$(PATH_SEPARATOR)" && cd INSTALL = @INSTALL@ install_sh_DATA = $(install_sh) -c -m 644 install_sh_PROGRAM = $(install_sh) -c install_sh_SCRIPT = $(install_sh) -c INSTALL_HEADER = $(INSTALL_DATA) transform = $(program_transform_name) NORMAL_INSTALL = : PRE_INSTALL = : POST_INSTALL = : NORMAL_UNINSTALL = : PRE_UNINSTALL = : POST_UNINSTALL = : build_triplet = @build@ host_triplet = @host@ subdir = docs/man DIST_COMMON = $(srcdir)/Makefile.am $(srcdir)/Makefile.in \ $(srcdir)/version.xml.in ACLOCAL_M4 = $(top_srcdir)/aclocal.m4 am__aclocal_m4_deps = $(top_srcdir)/m4/talkfilters.m4 \ $(top_srcdir)/acinclude.m4 $(top_srcdir)/configure.ac am__configure_deps = $(am__aclocal_m4_deps) $(CONFIGURE_DEPENDENCIES) \ $(ACLOCAL_M4) mkinstalldirs = $(SHELL) $(top_srcdir)/mkinstalldirs CONFIG_HEADER = $(top_builddir)/config.h CONFIG_CLEAN_FILES = version.xml SOURCES = DIST_SOURCES = man1dir = $(mandir)/man1 am__installdirs = "$(DESTDIR)$(man1dir)" "$(DESTDIR)$(man5dir)" man5dir = $(mandir)/man5 NROFF = nroff MANS = $(man_MANS) DISTFILES = $(DIST_COMMON) $(DIST_SOURCES) $(TEXINFOS) $(EXTRA_DIST) ACLOCAL = @ACLOCAL@ AMDEP_FALSE = @AMDEP_FALSE@ AMDEP_TRUE = @AMDEP_TRUE@ AMTAR = @AMTAR@ AR = @AR@ AUTOCONF = @AUTOCONF@ AUTOHEADER = @AUTOHEADER@ AUTOMAKE = @AUTOMAKE@ AWK = @AWK@ CATALOGS = @CATALOGS@ CATOBJEXT = @CATOBJEXT@ CC = @CC@ CCDEPMODE = @CCDEPMODE@ CFLAGS = @CFLAGS@ CPP = @CPP@ CPPFLAGS = @CPPFLAGS@ CXX = @CXX@ CXXCPP = @CXXCPP@ CXXDEPMODE = @CXXDEPMODE@ CXXFLAGS = @CXXFLAGS@ CYGPATH_W = @CYGPATH_W@ DATADIRNAME = @DATADIRNAME@ DEFS = @DEFS@ DEPDIR = @DEPDIR@ ECHO = @ECHO@ ECHO_C = @ECHO_C@ ECHO_N = @ECHO_N@ ECHO_T = @ECHO_T@ EGREP = @EGREP@ ENABLE_GTK_DOC_FALSE = @ENABLE_GTK_DOC_FALSE@ ENABLE_GTK_DOC_TRUE = @ENABLE_GTK_DOC_TRUE@ EXEEXT = @EXEEXT@ F77 = @F77@ FFLAGS = @FFLAGS@ GETTEXT_PACKAGE = @GETTEXT_PACKAGE@ GLIB_CFLAGS = @GLIB_CFLAGS@ GLIB_LIBS = @GLIB_LIBS@ GMOFILES = @GMOFILES@ GMSGFMT = @GMSGFMT@ GTK_DOC_USE_LIBTOOL_FALSE = @GTK_DOC_USE_LIBTOOL_FALSE@ GTK_DOC_USE_LIBTOOL_TRUE = @GTK_DOC_USE_LIBTOOL_TRUE@ HTML_DIR = @HTML_DIR@ ICONV = @ICONV@ INSTALL_DATA = @INSTALL_DATA@ INSTALL_PROGRAM = @INSTALL_PROGRAM@ INSTALL_SCRIPT = @INSTALL_SCRIPT@ INSTALL_STRIP_PROGRAM = @INSTALL_STRIP_PROGRAM@ INSTOBJEXT = @INSTOBJEXT@ INTLLIBS = @INTLLIBS@ INTLTOOL_CAVES_RULE = @INTLTOOL_CAVES_RULE@ INTLTOOL_DESKTOP_RULE = @INTLTOOL_DESKTOP_RULE@ INTLTOOL_DIRECTORY_RULE = @INTLTOOL_DIRECTORY_RULE@ INTLTOOL_EXTRACT = @INTLTOOL_EXTRACT@ INTLTOOL_KBD_RULE = @INTLTOOL_KBD_RULE@ INTLTOOL_KEYS_RULE = @INTLTOOL_KEYS_RULE@ INTLTOOL_MERGE = @INTLTOOL_MERGE@ INTLTOOL_OAF_RULE = @INTLTOOL_OAF_RULE@ INTLTOOL_PERL = @INTLTOOL_PERL@ INTLTOOL_PONG_RULE = @INTLTOOL_PONG_RULE@ INTLTOOL_PROP_RULE = @INTLTOOL_PROP_RULE@ INTLTOOL_SCHEMAS_RULE = @INTLTOOL_SCHEMAS_RULE@ INTLTOOL_SERVER_RULE = @INTLTOOL_SERVER_RULE@ INTLTOOL_SHEET_RULE = @INTLTOOL_SHEET_RULE@ INTLTOOL_SOUNDLIST_RULE = @INTLTOOL_SOUNDLIST_RULE@ INTLTOOL_THEME_RULE = @INTLTOOL_THEME_RULE@ INTLTOOL_UI_RULE = @INTLTOOL_UI_RULE@ INTLTOOL_UPDATE = @INTLTOOL_UPDATE@ INTLTOOL_XAM_RULE = @INTLTOOL_XAM_RULE@ INTLTOOL_XML_NOMERGE_RULE = @INTLTOOL_XML_NOMERGE_RULE@ INTLTOOL_XML_RULE = @INTLTOOL_XML_RULE@ LDFLAGS = @LDFLAGS@ LIBOBJS = @LIBOBJS@ LIBS = @LIBS@ LIBTOOL = @LIBTOOL@ LIBXML_CFLAGS = @LIBXML_CFLAGS@ LIBXML_LIBS = @LIBXML_LIBS@ LN_S = @LN_S@ LTLIBOBJS = @LTLIBOBJS@ MAINT = @MAINT@ MAINTAINER_MODE_FALSE = @MAINTAINER_MODE_FALSE@ MAINTAINER_MODE_TRUE = @MAINTAINER_MODE_TRUE@ MAKEINFO = @MAKEINFO@ MKINSTALLDIRS = @MKINSTALLDIRS@ MSGFMT = @MSGFMT@ MSGMERGE = @MSGMERGE@ OBJEXT = @OBJEXT@ PACKAGE = @PACKAGE@ PACKAGE_BUGREPORT = @PACKAGE_BUGREPORT@ PACKAGE_NAME = @PACKAGE_NAME@ PACKAGE_STRING = @PACKAGE_STRING@ PACKAGE_TARNAME = @PACKAGE_TARNAME@ PACKAGE_VERSION = @PACKAGE_VERSION@ PATH_SEPARATOR = @PATH_SEPARATOR@ PKG_CONFIG = @PKG_CONFIG@ POFILES = @POFILES@ POSUB = @POSUB@ PO_IN_DATADIR_FALSE = @PO_IN_DATADIR_FALSE@ PO_IN_DATADIR_TRUE = @PO_IN_DATADIR_TRUE@ RANLIB = @RANLIB@ SET_MAKE = @SET_MAKE@ SHELL = @SHELL@ SOUP_CFLAGS = @SOUP_CFLAGS@ SOUP_LIBS = @SOUP_LIBS@ STRIP = @STRIP@ TALKFILTERS_CFLAGS = @TALKFILTERS_CFLAGS@ TALKFILTERS_LIBS = @TALKFILTERS_LIBS@ USE_NLS = @USE_NLS@ VERSION = @VERSION@ WARN_CFLAGS = @WARN_CFLAGS@ WITH_GENERIC_FALSE = @WITH_GENERIC_FALSE@ WITH_GENERIC_TRUE = @WITH_GENERIC_TRUE@ WITH_REGRESSION_TESTS_FALSE = @WITH_REGRESSION_TESTS_FALSE@ WITH_REGRESSION_TESTS_TRUE = @WITH_REGRESSION_TESTS_TRUE@ WITH_TALKFILTERS_FALSE = @WITH_TALKFILTERS_FALSE@ WITH_TALKFILTERS_TRUE = @WITH_TALKFILTERS_TRUE@ XGETTEXT = @XGETTEXT@ ac_ct_AR = @ac_ct_AR@ ac_ct_CC = @ac_ct_CC@ ac_ct_CXX = @ac_ct_CXX@ ac_ct_F77 = @ac_ct_F77@ ac_ct_RANLIB = @ac_ct_RANLIB@ ac_ct_STRIP = @ac_ct_STRIP@ am__fastdepCC_FALSE = @am__fastdepCC_FALSE@ am__fastdepCC_TRUE = @am__fastdepCC_TRUE@ am__fastdepCXX_FALSE = @am__fastdepCXX_FALSE@ am__fastdepCXX_TRUE = @am__fastdepCXX_TRUE@ am__include = @am__include@ am__leading_dot = @am__leading_dot@ am__quote = @am__quote@ am__tar = @am__tar@ am__untar = @am__untar@ bindir = @bindir@ build = @build@ build_alias = @build_alias@ build_cpu = @build_cpu@ build_os = @build_os@ build_vendor = @build_vendor@ datadir = @datadir@ exec_prefix = @exec_prefix@ host = @host@ host_alias = @host_alias@ host_cpu = @host_cpu@ host_os = @host_os@ host_vendor = @host_vendor@ includedir = @includedir@ infodir = @infodir@ install_sh = @install_sh@ libdir = @libdir@ libexecdir = @libexecdir@ localstatedir = @localstatedir@ mandir = @mandir@ mkdir_p = @mkdir_p@ oldincludedir = @oldincludedir@ prefix = @prefix@ program_transform_name = @program_transform_name@ sbindir = @sbindir@ sharedstatedir = @sharedstatedir@ sysconfdir = @sysconfdir@ target_alias = @target_alias@ @WITH_GENERIC_TRUE@services_xml_5 = services.xml.5 man_MANS = translate.1 $(services_xml_5) MAINTAINERCLEANFILES = translate.1 services.xml.5.in DISTCLEANFILES = version.xml CLEANFILES = services.xml.5 EXTRA_DIST = \ services.xml.5.in \ services.xml.5.xml \ translate.1.xml \ translate.1 all: all-am .SUFFIXES: $(srcdir)/Makefile.in: @MAINTAINER_MODE_TRUE@ $(srcdir)/Makefile.am $(am__configure_deps) @for dep in $?; do \ case '$(am__configure_deps)' in \ *$$dep*) \ cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh \ && exit 0; \ exit 1;; \ esac; \ done; \ echo ' cd $(top_srcdir) && $(AUTOMAKE) --foreign docs/man/Makefile'; \ cd $(top_srcdir) && \ $(AUTOMAKE) --foreign docs/man/Makefile .PRECIOUS: Makefile Makefile: $(srcdir)/Makefile.in $(top_builddir)/config.status @case '$?' in \ *config.status*) \ cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh;; \ *) \ echo ' cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe)'; \ cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe);; \ esac; $(top_builddir)/config.status: $(top_srcdir)/configure $(CONFIG_STATUS_DEPENDENCIES) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh $(top_srcdir)/configure: @MAINTAINER_MODE_TRUE@ $(am__configure_deps) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh $(ACLOCAL_M4): @MAINTAINER_MODE_TRUE@ $(am__aclocal_m4_deps) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh version.xml: $(top_builddir)/config.status $(srcdir)/version.xml.in cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ mostlyclean-libtool: -rm -f *.lo clean-libtool: -rm -rf .libs _libs distclean-libtool: -rm -f libtool uninstall-info-am: install-man1: $(man1_MANS) $(man_MANS) @$(NORMAL_INSTALL) test -z "$(man1dir)" || $(mkdir_p) "$(DESTDIR)$(man1dir)" @list='$(man1_MANS) $(dist_man1_MANS) $(nodist_man1_MANS)'; \ l2='$(man_MANS) $(dist_man_MANS) $(nodist_man_MANS)'; \ for i in $$l2; do \ case "$$i" in \ *.1*) list="$$list $$i" ;; \ esac; \ done; \ for i in $$list; do \ if test -f $(srcdir)/$$i; then file=$(srcdir)/$$i; \ else file=$$i; fi; \ ext=`echo $$i | sed -e 's/^.*\\.//'`; \ case "$$ext" in \ 1*) ;; \ *) ext='1' ;; \ esac; \ inst=`echo $$i | sed -e 's/\\.[0-9a-z]*$$//'`; \ inst=`echo $$inst | sed -e 's/^.*\///'`; \ inst=`echo $$inst | sed '$(transform)'`.$$ext; \ echo " $(INSTALL_DATA) '$$file' '$(DESTDIR)$(man1dir)/$$inst'"; \ $(INSTALL_DATA) "$$file" "$(DESTDIR)$(man1dir)/$$inst"; \ done uninstall-man1: @$(NORMAL_UNINSTALL) @list='$(man1_MANS) $(dist_man1_MANS) $(nodist_man1_MANS)'; \ l2='$(man_MANS) $(dist_man_MANS) $(nodist_man_MANS)'; \ for i in $$l2; do \ case "$$i" in \ *.1*) list="$$list $$i" ;; \ esac; \ done; \ for i in $$list; do \ ext=`echo $$i | sed -e 's/^.*\\.//'`; \ case "$$ext" in \ 1*) ;; \ *) ext='1' ;; \ esac; \ inst=`echo $$i | sed -e 's/\\.[0-9a-z]*$$//'`; \ inst=`echo $$inst | sed -e 's/^.*\///'`; \ inst=`echo $$inst | sed '$(transform)'`.$$ext; \ echo " rm -f '$(DESTDIR)$(man1dir)/$$inst'"; \ rm -f "$(DESTDIR)$(man1dir)/$$inst"; \ done install-man5: $(man5_MANS) $(man_MANS) @$(NORMAL_INSTALL) test -z "$(man5dir)" || $(mkdir_p) "$(DESTDIR)$(man5dir)" @list='$(man5_MANS) $(dist_man5_MANS) $(nodist_man5_MANS)'; \ l2='$(man_MANS) $(dist_man_MANS) $(nodist_man_MANS)'; \ for i in $$l2; do \ case "$$i" in \ *.5*) list="$$list $$i" ;; \ esac; \ done; \ for i in $$list; do \ if test -f $(srcdir)/$$i; then file=$(srcdir)/$$i; \ else file=$$i; fi; \ ext=`echo $$i | sed -e 's/^.*\\.//'`; \ case "$$ext" in \ 5*) ;; \ *) ext='5' ;; \ esac; \ inst=`echo $$i | sed -e 's/\\.[0-9a-z]*$$//'`; \ inst=`echo $$inst | sed -e 's/^.*\///'`; \ inst=`echo $$inst | sed '$(transform)'`.$$ext; \ echo " $(INSTALL_DATA) '$$file' '$(DESTDIR)$(man5dir)/$$inst'"; \ $(INSTALL_DATA) "$$file" "$(DESTDIR)$(man5dir)/$$inst"; \ done uninstall-man5: @$(NORMAL_UNINSTALL) @list='$(man5_MANS) $(dist_man5_MANS) $(nodist_man5_MANS)'; \ l2='$(man_MANS) $(dist_man_MANS) $(nodist_man_MANS)'; \ for i in $$l2; do \ case "$$i" in \ *.5*) list="$$list $$i" ;; \ esac; \ done; \ for i in $$list; do \ ext=`echo $$i | sed -e 's/^.*\\.//'`; \ case "$$ext" in \ 5*) ;; \ *) ext='5' ;; \ esac; \ inst=`echo $$i | sed -e 's/\\.[0-9a-z]*$$//'`; \ inst=`echo $$inst | sed -e 's/^.*\///'`; \ inst=`echo $$inst | sed '$(transform)'`.$$ext; \ echo " rm -f '$(DESTDIR)$(man5dir)/$$inst'"; \ rm -f "$(DESTDIR)$(man5dir)/$$inst"; \ done tags: TAGS TAGS: ctags: CTAGS CTAGS: distdir: $(DISTFILES) @srcdirstrip=`echo "$(srcdir)" | sed 's|.|.|g'`; \ topsrcdirstrip=`echo "$(top_srcdir)" | sed 's|.|.|g'`; \ list='$(DISTFILES)'; for file in $$list; do \ case $$file in \ $(srcdir)/*) file=`echo "$$file" | sed "s|^$$srcdirstrip/||"`;; \ $(top_srcdir)/*) file=`echo "$$file" | sed "s|^$$topsrcdirstrip/|$(top_builddir)/|"`;; \ esac; \ if test -f $$file || test -d $$file; then d=.; else d=$(srcdir); fi; \ dir=`echo "$$file" | sed -e 's,/[^/]*$$,,'`; \ if test "$$dir" != "$$file" && test "$$dir" != "."; then \ dir="/$$dir"; \ $(mkdir_p) "$(distdir)$$dir"; \ else \ dir=''; \ fi; \ if test -d $$d/$$file; then \ if test -d $(srcdir)/$$file && test $$d != $(srcdir); then \ cp -pR $(srcdir)/$$file $(distdir)$$dir || exit 1; \ fi; \ cp -pR $$d/$$file $(distdir)$$dir || exit 1; \ else \ test -f $(distdir)/$$file \ || cp -p $$d/$$file $(distdir)/$$file \ || exit 1; \ fi; \ done check-am: all-am check: check-am all-am: Makefile $(MANS) installdirs: for dir in "$(DESTDIR)$(man1dir)" "$(DESTDIR)$(man5dir)"; do \ test -z "$$dir" || $(mkdir_p) "$$dir"; \ done install: install-am install-exec: install-exec-am install-data: install-data-am uninstall: uninstall-am install-am: all-am @$(MAKE) $(AM_MAKEFLAGS) install-exec-am install-data-am installcheck: installcheck-am install-strip: $(MAKE) $(AM_MAKEFLAGS) INSTALL_PROGRAM="$(INSTALL_STRIP_PROGRAM)" \ install_sh_PROGRAM="$(INSTALL_STRIP_PROGRAM)" INSTALL_STRIP_FLAG=-s \ `test -z '$(STRIP)' || \ echo "INSTALL_PROGRAM_ENV=STRIPPROG='$(STRIP)'"` install mostlyclean-generic: clean-generic: -test -z "$(CLEANFILES)" || rm -f $(CLEANFILES) distclean-generic: -test -z "$(CONFIG_CLEAN_FILES)" || rm -f $(CONFIG_CLEAN_FILES) -test -z "$(DISTCLEANFILES)" || rm -f $(DISTCLEANFILES) maintainer-clean-generic: @echo "This command is intended for maintainers to use" @echo "it deletes files that may require special tools to rebuild." -test -z "$(MAINTAINERCLEANFILES)" || rm -f $(MAINTAINERCLEANFILES) clean: clean-am clean-am: clean-generic clean-libtool mostlyclean-am distclean: distclean-am -rm -f Makefile distclean-am: clean-am distclean-generic distclean-libtool dvi: dvi-am dvi-am: html: html-am info: info-am info-am: install-data-am: install-man install-exec-am: install-info: install-info-am install-man: install-man1 install-man5 installcheck-am: maintainer-clean: maintainer-clean-am -rm -f Makefile maintainer-clean-am: distclean-am maintainer-clean-generic mostlyclean: mostlyclean-am mostlyclean-am: mostlyclean-generic mostlyclean-libtool pdf: pdf-am pdf-am: ps: ps-am ps-am: uninstall-am: uninstall-info-am uninstall-man uninstall-man: uninstall-man1 uninstall-man5 .PHONY: all all-am check check-am clean clean-generic clean-libtool \ distclean distclean-generic distclean-libtool distdir dvi \ dvi-am html html-am info info-am install install-am \ install-data install-data-am install-exec install-exec-am \ install-info install-info-am install-man install-man1 \ install-man5 install-strip installcheck installcheck-am \ installdirs maintainer-clean maintainer-clean-generic \ mostlyclean mostlyclean-generic mostlyclean-libtool pdf pdf-am \ ps ps-am uninstall uninstall-am uninstall-info-am \ uninstall-man uninstall-man1 uninstall-man5 translate.1: translate.1.xml xsltproc /usr/local/share/xsl/docbook/manpages/docbook.xsl $< services.xml.5.in: services.xml.5.xml xsltproc /usr/local/share/xsl/docbook/manpages/docbook.xsl $< mv services.xml.5 services.xml.5.in services.xml.5: services.xml.5.in sed -e 's,@pkgdatadir\@,$(pkgdatadir),g' $< > $@ # Tell versions [3.59,3.63) of GNU make to not export all variables. # Otherwise a system limit (for SysV at least) may be exceeded. .NOEXPORT: libtranslate-0.99/docs/man/version.xml.in000644 001750 001750 00000000011 10165037537 022213 0ustar00jylefortjylefort000000 000000 @VERSION@libtranslate-0.99/docs/man/services.xml.5.in000644 001750 001750 00000022335 10176431013 022516 0ustar00jylefortjylefort000000 000000 .\"Generated by db2man.xsl. Don't modify this, modify the source. .de Sh \" Subsection .br .if t .Sp .ne 5 .PP \fB\\$1\fR .PP .. .de Sp \" Vertical space (when we can't use .PP) .if t .sp .5v .if n .sp .. .de Ip \" List item .br .ie \\n(.$>=3 .ne \\$3 .el .ne 3 .IP "\\$1" \\$2 .. .TH "SERVICES.XML" 5 "January 15, 2005" "libtranslate 0.99" "services.xml Manual" .SH NAME services.xml \- libtranslate generic service definitions .SH "DESCRIPTION" .PP The \fIservices\&.xml\fR file contains translation service definitions for the libtranslate generic module\&. .PP The generic module provides an abstract framework for supporting web\-based translation services\&. .PP When the generic module is initialized, it reads service definitions from the \fIservices\&.xml\fR files located in \fI@pkgdatadir@\fR and \fI~/\&.libtranslate\fR, creates the services defined in these files, and makes them available to libtranslate\&. .PP The \fIservices\&.xml\fR file must be encoded in UTF\-8, and conform to the \fIservices\&.xml\fR Document Type Definition, located in \fI@pkgdatadir@/services\&.dtd\fR\&. .SH "ELEMENTS" .SS "services" .TP Description The services element is the root of the document, and may contains service definitions and language mappings\&. .TP Children These elements may occur zero or more times in services: custom\-language, service\&. .SS "custom-language" .TP Description The custom\-language element maps a RFC 3066 language tag to a language name\&. .RS .Sh "Note" Some RFC 3066 tag to name mappings are built into libtranslate and do not need to be added (see the Built\-In RFC 3066 Tag to Name Mappings appendix in the libtranslate Reference Manual)\&. .RE .TP Attributes .RS .TP \fItag\fR (required) The RFC 3066 language tag\&. .TP \fIname\fR (required) The language human\-readable name\&. .RE .IP .TP Parents This element contains custom\-language: services\&. .SS "service" .TP Description The service element defines a translation service\&. .TP Attributes .RS .TP \fIname\fR (required) The service symbolic name, encoded in ASCII\&. .TP \fInick\fR (implied, default: \fIname\fR) The service human\-readable name\&. .TP \fImax\-chunk\-len\fR (optional, default: 1000) The maximum length of an input chunk, in characters (0 means unlimited)\&. .RE .IP .TP Parents This element contains service: services\&. .TP Children This element may occur zero or more times in service: group\&. .SS "group" .TP Description The group element defines a translation group (a group represents a set of languages and translation methods)\&. .TP Parents This element contains group: service\&. .TP Children These elements may occur zero or more times in group: language, http\-header\&. These elements may occur zero or one time in group: text\-translation, web\-page\-translation\&. .SS "language" .TP Description The language element adds a language to the list of languages supported by a group\&. .TP Attributes .RS .TP \fItag\fR (required) The RFC 3066 language tag\&. .TP \fIservice\-tag\fR (implied, default: \fItag\fR) The language service\-specific tag\&. This tag is not exposed to libtranslate, but is available as \fIfrom\fR and \fIto\fR variables (see Variable Substitution)\&. .TP \fIto\fR (optional, default: none) A comma\-separated list of RFC 3066 language tags this language can be translated into\&. The special list element * means "every language of this group but this one"\&. .RE .IP .TP Parents This element contains language: group\&. .SS "http-header" .TP Description The http\-header element adds a HTTP header to the list of headers that are set when a HTTP request is issued\&. If the http\-header element occurs inside a group element, the header is added for text and web page translations\&. If it occurs inside a text\-translation or web\-page\-translation element, the header is only added for a text or web page translation, respectively\&. .TP Attributes .RS .TP \fIname\fR (required) The HTTP header name\&. .TP \fIvalue\fR (required) The HTTP header value\&. .RE .IP .TP Parents These elements contain http\-header: group, text\-translation, web\-page\-translation\&. .SS "text-translation" .TP Description The presence of the text\-translation element specifies that the group can translate text\&. .TP Attributes .RS .TP \fIurl\fR (required) The URL to use for translating text\&. Variable substitution is performed on the URL (see Variable Substitution)\&. .TP \fIpost\fR (optional, default: none) If this attribute is present, a HTTP POST request is issued (using the attribute value as post data)\&. Otherwise, a HTTP GET request is issued\&. Variable substitution is performed on the post data (see Variable Substitution)\&. .RE .IP .TP Parents This element contains text\-translation: group\&. .TP Children These element may occur zero or more times in text\-translation: http\-header, pre\-marker, error\-marker\&. This element may occur zero or one time in text\-translation: post\-marker\&. .SS "pre-marker" .TP Description The pre\-marker element is used to extract the translated text from the response to a text translation request\&. For each pre\-marker element, the parser locates \fItext\fR in the server response\&. If \fItext\fR is found, the parser moves to the character following \fItext\fR\&. If it is not found, the translation fails\&. The translated text starts at the character following the last pre\-marker match\&. If no pre\-marker element is specified, the translated text starts at the first character of the server response\&. .TP Attributes .RS .TP \fItext\fR (required) The text to match\&. .RE .IP .TP Parents This element contains pre\-marker: text\-translation\&. .SS "post-marker" .TP Description The post\-marker element is used to extract the translated text from the response to a text translation request\&. If \fItext\fR can be located in the server response, the translated text ends at the character preceding \fItext\fR\&. Otherwise, the translation fails\&. If no post\-marker element is specified, the translated text ends at the last character of the server response\&. .TP Attributes .RS .TP \fItext\fR (required) The text to match\&. .RE .IP .TP Parents This element contains post\-marker: text\-translation\&. .SS "error-marker" .TP Description The error\-marker element is used to check if a text translation error has occurred\&. If one or more error\-marker elements are specified and the \fItext\fR of any of them can be located anywhere in the server response, the translation fails\&. .TP Attributes .RS .TP \fItext\fR (required) The text to match\&. .RE .IP .TP Parents This element contains error\-marker: text\-translation\&. .SS "web-page-translation" .TP Description The presence of the web\-page\-translation element specifies that the group can translate a web page\&. If no http\-header element is specified and if \fIpost\fR is not specified, the generic module does not need to connect to the server\&. In this case, \fIurl\fR is returned as the URL of the translated web page\&. Otherwise, the generic module connects to the server, issues a HTTP GET or POST request, saves the response to a local file, and returns a file:// URL pointing to that file\&. .TP Attributes .RS .TP \fIurl\fR (required) The URL to use for translating a web page\&. Variable substitution is performed on the URL (see Variable Substitution)\&. .TP \fIpost\fR (optional, default: none) If this attribute is present, a HTTP POST request is issued (using the attribute value as post data)\&. Otherwise, a HTTP GET request is issued (or no request at all, see above)\&. Variable substitution is performed on the post data (see Variable Substitution)\&. .RE .IP .TP Parents This element contains web\-page\-translation: group\&. .TP Children This element may occur zero or more times in web\-page\-translation: http\-header\&. .SH "VARIABLE SUBSTITUTION" .PP Variable substitution is performed at translation time on the \fIurl\fR and \fIpost\fR attributes of the text\-translation and web\-page\-translation elements\&. .PP A variable has the syntax ${\fIvarname\fR[:\fImodifiers\fR]}\&. .PP \fIvarname\fR may be any of the following variables: .TP \fItext\fR (text\-translation only) The text to translate\&. .TP \fIurl\fR (web\-page\-translation only) The URL of the web page to translate\&. .TP \fIfrom\fR The source language service tag\&. .TP \fIto\fR The destination language service tag\&. .TP \fItime\fR The number of seconds since 0 hours, 0 minutes, 0 seconds, January 1, 1970, Coordinated Universal Time\&. .PP \fImodifiers\fR is a comma\-separated list of modifiers\&. Each modifier is applied (in the specified order) on the contents of the variable\&. A modifier has the syntax \fIname\fR[=\fIvalue\fR]\&. .PP \fIname\fR may be any of the following modifiers: .TP escape Escapes the unsafe characters in the variable using URI percent notation\&. .TP charset Converts the variable from UTF\-8 (the libtranslate character set) to the character set \fIvalue\fR\&. .SH "FILES" .TP \fI@pkgdatadir@/services\&.xml\fR .PP The system\-wide service definitions\&. .TP \fI~/\&.libtranslate/services\&.xml\fR .PP The user service definitions\&. .TP \fI@pkgdatadir@/services\&.dtd\fR .PP The \fIservices\&.xml\fR Document Type Definition\&. .SH "SEE ALSO" .PP The libtranslate Reference Manual .SH AUTHOR Jean\-Yves Lefort. libtranslate-0.99/docs/man/services.xml.5.xml000644 001750 001750 00000054772 10172767013 022732 0ustar00jylefortjylefort000000 000000 services.xml"> ]> services.xml 5 services.xml Manual January 15, 2005 libtranslate &version; Jean-Yves Lefort jylefort@brutele.be services.xml libtranslate generic service definitions Description The &file; file contains translation service definitions for the libtranslate generic module. The generic module provides an abstract framework for supporting web-based translation services. When the generic module is initialized, it reads service definitions from the &file; files located in @pkgdatadir@ and ~/.libtranslate, creates the services defined in these files, and makes them available to libtranslate. The &file; file must be encoded in UTF-8, and conform to the &file; Document Type Definition, located in @pkgdatadir@/services.dtd. Elements <sgmltag>services</sgmltag> Description The services element is the root of the document, and may contains service definitions and language mappings. Children These elements may occur zero or more times in services: custom-language, service. <sgmltag>custom-language</sgmltag> Description The custom-language element maps a RFC 3066 language tag to a language name. Some RFC 3066 tag to name mappings are built into libtranslate and do not need to be added (see the Built-In RFC 3066 Tag to Name Mappings appendix in the libtranslate Reference Manual). Attributes tag (required) The RFC 3066 language tag. name (required) The language human-readable name. Parents This element contains custom-language: services. <sgmltag>service</sgmltag> Description The service element defines a translation service. Attributes name (required) The service symbolic name, encoded in ASCII. nick (implied, default: name) The service human-readable name. max-chunk-len (optional, default: 1000) The maximum length of an input chunk, in characters (0 means unlimited). Parents This element contains service: services. Children This element may occur zero or more times in service: group. <sgmltag>group</sgmltag> Description The group element defines a translation group (a group represents a set of languages and translation methods). Parents This element contains group: service. Children These elements may occur zero or more times in group: language, http-header. These elements may occur zero or one time in group: text-translation, web-page-translation. <sgmltag>language</sgmltag> Description The language element adds a language to the list of languages supported by a group. Attributes tag (required) The RFC 3066 language tag. service-tag (implied, default: tag) The language service-specific tag. This tag is not exposed to libtranslate, but is available as from and to variables (see Variable Substitution). to (optional, default: none) A comma-separated list of RFC 3066 language tags this language can be translated into. The special list element * means "every language of this group but this one". Parents This element contains language: group. <sgmltag>http-header</sgmltag> Description The http-header element adds a HTTP header to the list of headers that are set when a HTTP request is issued. If the http-header element occurs inside a group element, the header is added for text and web page translations. If it occurs inside a text-translation or web-page-translation element, the header is only added for a text or web page translation, respectively. Attributes name (required) The HTTP header name. value (required) The HTTP header value. Parents These elements contain http-header: group, text-translation, web-page-translation. <sgmltag>text-translation</sgmltag> Description The presence of the text-translation element specifies that the group can translate text. Attributes url (required) The URL to use for translating text. Variable substitution is performed on the URL (see Variable Substitution). post (optional, default: none) If this attribute is present, a HTTP POST request is issued (using the attribute value as post data). Otherwise, a HTTP GET request is issued. Variable substitution is performed on the post data (see Variable Substitution). Parents This element contains text-translation: group. Children These element may occur zero or more times in text-translation: http-header, pre-marker, error-marker. This element may occur zero or one time in text-translation: post-marker. <sgmltag>pre-marker</sgmltag> Description The pre-marker element is used to extract the translated text from the response to a text translation request. For each pre-marker element, the parser locates text in the server response. If text is found, the parser moves to the character following text. If it is not found, the translation fails. The translated text starts at the character following the last pre-marker match. If no pre-marker element is specified, the translated text starts at the first character of the server response. Attributes text (required) The text to match. Parents This element contains pre-marker: text-translation. <sgmltag>post-marker</sgmltag> Description The post-marker element is used to extract the translated text from the response to a text translation request. If text can be located in the server response, the translated text ends at the character preceding text. Otherwise, the translation fails. If no post-marker element is specified, the translated text ends at the last character of the server response. Attributes text (required) The text to match. Parents This element contains post-marker: text-translation. <sgmltag>error-marker</sgmltag> Description The error-marker element is used to check if a text translation error has occurred. If one or more error-marker elements are specified and the text of any of them can be located anywhere in the server response, the translation fails. Attributes text (required) The text to match. Parents This element contains error-marker: text-translation. <sgmltag>web-page-translation</sgmltag> Description The presence of the web-page-translation element specifies that the group can translate a web page. If no http-header element is specified and if post is not specified, the generic module does not need to connect to the server. In this case, url is returned as the URL of the translated web page. Otherwise, the generic module connects to the server, issues a HTTP GET or POST request, saves the response to a local file, and returns a file:// URL pointing to that file. Attributes url (required) The URL to use for translating a web page. Variable substitution is performed on the URL (see Variable Substitution). post (optional, default: none) If this attribute is present, a HTTP POST request is issued (using the attribute value as post data). Otherwise, a HTTP GET request is issued (or no request at all, see above). Variable substitution is performed on the post data (see Variable Substitution). Parents This element contains web-page-translation: group. Children This element may occur zero or more times in web-page-translation: http-header. Variable Substitution Variable substitution is performed at translation time on the url and post attributes of the text-translation and web-page-translation elements. A variable has the syntax ${varname:modifiers}. varname may be any of the following variables: text (text-translation only) The text to translate. url (web-page-translation only) The URL of the web page to translate. from The source language service tag. to The destination language service tag. time The number of seconds since 0 hours, 0 minutes, 0 seconds, January 1, 1970, Coordinated Universal Time. modifiers is a comma-separated list of modifiers. Each modifier is applied (in the specified order) on the contents of the variable. A modifier has the syntax name=value. name may be any of the following modifiers: escape Escapes the unsafe characters in the variable using URI percent notation. charset Converts the variable from UTF-8 (the libtranslate character set) to the character set value. Files @pkgdatadir@/services.xml The system-wide service definitions. ~/.libtranslate/services.xml The user service definitions. @pkgdatadir@/services.dtd The &file; Document Type Definition. See Also The libtranslate Reference Manual libtranslate-0.99/docs/man/translate.1.xml000644 001750 001750 00000033007 10172767046 022273 0ustar00jylefortjylefort000000 000000 translate"> ]> translate 1 translate Manual January 15, 2005 libtranslate &version; Jean-Yves Lefort jylefort@brutele.be translate translate a text or web page &cmd; -? -v --list-services &cmd; -s services -f lang -t lang -l &cmd; -s services -f lang -t lang http_url https_url &cmd; -s services -f lang -t lang --max-threads=n --max-retries=n file Description &cmd; translates a text or web page. If the first synopsis form is used, &cmd; prints a quick help, the version information or the list of available translation services to standard output. If the second synopsis form is used, &cmd; prints the list of available language pairs to standard output. If the third synopsis form is used, &cmd; translates the web page pointed to by http_url or https_url, and prints the URL of the translated web page to standard output (http_url must be a string starting with http://, and https_url must be a string starting with https://). If the fourth synopsis form is used, &cmd; translates the text contained in file, and prints the translation to standard output (if file is omitted or given as a single dash, standard input is used instead). Options , Prints a quick help to standard output. , Prints version information to standard output. Lists the available translation services. services, =services Specifies the translation services to use. The services argument must be a comma-separated list of service names (default value: all the available services). The list of services determines the available language pairs. The order of the list is important, as libtranslate iterates over the list until the requested translation can be performed. , Lists the available language pairs. The and options can be used to specify a source and/or destination language filter. If neither nor is specified, all the pairs are listed. lang, =lang Specifies the source language of a translation. The lang argument must be a RFC 3066 language tag such as en or zh-TW (default value: see Language Selection). lang, =lang Specifies the destination language of a translation. The lang argument must be a RFC 3066 language tag such as en or zh-TW (default value: see Language Selection). =n Specifies the maximum number of concurrent threads to use for translating text (default value: 8). =n Specifies the maximum number of retries per text chunk (default value: 3). Language Selection Definitions: in this section, default_from is defined as the contents of the environment variable TRANSLATE_DEFAULT_FROM, or, if that variable is not set, en; default_to is defined as the contents of the environment variable TRANSLATE_DEFAULT_TO, or, if that variable is not set, fr. If the source language is not specified, it defaults to default_from, or, if the destination language is equal to default_from, default_to. If the destination language is not specified, it defaults to default_to, or, if the source language is equal to default_to, default_from. Character Set Handling Internally, libtranslate uses the UTF-8 encoding. If the input text is not encoded in UTF-8, &cmd; assumes it is encoded in the character set of the current locale, and attempts to convert it to UTF-8. If the conversion fails, &cmd; exits with an error. The output text is converted to the character set of the current locale before printing. Examples In the following examples, it is assumed that TRANSLATE_DEFAULT_FROM is set to es and that TRANSLATE_DEFAULT_TO is set to de. &cmd; fr Lists all the available language pairs where the source language is French. &cmd; document1 Translates the contents of the file document1 from Spanish to German and prints the result to standard output. &cmd; babelfish,freetranslation document1 Translates the contents of the file document1 from Spanish to German, only using the Babel Fish and FreeTranslation services, and prints the result to standard output. &cmd; de document1 Translates the contents of the file document1 from German to Spanish and prints the result to standard output. echo "Le problème est résolu." | &cmd; fr en Translates the text given on standard input from French to English and prints the result to standard output. &cmd; en http://www.freebsd.org/es/index.html Translates the web page pointed to by http://www.freebsd.org/es/index.html from Spanish to English and prints an URL pointing to the result to standard output. Diagnostics The &cmd; utility exits with a status of 0 on success, and >0 if an error occurs. Environment The following environment variables affect the execution of &cmd;: HTTP_PROXY The URL of the proxy to use for HTTP requests. http_proxy Same as HTTP_PROXY, for compatibility. TRANSLATE_DEFAULT_FROM The default source language (see Language Selection). TRANSLATE_DEFAULT_TO The default destination language (see Language Selection). See Also The libtranslate Reference Manual libtranslate-0.99/docs/man/translate.1000644 001750 001750 00000014500 10176431006 021455 0ustar00jylefortjylefort000000 000000 .\"Generated by db2man.xsl. Don't modify this, modify the source. .de Sh \" Subsection .br .if t .Sp .ne 5 .PP \fB\\$1\fR .PP .. .de Sp \" Vertical space (when we can't use .PP) .if t .sp .5v .if n .sp .. .de Ip \" List item .br .ie \\n(.$>=3 .ne \\$3 .el .ne 3 .IP "\\$1" \\$2 .. .TH "TRANSLATE" 1 "January 15, 2005" "libtranslate 0.99" "translate Manual" .SH NAME translate \- translate a text or web page .SH "SYNOPSIS" .ad l .hy 0 .HP 10 \fBtranslate\fR {\fB\-?\fR | \fB\-v\fR | \fB\-\-list\-services\fR} .ad .hy .ad l .hy 0 .HP 10 \fBtranslate\fR [\-s\ \fIservices\fR] [\-f\ \fIlang\fR] [\-t\ \fIlang\fR] {\-l} .ad .hy .ad l .hy 0 .HP 10 \fBtranslate\fR [\-s\ \fIservices\fR] [\-f\ \fIlang\fR] [\-t\ \fIlang\fR] {\fB\fIhttp_url\fR\fR | \fB\fIhttps_url\fR\fR} .ad .hy .ad l .hy 0 .HP 10 \fBtranslate\fR [\-s\ \fIservices\fR] [\-f\ \fIlang\fR] [\-t\ \fIlang\fR] [\-\-max\-threads=\fIn\fR] [\-\-max\-retries=\fIn\fR] [\fIfile\fR] .ad .hy .SH "DESCRIPTION" .PP \fBtranslate\fR translates a text or web page\&. .PP If the first synopsis form is used, \fBtranslate\fR prints a quick help, the version information or the list of available translation services to standard output\&. .PP If the second synopsis form is used, \fBtranslate\fR prints the list of available language pairs to standard output\&. .PP If the third synopsis form is used, \fBtranslate\fR translates the web page pointed to by \fIhttp_url\fR or \fIhttps_url\fR, and prints the URL of the translated web page to standard output (\fIhttp_url\fR must be a string starting with http://, and \fIhttps_url\fR must be a string starting with https://)\&. .PP If the fourth synopsis form is used, \fBtranslate\fR translates the text contained in \fIfile\fR, and prints the translation to standard output (if \fIfile\fR is omitted or given as a single dash, standard input is used instead)\&. .SH "OPTIONS" .TP \fB\-?\fR, \fB\-\-help\fR Prints a quick help to standard output\&. .TP \fB\-v\fR, \fB\-\-version\fR Prints version information to standard output\&. .TP \fB\-\-list\-services\fR Lists the available translation services\&. .TP \fB\-s\fR \fIservices\fR, \fB\-\-services\fR=\fIservices\fR Specifies the translation services to use\&. The \fIservices\fR argument must be a comma\-separated list of service names (default value: all the available services)\&. The list of services determines the available language pairs\&. The order of the list is important, as libtranslate iterates over the list until the requested translation can be performed\&. .TP \fB\-l\fR, \fB\-\-list\-pairs\fR Lists the available language pairs\&. The \fB\-f\fR and \fB\-t\fR options can be used to specify a source and/or destination language filter\&. If neither \fB\-f\fR nor \fB\-t\fR is specified, all the pairs are listed\&. .TP \fB\-f\fR \fIlang\fR, \fB\-\-from\fR=\fIlang\fR Specifies the source language of a translation\&. The \fIlang\fR argument must be a RFC 3066 language tag such as en or zh\-TW (default value: see Language Selection)\&. .TP \fB\-t\fR \fIlang\fR, \fB\-\-to\fR=\fIlang\fR Specifies the destination language of a translation\&. The \fIlang\fR argument must be a RFC 3066 language tag such as en or zh\-TW (default value: see Language Selection)\&. .TP \fB\-\-max\-threads\fR=\fIn\fR Specifies the maximum number of concurrent threads to use for translating text (default value: 8)\&. .TP \fB\-\-max\-retries\fR=\fIn\fR Specifies the maximum number of retries per text chunk (default value: 3)\&. .SH "LANGUAGE SELECTION" .PP Definitions: in this section, \fIdefault_from\fR is defined as the contents of the environment variable \fBTRANSLATE_DEFAULT_FROM\fR, or, if that variable is not set, en; \fIdefault_to\fR is defined as the contents of the environment variable \fBTRANSLATE_DEFAULT_TO\fR, or, if that variable is not set, fr\&. .PP If the source language is not specified, it defaults to \fIdefault_from\fR, or, if the destination language is equal to \fIdefault_from\fR, \fIdefault_to\fR\&. .PP If the destination language is not specified, it defaults to \fIdefault_to\fR, or, if the source language is equal to \fIdefault_to\fR, \fIdefault_from\fR\&. .SH "CHARACTER SET HANDLING" .PP Internally, libtranslate uses the UTF\-8 encoding\&. .PP If the input text is not encoded in UTF\-8, \fBtranslate\fR assumes it is encoded in the character set of the current locale, and attempts to convert it to UTF\-8\&. If the conversion fails, \fBtranslate\fR exits with an error\&. .PP The output text is converted to the character set of the current locale before printing\&. .SH "EXAMPLES" .PP In the following examples, it is assumed that \fBTRANSLATE_DEFAULT_FROM\fR is set to es and that \fBTRANSLATE_DEFAULT_TO\fR is set to de\&. .TP \fBtranslate\fR \fB\-f\fR fr \fB\-l\fR Lists all the available language pairs where the source language is French\&. .TP \fBtranslate\fR document1 Translates the contents of the file document1 from Spanish to German and prints the result to standard output\&. .TP \fBtranslate\fR \fB\-s\fR babelfish,freetranslation document1 Translates the contents of the file document1 from Spanish to German, only using the Babel Fish and FreeTranslation services, and prints the result to standard output\&. .TP \fBtranslate\fR \fB\-f\fR de document1 Translates the contents of the file document1 from German to Spanish and prints the result to standard output\&. .TP \fBecho\fR "Le problme est rsolu\&." | \fBtranslate\fR \fB\-f\fR fr \fB\-t\fR en Translates the text given on standard input from French to English and prints the result to standard output\&. .TP \fBtranslate\fR \fB\-t\fR en http://www\&.freebsd\&.org/es/index\&.html Translates the web page pointed to by http://www\&.freebsd\&.org/es/index\&.html from Spanish to English and prints an URL pointing to the result to standard output\&. .SH "DIAGNOSTICS" .PP The \fBtranslate\fR utility exits with a status of 0 on success, and >0 if an error occurs\&. .SH "ENVIRONMENT" .PP The following environment variables affect the execution of \fBtranslate\fR: .TP \fBHTTP_PROXY\fR The URL of the proxy to use for HTTP requests\&. .TP \fBhttp_proxy\fR Same as HTTP_PROXY, for compatibility\&. .TP \fBTRANSLATE_DEFAULT_FROM\fR The default source language (see Language Selection)\&. .TP \fBTRANSLATE_DEFAULT_TO\fR The default destination language (see Language Selection)\&. .SH "SEE ALSO" .PP The libtranslate Reference Manual .SH AUTHOR Jean\-Yves Lefort. libtranslate-0.99/docs/reference000777 001750 001750 00000000000 10176431055 020512 5ustar00jylefortjylefort000000 000000 libtranslate-0.99/docs/reference/Makefile.am000644 001750 001750 00000002745 10172241211 022616 0ustar00jylefortjylefort000000 000000 include $(top_srcdir)/common.make # The name of the module. DOC_MODULE = libtranslate # The top-level SGML file. DOC_MAIN_SGML_FILE = libtranslate-docs.sgml # Extra options to supply to gtkdoc-scan SCAN_OPTIONS = --deprecated-guards="TRANSLATE_DISABLE_DEPRECATED" # The directory containing the source code. Relative to $(srcdir) DOC_SOURCE_DIR = ../.. # Used for dependencies HFILE_GLOB = $(top_srcdir)/src/*.h CFILE_GLOB = $(top_srcdir)/src/*.c # Headers to ignore IGNORE_HFILES = *-private.h # CFLAGS and LDFLAGS for compiling scan program. Only needed # if $(DOC_MODULE).types is non-empty. INCLUDES = $(TRANSLATE_CFLAGS) GTKDOC_LIBS = $(top_builddir)/src/libtranslate.la # Extra options to supply to gtkdoc-mkdb MKDB_OPTIONS = --sgml-mode --output-format=xml --ignore-files=trio # Extra SGML files that are included by $(DOC_MAIN_SGML_FILE) content_files = \ example-application.c.xml \ example-service.c.xml \ rfc3066-table.xml \ version.xml # include common portion ... include $(top_srcdir)/docs/gtk-doc.make # Other files to distribute EXTRA_DIST += \ example-application.c \ example-service.c \ lang2xml.sh DISTCLEANFILES = version.xml MAINTAINERCLEANFILES = \ example-application.c.xml \ example-service.c.xml \ rfc3066-table.xml %.c.xml: %.c sed -e 's,&,\&,g; s,<,\<,g; s,>,\>,g' $< > $@ rfc3066-table.xml: $(top_srcdir)/data/iso639-2 $(top_srcdir)/data/rfc3066.sh lang2xml.sh $(top_srcdir)/data/rfc3066.sh < $(top_srcdir)/data/iso639-2 | ./lang2xml.sh > $@ libtranslate-0.99/docs/reference/Makefile.in000644 001750 001750 00000043760 10176430640 022643 0ustar00jylefortjylefort000000 000000 # Makefile.in generated by automake 1.9.2 from Makefile.am. # @configure_input@ # Copyright (C) 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001, 2002, # 2003, 2004 Free Software Foundation, Inc. # This Makefile.in is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY, to the extent permitted by law; without # even the implied warranty of MERCHANTABILITY or FITNESS FOR A # PARTICULAR PURPOSE. @SET_MAKE@ # -*- mode: makefile -*- #################################### # Everything below here is generic # #################################### srcdir = @srcdir@ top_srcdir = @top_srcdir@ VPATH = @srcdir@ pkgdatadir = $(datadir)/@PACKAGE@ pkglibdir = $(libdir)/@PACKAGE@ pkgincludedir = $(includedir)/@PACKAGE@ top_builddir = ../.. am__cd = CDPATH="$${ZSH_VERSION+.}$(PATH_SEPARATOR)" && cd INSTALL = @INSTALL@ install_sh_DATA = $(install_sh) -c -m 644 install_sh_PROGRAM = $(install_sh) -c install_sh_SCRIPT = $(install_sh) -c INSTALL_HEADER = $(INSTALL_DATA) transform = $(program_transform_name) NORMAL_INSTALL = : PRE_INSTALL = : POST_INSTALL = : NORMAL_UNINSTALL = : PRE_UNINSTALL = : POST_UNINSTALL = : build_triplet = @build@ host_triplet = @host@ DIST_COMMON = $(srcdir)/Makefile.am $(srcdir)/Makefile.in \ $(srcdir)/version.xml.in $(top_srcdir)/common.make \ $(top_srcdir)/docs/gtk-doc.make subdir = docs/reference ACLOCAL_M4 = $(top_srcdir)/aclocal.m4 am__aclocal_m4_deps = $(top_srcdir)/m4/talkfilters.m4 \ $(top_srcdir)/acinclude.m4 $(top_srcdir)/configure.ac am__configure_deps = $(am__aclocal_m4_deps) $(CONFIGURE_DEPENDENCIES) \ $(ACLOCAL_M4) mkinstalldirs = $(SHELL) $(top_srcdir)/mkinstalldirs CONFIG_HEADER = $(top_builddir)/config.h CONFIG_CLEAN_FILES = version.xml SOURCES = DIST_SOURCES = DISTFILES = $(DIST_COMMON) $(DIST_SOURCES) $(TEXINFOS) $(EXTRA_DIST) ACLOCAL = @ACLOCAL@ AMDEP_FALSE = @AMDEP_FALSE@ AMDEP_TRUE = @AMDEP_TRUE@ AMTAR = @AMTAR@ AR = @AR@ AUTOCONF = @AUTOCONF@ AUTOHEADER = @AUTOHEADER@ AUTOMAKE = @AUTOMAKE@ AWK = @AWK@ CATALOGS = @CATALOGS@ CATOBJEXT = @CATOBJEXT@ CC = @CC@ CCDEPMODE = @CCDEPMODE@ CFLAGS = @CFLAGS@ CPP = @CPP@ CPPFLAGS = @CPPFLAGS@ CXX = @CXX@ CXXCPP = @CXXCPP@ CXXDEPMODE = @CXXDEPMODE@ CXXFLAGS = @CXXFLAGS@ CYGPATH_W = @CYGPATH_W@ DATADIRNAME = @DATADIRNAME@ DEFS = @DEFS@ DEPDIR = @DEPDIR@ ECHO = @ECHO@ ECHO_C = @ECHO_C@ ECHO_N = @ECHO_N@ ECHO_T = @ECHO_T@ EGREP = @EGREP@ ENABLE_GTK_DOC_FALSE = @ENABLE_GTK_DOC_FALSE@ ENABLE_GTK_DOC_TRUE = @ENABLE_GTK_DOC_TRUE@ EXEEXT = @EXEEXT@ F77 = @F77@ FFLAGS = @FFLAGS@ GETTEXT_PACKAGE = @GETTEXT_PACKAGE@ GLIB_CFLAGS = @GLIB_CFLAGS@ GLIB_LIBS = @GLIB_LIBS@ GMOFILES = @GMOFILES@ GMSGFMT = @GMSGFMT@ GTK_DOC_USE_LIBTOOL_FALSE = @GTK_DOC_USE_LIBTOOL_FALSE@ GTK_DOC_USE_LIBTOOL_TRUE = @GTK_DOC_USE_LIBTOOL_TRUE@ HTML_DIR = @HTML_DIR@ ICONV = @ICONV@ INSTALL_DATA = @INSTALL_DATA@ INSTALL_PROGRAM = @INSTALL_PROGRAM@ INSTALL_SCRIPT = @INSTALL_SCRIPT@ INSTALL_STRIP_PROGRAM = @INSTALL_STRIP_PROGRAM@ INSTOBJEXT = @INSTOBJEXT@ INTLLIBS = @INTLLIBS@ INTLTOOL_CAVES_RULE = @INTLTOOL_CAVES_RULE@ INTLTOOL_DESKTOP_RULE = @INTLTOOL_DESKTOP_RULE@ INTLTOOL_DIRECTORY_RULE = @INTLTOOL_DIRECTORY_RULE@ INTLTOOL_EXTRACT = @INTLTOOL_EXTRACT@ INTLTOOL_KBD_RULE = @INTLTOOL_KBD_RULE@ INTLTOOL_KEYS_RULE = @INTLTOOL_KEYS_RULE@ INTLTOOL_MERGE = @INTLTOOL_MERGE@ INTLTOOL_OAF_RULE = @INTLTOOL_OAF_RULE@ INTLTOOL_PERL = @INTLTOOL_PERL@ INTLTOOL_PONG_RULE = @INTLTOOL_PONG_RULE@ INTLTOOL_PROP_RULE = @INTLTOOL_PROP_RULE@ INTLTOOL_SCHEMAS_RULE = @INTLTOOL_SCHEMAS_RULE@ INTLTOOL_SERVER_RULE = @INTLTOOL_SERVER_RULE@ INTLTOOL_SHEET_RULE = @INTLTOOL_SHEET_RULE@ INTLTOOL_SOUNDLIST_RULE = @INTLTOOL_SOUNDLIST_RULE@ INTLTOOL_THEME_RULE = @INTLTOOL_THEME_RULE@ INTLTOOL_UI_RULE = @INTLTOOL_UI_RULE@ INTLTOOL_UPDATE = @INTLTOOL_UPDATE@ INTLTOOL_XAM_RULE = @INTLTOOL_XAM_RULE@ INTLTOOL_XML_NOMERGE_RULE = @INTLTOOL_XML_NOMERGE_RULE@ INTLTOOL_XML_RULE = @INTLTOOL_XML_RULE@ LDFLAGS = @LDFLAGS@ LIBOBJS = @LIBOBJS@ LIBS = @LIBS@ LIBTOOL = @LIBTOOL@ LIBXML_CFLAGS = @LIBXML_CFLAGS@ LIBXML_LIBS = @LIBXML_LIBS@ LN_S = @LN_S@ LTLIBOBJS = @LTLIBOBJS@ MAINT = @MAINT@ MAINTAINER_MODE_FALSE = @MAINTAINER_MODE_FALSE@ MAINTAINER_MODE_TRUE = @MAINTAINER_MODE_TRUE@ MAKEINFO = @MAKEINFO@ MKINSTALLDIRS = @MKINSTALLDIRS@ MSGFMT = @MSGFMT@ MSGMERGE = @MSGMERGE@ OBJEXT = @OBJEXT@ PACKAGE = @PACKAGE@ PACKAGE_BUGREPORT = @PACKAGE_BUGREPORT@ PACKAGE_NAME = @PACKAGE_NAME@ PACKAGE_STRING = @PACKAGE_STRING@ PACKAGE_TARNAME = @PACKAGE_TARNAME@ PACKAGE_VERSION = @PACKAGE_VERSION@ PATH_SEPARATOR = @PATH_SEPARATOR@ PKG_CONFIG = @PKG_CONFIG@ POFILES = @POFILES@ POSUB = @POSUB@ PO_IN_DATADIR_FALSE = @PO_IN_DATADIR_FALSE@ PO_IN_DATADIR_TRUE = @PO_IN_DATADIR_TRUE@ RANLIB = @RANLIB@ SET_MAKE = @SET_MAKE@ SHELL = @SHELL@ SOUP_CFLAGS = @SOUP_CFLAGS@ SOUP_LIBS = @SOUP_LIBS@ STRIP = @STRIP@ TALKFILTERS_CFLAGS = @TALKFILTERS_CFLAGS@ TALKFILTERS_LIBS = @TALKFILTERS_LIBS@ USE_NLS = @USE_NLS@ VERSION = @VERSION@ WARN_CFLAGS = @WARN_CFLAGS@ WITH_GENERIC_FALSE = @WITH_GENERIC_FALSE@ WITH_GENERIC_TRUE = @WITH_GENERIC_TRUE@ WITH_REGRESSION_TESTS_FALSE = @WITH_REGRESSION_TESTS_FALSE@ WITH_REGRESSION_TESTS_TRUE = @WITH_REGRESSION_TESTS_TRUE@ WITH_TALKFILTERS_FALSE = @WITH_TALKFILTERS_FALSE@ WITH_TALKFILTERS_TRUE = @WITH_TALKFILTERS_TRUE@ XGETTEXT = @XGETTEXT@ ac_ct_AR = @ac_ct_AR@ ac_ct_CC = @ac_ct_CC@ ac_ct_CXX = @ac_ct_CXX@ ac_ct_F77 = @ac_ct_F77@ ac_ct_RANLIB = @ac_ct_RANLIB@ ac_ct_STRIP = @ac_ct_STRIP@ am__fastdepCC_FALSE = @am__fastdepCC_FALSE@ am__fastdepCC_TRUE = @am__fastdepCC_TRUE@ am__fastdepCXX_FALSE = @am__fastdepCXX_FALSE@ am__fastdepCXX_TRUE = @am__fastdepCXX_TRUE@ am__include = @am__include@ am__leading_dot = @am__leading_dot@ am__quote = @am__quote@ am__tar = @am__tar@ am__untar = @am__untar@ bindir = @bindir@ build = @build@ build_alias = @build_alias@ build_cpu = @build_cpu@ build_os = @build_os@ build_vendor = @build_vendor@ datadir = @datadir@ exec_prefix = @exec_prefix@ host = @host@ host_alias = @host_alias@ host_cpu = @host_cpu@ host_os = @host_os@ host_vendor = @host_vendor@ includedir = @includedir@ infodir = @infodir@ install_sh = @install_sh@ libdir = @libdir@ libexecdir = @libexecdir@ localstatedir = @localstatedir@ mandir = @mandir@ mkdir_p = @mkdir_p@ oldincludedir = @oldincludedir@ prefix = @prefix@ program_transform_name = @program_transform_name@ sbindir = @sbindir@ sharedstatedir = @sharedstatedir@ sysconfdir = @sysconfdir@ target_alias = @target_alias@ modulesdir = $(pkglibdir)/modules TRANSLATE_CFLAGS = $(GLIB_CFLAGS) -I$(top_srcdir)/src # The name of the module. DOC_MODULE = libtranslate # The top-level SGML file. DOC_MAIN_SGML_FILE = libtranslate-docs.sgml # Extra options to supply to gtkdoc-scan SCAN_OPTIONS = --deprecated-guards="TRANSLATE_DISABLE_DEPRECATED" # The directory containing the source code. Relative to $(srcdir) DOC_SOURCE_DIR = ../.. # Used for dependencies HFILE_GLOB = $(top_srcdir)/src/*.h CFILE_GLOB = $(top_srcdir)/src/*.c # Headers to ignore IGNORE_HFILES = *-private.h # CFLAGS and LDFLAGS for compiling scan program. Only needed # if $(DOC_MODULE).types is non-empty. INCLUDES = $(TRANSLATE_CFLAGS) GTKDOC_LIBS = $(top_builddir)/src/libtranslate.la # Extra options to supply to gtkdoc-mkdb MKDB_OPTIONS = --sgml-mode --output-format=xml --ignore-files=trio # Extra SGML files that are included by $(DOC_MAIN_SGML_FILE) content_files = \ example-application.c.xml \ example-service.c.xml \ rfc3066-table.xml \ version.xml @GTK_DOC_USE_LIBTOOL_FALSE@GTKDOC_CC = $(CC) $(INCLUDES) $(AM_CFLAGS) $(CFLAGS) @GTK_DOC_USE_LIBTOOL_TRUE@GTKDOC_CC = $(LIBTOOL) --mode=compile $(CC) $(INCLUDES) $(AM_CFLAGS) $(CFLAGS) @GTK_DOC_USE_LIBTOOL_FALSE@GTKDOC_LD = $(CC) $(AM_CFLAGS) $(CFLAGS) $(LDFLAGS) @GTK_DOC_USE_LIBTOOL_TRUE@GTKDOC_LD = $(LIBTOOL) --mode=link $(CC) $(AM_CFLAGS) $(CFLAGS) $(LDFLAGS) # We set GPATH here; this gives us semantics for GNU make # which are more like other make's VPATH, when it comes to # whether a source that is a target of one rule is then # searched for in VPATH/GPATH. # GPATH = $(srcdir) TARGET_DIR = $(HTML_DIR)/$(DOC_MODULE) # include common portion ... # Other files to distribute EXTRA_DIST = $(content_files) $(HTML_IMAGES) $(DOC_MAIN_SGML_FILE) \ $(DOC_MODULE).types $(DOC_MODULE)-sections.txt \ $(DOC_MODULE)-overrides.txt example-application.c \ example-service.c lang2xml.sh DOC_STAMPS = scan-build.stamp tmpl-build.stamp sgml-build.stamp html-build.stamp \ $(srcdir)/tmpl.stamp $(srcdir)/sgml.stamp $(srcdir)/html.stamp SCANOBJ_FILES = \ $(DOC_MODULE).args \ $(DOC_MODULE).hierarchy \ $(DOC_MODULE).interfaces \ $(DOC_MODULE).prerequisites \ $(DOC_MODULE).signals CLEANFILES = $(SCANOBJ_FILES) $(DOC_MODULE)-unused.txt $(DOC_STAMPS) DISTCLEANFILES = version.xml MAINTAINERCLEANFILES = \ example-application.c.xml \ example-service.c.xml \ rfc3066-table.xml all: all-am .SUFFIXES: $(srcdir)/Makefile.in: @MAINTAINER_MODE_TRUE@ $(srcdir)/Makefile.am $(top_srcdir)/common.make $(top_srcdir)/docs/gtk-doc.make $(am__configure_deps) @for dep in $?; do \ case '$(am__configure_deps)' in \ *$$dep*) \ cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh \ && exit 0; \ exit 1;; \ esac; \ done; \ echo ' cd $(top_srcdir) && $(AUTOMAKE) --foreign docs/reference/Makefile'; \ cd $(top_srcdir) && \ $(AUTOMAKE) --foreign docs/reference/Makefile .PRECIOUS: Makefile Makefile: $(srcdir)/Makefile.in $(top_builddir)/config.status @case '$?' in \ *config.status*) \ cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh;; \ *) \ echo ' cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe)'; \ cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe);; \ esac; $(top_builddir)/config.status: $(top_srcdir)/configure $(CONFIG_STATUS_DEPENDENCIES) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh $(top_srcdir)/configure: @MAINTAINER_MODE_TRUE@ $(am__configure_deps) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh $(ACLOCAL_M4): @MAINTAINER_MODE_TRUE@ $(am__aclocal_m4_deps) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh version.xml: $(top_builddir)/config.status $(srcdir)/version.xml.in cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ mostlyclean-libtool: -rm -f *.lo clean-libtool: -rm -rf .libs _libs distclean-libtool: -rm -f libtool uninstall-info-am: tags: TAGS TAGS: ctags: CTAGS CTAGS: distdir: $(DISTFILES) $(mkdir_p) $(distdir)/../.. $(distdir)/../../docs @srcdirstrip=`echo "$(srcdir)" | sed 's|.|.|g'`; \ topsrcdirstrip=`echo "$(top_srcdir)" | sed 's|.|.|g'`; \ list='$(DISTFILES)'; for file in $$list; do \ case $$file in \ $(srcdir)/*) file=`echo "$$file" | sed "s|^$$srcdirstrip/||"`;; \ $(top_srcdir)/*) file=`echo "$$file" | sed "s|^$$topsrcdirstrip/|$(top_builddir)/|"`;; \ esac; \ if test -f $$file || test -d $$file; then d=.; else d=$(srcdir); fi; \ dir=`echo "$$file" | sed -e 's,/[^/]*$$,,'`; \ if test "$$dir" != "$$file" && test "$$dir" != "."; then \ dir="/$$dir"; \ $(mkdir_p) "$(distdir)$$dir"; \ else \ dir=''; \ fi; \ if test -d $$d/$$file; then \ if test -d $(srcdir)/$$file && test $$d != $(srcdir); then \ cp -pR $(srcdir)/$$file $(distdir)$$dir || exit 1; \ fi; \ cp -pR $$d/$$file $(distdir)$$dir || exit 1; \ else \ test -f $(distdir)/$$file \ || cp -p $$d/$$file $(distdir)/$$file \ || exit 1; \ fi; \ done $(MAKE) $(AM_MAKEFLAGS) \ top_distdir="$(top_distdir)" distdir="$(distdir)" \ dist-hook check-am: all-am check: check-am all-am: Makefile all-local installdirs: install: install-am install-exec: install-exec-am install-data: install-data-am uninstall: uninstall-am install-am: all-am @$(MAKE) $(AM_MAKEFLAGS) install-exec-am install-data-am installcheck: installcheck-am install-strip: $(MAKE) $(AM_MAKEFLAGS) INSTALL_PROGRAM="$(INSTALL_STRIP_PROGRAM)" \ install_sh_PROGRAM="$(INSTALL_STRIP_PROGRAM)" INSTALL_STRIP_FLAG=-s \ `test -z '$(STRIP)' || \ echo "INSTALL_PROGRAM_ENV=STRIPPROG='$(STRIP)'"` install mostlyclean-generic: clean-generic: -test -z "$(CLEANFILES)" || rm -f $(CLEANFILES) distclean-generic: -test -z "$(CONFIG_CLEAN_FILES)" || rm -f $(CONFIG_CLEAN_FILES) -test -z "$(DISTCLEANFILES)" || rm -f $(DISTCLEANFILES) maintainer-clean-generic: @echo "This command is intended for maintainers to use" @echo "it deletes files that may require special tools to rebuild." -test -z "$(MAINTAINERCLEANFILES)" || rm -f $(MAINTAINERCLEANFILES) clean: clean-am clean-am: clean-generic clean-libtool clean-local mostlyclean-am distclean: distclean-am -rm -f Makefile distclean-am: clean-am distclean-generic distclean-libtool dvi: dvi-am dvi-am: html: html-am info: info-am info-am: install-data-am: install-data-local install-exec-am: install-info: install-info-am install-man: installcheck-am: maintainer-clean: maintainer-clean-am -rm -f Makefile maintainer-clean-am: distclean-am maintainer-clean-generic \ maintainer-clean-local mostlyclean: mostlyclean-am mostlyclean-am: mostlyclean-generic mostlyclean-libtool pdf: pdf-am pdf-am: ps: ps-am ps-am: uninstall-am: uninstall-info-am uninstall-local .PHONY: all all-am all-local check check-am clean clean-generic \ clean-libtool clean-local dist-hook distclean \ distclean-generic distclean-libtool distdir dvi dvi-am html \ html-am info info-am install install-am install-data \ install-data-am install-data-local install-exec \ install-exec-am install-info install-info-am install-man \ install-strip installcheck installcheck-am installdirs \ maintainer-clean maintainer-clean-generic \ maintainer-clean-local mostlyclean mostlyclean-generic \ mostlyclean-libtool pdf pdf-am ps ps-am uninstall uninstall-am \ uninstall-info-am uninstall-local @ENABLE_GTK_DOC_TRUE@all-local: html-build.stamp #### scan #### @ENABLE_GTK_DOC_TRUE@scan-build.stamp: $(HFILE_GLOB) @ENABLE_GTK_DOC_TRUE@ @echo '*** Scanning header files ***' @ENABLE_GTK_DOC_TRUE@ @-chmod -R u+w $(srcdir) @ENABLE_GTK_DOC_TRUE@ if grep -l '^..*$$' $(srcdir)/$(DOC_MODULE).types > /dev/null ; then \ @ENABLE_GTK_DOC_TRUE@ CC="$(GTKDOC_CC)" LD="$(GTKDOC_LD)" CFLAGS="$(GTKDOC_CFLAGS)" LDFLAGS="$(GTKDOC_LIBS)" gtkdoc-scangobj $(SCANGOBJ_OPTIONS) --module=$(DOC_MODULE) --output-dir=$(srcdir) ; \ @ENABLE_GTK_DOC_TRUE@ else \ @ENABLE_GTK_DOC_TRUE@ cd $(srcdir) ; \ @ENABLE_GTK_DOC_TRUE@ for i in $(SCANOBJ_FILES) ; do \ @ENABLE_GTK_DOC_TRUE@ test -f $$i || touch $$i ; \ @ENABLE_GTK_DOC_TRUE@ done \ @ENABLE_GTK_DOC_TRUE@ fi @ENABLE_GTK_DOC_TRUE@ cd $(srcdir) && \ @ENABLE_GTK_DOC_TRUE@ gtkdoc-scan --module=$(DOC_MODULE) --source-dir=$(DOC_SOURCE_DIR) --ignore-headers="$(IGNORE_HFILES)" $(SCAN_OPTIONS) $(EXTRA_HFILES) @ENABLE_GTK_DOC_TRUE@ touch scan-build.stamp @ENABLE_GTK_DOC_TRUE@$(DOC_MODULE)-decl.txt $(SCANOBJ_FILES): scan-build.stamp @ENABLE_GTK_DOC_TRUE@ @true #### templates #### @ENABLE_GTK_DOC_TRUE@tmpl-build.stamp: $(DOC_MODULE)-decl.txt $(SCANOBJ_FILES) $(DOC_MODULE)-sections.txt $(DOC_MODULE)-overrides.txt @ENABLE_GTK_DOC_TRUE@ @echo '*** Rebuilding template files ***' @ENABLE_GTK_DOC_TRUE@ @-chmod -R u+w $(srcdir) @ENABLE_GTK_DOC_TRUE@ cd $(srcdir) && gtkdoc-mktmpl --module=$(DOC_MODULE) @ENABLE_GTK_DOC_TRUE@ touch tmpl-build.stamp @ENABLE_GTK_DOC_TRUE@tmpl.stamp: tmpl-build.stamp @ENABLE_GTK_DOC_TRUE@ @true #### xml #### @ENABLE_GTK_DOC_TRUE@sgml-build.stamp: tmpl.stamp $(CFILE_GLOB) $(srcdir)/tmpl/*.sgml @ENABLE_GTK_DOC_TRUE@ @echo '*** Building XML ***' @ENABLE_GTK_DOC_TRUE@ @-chmod -R u+w $(srcdir) @ENABLE_GTK_DOC_TRUE@ cd $(srcdir) && \ @ENABLE_GTK_DOC_TRUE@ gtkdoc-mkdb --module=$(DOC_MODULE) --source-dir=$(DOC_SOURCE_DIR) --output-format=xml $(MKDB_OPTIONS) @ENABLE_GTK_DOC_TRUE@ touch sgml-build.stamp @ENABLE_GTK_DOC_TRUE@sgml.stamp: sgml-build.stamp @ENABLE_GTK_DOC_TRUE@ @true #### html #### @ENABLE_GTK_DOC_TRUE@html-build.stamp: sgml.stamp $(DOC_MAIN_SGML_FILE) $(content_files) @ENABLE_GTK_DOC_TRUE@ @echo '*** Building HTML ***' @ENABLE_GTK_DOC_TRUE@ @-chmod -R u+w $(srcdir) @ENABLE_GTK_DOC_TRUE@ rm -rf $(srcdir)/html @ENABLE_GTK_DOC_TRUE@ mkdir $(srcdir)/html @ENABLE_GTK_DOC_TRUE@ cd $(srcdir)/html && gtkdoc-mkhtml $(DOC_MODULE) ../$(DOC_MAIN_SGML_FILE) @ENABLE_GTK_DOC_TRUE@ test "x$(HTML_IMAGES)" = "x" || ( cd $(srcdir) && cp $(HTML_IMAGES) html ) @ENABLE_GTK_DOC_TRUE@ @echo '-- Fixing Crossreferences' @ENABLE_GTK_DOC_TRUE@ cd $(srcdir) && gtkdoc-fixxref --module-dir=html --html-dir=$(HTML_DIR) $(FIXXREF_OPTIONS) @ENABLE_GTK_DOC_TRUE@ touch html-build.stamp @ENABLE_GTK_DOC_FALSE@all-local: ############## clean-local: rm -f *~ *.bak rm -rf .libs maintainer-clean-local: clean cd $(srcdir) && rm -rf xml html $(DOC_MODULE)-decl-list.txt $(DOC_MODULE)-decl.txt install-data-local: installfiles=`echo $(srcdir)/html/*`; \ if test "$$installfiles" = '$(srcdir)/html/*'; \ then echo '-- Nothing to install' ; \ else \ $(mkinstalldirs) $(DESTDIR)$(TARGET_DIR); \ for i in $$installfiles; do \ echo '-- Installing '$$i ; \ $(INSTALL_DATA) $$i $(DESTDIR)$(TARGET_DIR); \ done; \ echo '-- Installing $(srcdir)/html/index.sgml' ; \ $(INSTALL_DATA) $(srcdir)/html/index.sgml $(DESTDIR)$(TARGET_DIR) || :; \ fi uninstall-local: rm -f $(DESTDIR)$(TARGET_DIR)/* # # Require gtk-doc when making dist # @ENABLE_GTK_DOC_TRUE@dist-check-gtkdoc: @ENABLE_GTK_DOC_FALSE@dist-check-gtkdoc: @ENABLE_GTK_DOC_FALSE@ @echo "*** gtk-doc must be installed and enabled in order to make dist" @ENABLE_GTK_DOC_FALSE@ @false dist-hook: dist-check-gtkdoc dist-hook-local mkdir $(distdir)/tmpl mkdir $(distdir)/xml mkdir $(distdir)/html -cp $(srcdir)/tmpl/*.sgml $(distdir)/tmpl -cp $(srcdir)/xml/*.xml $(distdir)/xml -cp $(srcdir)/html/* $(distdir)/html .PHONY : dist-hook-local %.c.xml: %.c sed -e 's,&,\&,g; s,<,\<,g; s,>,\>,g' $< > $@ rfc3066-table.xml: $(top_srcdir)/data/iso639-2 $(top_srcdir)/data/rfc3066.sh lang2xml.sh $(top_srcdir)/data/rfc3066.sh < $(top_srcdir)/data/iso639-2 | ./lang2xml.sh > $@ # Tell versions [3.59,3.63) of GNU make to not export all variables. # Otherwise a system limit (for SysV at least) may be exceeded. .NOEXPORT: libtranslate-0.99/docs/reference/version.xml.in000644 001750 001750 00000000011 10165040114 023357 0ustar00jylefortjylefort000000 000000 @VERSION@libtranslate-0.99/docs/reference/example-application.c.xml000644 001750 001750 00000006021 10176431017 025461 0ustar00jylefortjylefort000000 000000 /* * Copyright (C) 2005 Jean-Yves Lefort * All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in the * documentation and/or other materials provided with the distribution. * 3. Neither the name of Jean-Yves Lefort nor the names of its contributors * may be used to endorse or promote products derived from this software * without specific prior written permission. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND * CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, * INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF * MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE * DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS * BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, * EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED * TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON * ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, * OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY * OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE * POSSIBILITY OF SUCH DAMAGE. */ #include <locale.h> #include <stdlib.h> #include <translate.h> int main (int argc, char **argv) { GError *err = NULL; GSList *services; TranslateSession *session; char *translation; setlocale(LC_ALL, ""); /* use user's locale */ if (argc != 4) { g_printerr("Usage: translate FROM TO {TEXT | HTTP_URL | HTTPS_URL}\n"); exit(1); } /* initialize libtranslate */ if (! translate_init(&err)) { g_printerr("Unable to initialize libtranslate: %s\n", err->message); g_error_free(err); exit(1); } /* create a session which will use all the services */ services = translate_get_services(); session = translate_session_new(services); g_slist_foreach(services, (GFunc) g_object_unref, NULL); g_slist_free(services); /* translate text or web page, depending on the string given */ translation = (g_str_has_prefix(argv[3], "http://") || g_str_has_prefix(argv[3], "https://")) ? translate_session_translate_web_page(session, argv[3], argv[1], argv[2], NULL, NULL, &err) : translate_session_translate_text(session, argv[3], argv[1], argv[2], NULL, NULL, &err); /* handle failure */ if (! translation) { g_printerr("Unable to translate: %s\n", err->message); g_error_free(err); exit(1); } /* success, print the translation, cleanup and exit */ g_print("%s\n", translation); g_free(translation); g_object_unref(session); return 0; } libtranslate-0.99/docs/reference/example-service.c.xml000644 001750 001750 00000013276 10176431017 024630 0ustar00jylefortjylefort000000 000000 /* * Copyright (C) 2005 Jean-Yves Lefort * All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in the * documentation and/or other materials provided with the distribution. * 3. Neither the name of Jean-Yves Lefort nor the names of its contributors * may be used to endorse or promote products derived from this software * without specific prior written permission. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND * CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, * INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF * MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE * DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS * BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, * EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED * TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON * ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, * OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY * OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE * POSSIBILITY OF SUCH DAMAGE. */ #include <locale.h> #include <stdlib.h> #include <gmodule.h> #include <translate.h> #define REVERSE_TYPE_SERVICE (reverse_service_get_type()) typedef struct { TranslateService parent; } ReverseService; typedef struct { TranslateServiceClass parent; } ReverseServiceClass; static gboolean reverse_service_get_pairs (TranslateService *service, GSList **pairs, TranslateProgressFunc progress_func, gpointer user_data, GError **err) { /* initialize the list */ *pairs = NULL; /* add the English -> English (reversed) pair */ *pairs = g_slist_append(*pairs, translate_pair_new(TRANSLATE_PAIR_TEXT, "en", "en-x-rev")); /* add the English (reversed) -> English pair */ *pairs = g_slist_append(*pairs, translate_pair_new(TRANSLATE_PAIR_TEXT, "en-x-rev", "en")); return TRUE; /* success */ } static char * reverse_service_translate_text (TranslateService *service, const char *text, const char *from, const char *to, TranslateProgressFunc progress_func, gpointer user_data, GError **err) { return g_utf8_strreverse(text, -1); } static void reverse_service_class_init (ReverseServiceClass *class) { TranslateServiceClass *service_class = TRANSLATE_SERVICE_CLASS(class); service_class->get_pairs = reverse_service_get_pairs; service_class->translate_text = reverse_service_translate_text; } static void reverse_service_register_type (GType *type) { static const GTypeInfo info = { sizeof(ReverseServiceClass), NULL, NULL, (GClassInitFunc) reverse_service_class_init, NULL, NULL, sizeof(ReverseService), 0, NULL }; *type = g_type_register_static(TRANSLATE_TYPE_SERVICE, "ReverseService", &info, 0); } static GType reverse_service_get_type (void) { static GType type; static GOnce once = G_ONCE_INIT; g_once(&once, (GThreadFunc) reverse_service_register_type, &type); return type; } static TranslateService * reverse_service_new (void) { return g_object_new(REVERSE_TYPE_SERVICE, "name", "reverse", "nick", "Reverse", NULL); } static void reverse_service_register_tag (void) { /* * Register our en-x-rev custom tag. The tag name was chosen * according to rules specified in RFC 3066 section 2.2. * * Note that registering a language name is optional and has * aesthetical purposes only. If no name exists for a particular * tag, the tag itself will be used. */ translate_add_language("en-x-rev", "English (reversed)"); } #ifdef STANDALONE int main (int argc, char **argv) { GError *err = NULL; GSList *services = NULL; TranslateSession *session; char *reversed; setlocale(LC_ALL, ""); /* use user's locale */ if (argc != 2) { g_printerr("Usage: rev TEXT\n"); exit(1); } /* initialize libtranslate */ if (! translate_init(&err)) { g_printerr("Unable to initialize libtranslate: %s\n", err->message); g_error_free(err); exit(1); } /* register our custom tag */ reverse_service_register_tag(); /* create a session which will use our reverse service */ services = g_slist_append(services, reverse_service_new()); session = translate_session_new(services); g_slist_foreach(services, (GFunc) g_object_unref, NULL); g_slist_free(services); /* reverse the given text */ reversed = translate_session_translate_text(session, argv[1], "en", "en-x-rev", NULL, NULL, &err); /* handle failure */ if (! reversed) { g_printerr("Unable to reverse text: %s\n", err->message); g_error_free(err); exit(1); } /* success, print the reversed text, cleanup and exit */ g_print("%s", reversed); g_free(reversed); g_object_unref(session); return 0; } #else /* ! STANDALONE */ G_MODULE_EXPORT gboolean translate_module_init (GError **err) { TranslateService *service; /* register our custom tag */ reverse_service_register_tag(); /* add the reverse service */ service = reverse_service_new(); translate_add_service(service); g_object_unref(service); return TRUE; /* success */ } #endif /* ! STANDALONE */ libtranslate-0.99/docs/reference/rfc3066-table.xml000644 001750 001750 00000160173 10176431021 023466 0ustar00jylefortjylefort000000 000000 Built-in RFC 3066 Tag to Name Mappings RFC 3066 Tag English Name French Name aa Afar afar ab Abkhazian abkhaze ace Achinese aceh ach Acoli acoli ada Adangme adangme ady Adyghe; Adygei adyghe afa Afro-Asiatic (Other) afro-asiatiques, autres langues afh Afrihili afrihili af Afrikaans afrikaans ak Akan akan akk Akkadian akkadien sq Albanian albanais ale Aleut aléoute alg Algonquian languages algonquines, langues am Amharic amharique ang English, Old (ca.450-1100) anglo-saxon (ca.450-1100) apa Apache languages apache ar Arabic arabe arc Aramaic araméen an Aragonese aragonais hy Armenian arménien arn Araucanian araucan arp Arapaho arapaho art Artificial (Other) artificielles, autres langues arw Arawak arawak as Assamese assamais ast Asturian; Bable asturien; bable ath Athapascan languages athapascanes, langues aus Australian languages australiennes, langues av Avaric avar ae Avestan avestique awa Awadhi awadhi ay Aymara aymara az Azerbaijani azéri bad Banda banda bai Bamileke languages bamilékés, langues ba Bashkir bachkir bal Baluchi baloutchi bm Bambara bambara ban Balinese balinais eu Basque basque bas Basa basa bat Baltic (Other) baltiques, autres langues bej Beja bedja be Belarusian biélorusse bem Bemba bemba bn Bengali bengali ber Berber (Other) berbères, autres langues bho Bhojpuri bhojpuri bh Bihari bihari bik Bikol bikol bin Bini bini bi Bislama bichlamar bla Siksika blackfoot bnt Bantu (Other) bantoues, autres langues bs Bosnian bosniaque bra Braj braj br Breton breton btk Batak (Indonesia) batak (Indonésie) bua Buriat bouriate bug Buginese bugi bg Bulgarian bulgare my Burmese birman byn Blin; Bilin blin; bilen cad Caddo caddo cai Central American Indian (Other) indiennes d'Amérique centrale, autres langues car Carib caribe ca Catalan; Valencian catalan; valencien cau Caucasian (Other) caucasiennes, autres langues ceb Cebuano cebuano cel Celtic (Other) celtiques, autres langues ch Chamorro chamorro chb Chibcha chibcha ce Chechen tchétchène chg Chagatai djaghataï zh Chinese chinois chk Chuukese chuuk chm Mari mari chn Chinook jargon chinook, jargon cho Choctaw choctaw chp Chipewyan chipewyan chr Cherokee cherokee cu Church Slavic; Old Slavonic; Church Slavonic; Old Bulgarian; Old Church Slavonic slavon d'église; vieux slave; slavon liturgique; vieux bulgare cv Chuvash tchouvache chy Cheyenne cheyenne cmc Chamic languages chames, langues cop Coptic copte kw Cornish cornique co Corsican corse cpe Creoles and pidgins, English based (Other) créoles et pidgins anglais, autres cpf Creoles and pidgins, French-based (Other) créoles et pidgins français, autres cpp Creoles and pidgins, Portuguese-based (Other) créoles et pidgins portugais, autres cr Cree cree crh Crimean Tatar; Crimean Turkish tatar de Crimé crp Creoles and pidgins (Other) créoles et pidgins divers csb Kashubian kachoube cus Cushitic (Other) couchitiques, autres langues cs Czech tchèque dak Dakota dakota da Danish danois dar Dargwa dargwa day Dayak dayak del Delaware delaware den Slave (Athapascan) esclave (athapascan) dgr Dogrib dogrib din Dinka dinka dv Divehi maldivien doi Dogri dogri dra Dravidian (Other) dravidiennes, autres langues dsb Lower Sorbian bas-sorabe dua Duala douala dum Dutch, Middle (ca.1050-1350) néerlandais moyen (ca. 1050-1350) nl Dutch; Flemish néerlandais; flamand dyu Dyula dioula dz Dzongkha dzongkha efi Efik efik egy Egyptian (Ancient) égyptien eka Ekajuk ekajuk elx Elamite élamite en English anglais enm English, Middle (1100-1500) anglais moyen (1100-1500) eo Esperanto espéranto et Estonian estonien ee Ewe éwé ewo Ewondo éwondo fan Fang fang fo Faroese féroïen fat Fanti fanti fj Fijian fidjien fil Filipino; Pilipino filipino; pilipino fi Finnish finnois fiu Finno-Ugrian (Other) finno-ougriennes, autres langues fon Fon fon fr French français frm French, Middle (ca.1400-1800) français moyen (1400-1800) fro French, Old (842-ca.1400) français ancien (842-ca.1400) fy Frisian frison ff Fulah peul fur Friulian frioulan gaa Ga ga gay Gayo gayo gba Gbaya gbaya gem Germanic (Other) germaniques, autres langues ka Georgian géorgien de German allemand gez Geez guèze gil Gilbertese kiribati gd Gaelic; Scottish Gaelic gaélique; gaélique écossais ga Irish irlandais gl Gallegan galicien gv Manx manx; mannois gmh German, Middle High (ca.1050-1500) allemand, moyen haut (ca. 1050-1500) goh German, Old High (ca.750-1050) allemand, vieux haut (ca. 750-1050) gon Gondi gond gor Gorontalo gorontalo got Gothic gothique grb Grebo grebo grc Greek, Ancient (to 1453) grec ancien (jusqu'à 1453) el Greek, Modern (1453-) grec moderne (après 1453) gn Guarani guarani gu Gujarati goudjrati gwi Gwich´in gwich´in hai Haida haida ht Haitian; Haitian Creole haïtien; créole haïtien ha Hausa haoussa haw Hawaiian hawaïen he Hebrew hébreu hz Herero herero hil Hiligaynon hiligaynon him Himachali himachali hi Hindi hindi hit Hittite hittite hmn Hmong hmong ho Hiri Motu hiri motu hsb Upper Sorbian haut-sorabe hu Hungarian hongrois hup Hupa hupa iba Iban iban ig Igbo igbo is Icelandic islandais io Ido ido ii Sichuan Yi yi de Sichuan ijo Ijo ijo iu Inuktitut inuktitut ie Interlingue interlingue ilo Iloko ilocano ia Interlingua (International Auxiliary Language Association) interlingua (langue auxiliaire internationale) inc Indic (Other) indo-aryennes, autres langues id Indonesian indonésien ine Indo-European (Other) indo-européennes, autres langues inh Ingush ingouche ik Inupiaq inupiaq ira Iranian (Other) iraniennes, autres langues iro Iroquoian languages iroquoises, langues (famille) it Italian italien jv Javanese javanais jbo Lojban lojban ja Japanese japonais jpr Judeo-Persian judéo-persan jrb Judeo-Arabic judéo-arabe kaa Kara-Kalpak karakalpak kab Kabyle kabyle kac Kachin kachin kl Kalaallisut; Greenlandic groenlandais kam Kamba kamba kn Kannada kannada kar Karen karen ks Kashmiri kashmiri kr Kanuri kanouri kaw Kawi kawi kk Kazakh kazakh kbd Kabardian kabardien kha Khasi khasi khi Khoisan (Other) khoisan, autres langues km Khmer khmer kho Khotanese khotanais ki Kikuyu; Gikuyu kikuyu rw Kinyarwanda rwanda ky Kirghiz kirghize kmb Kimbundu kimbundu kok Konkani konkani kv Komi kom kg Kongo kongo ko Korean coréen kos Kosraean kosrae kpe Kpelle kpellé krc Karachay-Balkar karatchai balkar kro Kru krou kru Kurukh kurukh kj Kuanyama; Kwanyama kuanyama; kwanyama kum Kumyk koumyk ku Kurdish kurde kut Kutenai kutenai lad Ladino judéo-espagnol lah Lahnda lahnda lam Lamba lamba lo Lao lao la Latin latin lv Latvian letton lez Lezghian lezghien li Limburgan; Limburger; Limburgish limbourgeois ln Lingala lingala lt Lithuanian lituanien lol Mongo mongo loz Lozi lozi lb Luxembourgish; Letzeburgesch luxembourgeois lua Luba-Lulua luba-lulua lu Luba-Katanga luba-katanga lg Ganda ganda lui Luiseno luiseno lun Lunda lunda luo Luo (Kenya and Tanzania) luo (Kenya et Tanzanie) lus lushai Lushai mk Macedonian macédonien mad Madurese madourais mag Magahi magahi mh Marshallese marshall mai Maithili maithili mak Makasar makassar ml Malayalam malayalam man Mandingo mandingue mi Maori maori map Austronesian (Other) malayo-polynésiennes, autres langues mr Marathi marathe mas Masai massaï ms Malay malais mdf Moksha moksa mdr Mandar mandar men Mende mendé mga Irish, Middle (900-1200) irlandais moyen (900-1200) mic Mi'kmaq; Micmac mi'kmaq; micmac min Minangkabau minangkabau mis Miscellaneous languages diverses, langues mkh Mon-Khmer (Other) môn-khmer, autres langues mg Malagasy malgache mt Maltese maltais mnc Manchu mandchou mni Manipuri manipuri mno Manobo languages manobo, langues moh Mohawk mohawk mo Moldavian moldave mn Mongolian mongol mos Mossi moré mul Multiple languages multilingue mun Munda languages mounda, langues mus Creek muskogee mwl Mirandese mirandais mwr Marwari marvari myn Mayan languages maya, langues myv Erzya erza nah Nahuatl nahuatl nai North American Indian indiennes d'Amérique du Nord, autres langues nap Neapolitan napolitain na Nauru nauruan nv Navajo; Navaho navaho nr Ndebele, South; South Ndebele ndébélé du Sud nd Ndebele, North; North Ndebele ndébélé du Nord ng Ndonga ndonga nds Low German; Low Saxon; German, Low; Saxon, Low bas allemand; bas saxon; allemand, bas; saxon, bas ne Nepali népalais new Nepal Bhasa; Newari nepal bhasa; newari nia Nias nias nic Niger-Kordofanian (Other) nigéro-congolaises, autres langues niu Niuean niué nn Norwegian Nynorsk norvégien nynorsk nb Norwegian Bokmål norvégien bokmål nog Nogai nogaï; nogay non Norse, Old norrois, vieux no Norwegian norvégien nso Northern Sotho; Pedi; Sepedi sotho du Nord; pedi; sepedi nub Nubian languages nubiennes, langues nwc Classical Newari; Old Newari; Classical Nepal Bhasa newari classique ny Chichewa; Chewa; Nyanja chichewa; chewa; nyanja nym Nyamwezi nyamwezi nyn Nyankole nyankolé nyo Nyoro nyoro nzi Nzima nzema oc Occitan (post 1500); Provençal occitan (après 1500); provençal oj Ojibwa ojibwa or Oriya oriya om Oromo galla osa Osage osage os Ossetian; Ossetic ossète ota Turkish, Ottoman (1500-1928) turc ottoman (1500-1928) oto Otomian languages otomangue, langues paa Papuan (Other) papoues, autres langues pag Pangasinan pangasinan pal Pahlavi pahlavi pam Pampanga pampangan pa Panjabi; Punjabi pendjabi pap Papiamento papiamento pau Palauan palau peo Persian, Old (ca.600-400 B.C.) perse, vieux (ca. 600-400 av. J.-C.) fa Persian persan phi Philippine (Other) philippines, autres langues phn Phoenician phénicien pi Pali pali pl Polish polonais pon Pohnpeian pohnpei pt Portuguese portugais pra Prakrit languages prâkrit pro Provençal, Old (to 1500) provençal ancien (jusqu'à 1500) ps Pushto pachto qaa-qtz Reserved for local use réservée à l'usage local qu Quechua quechua raj Rajasthani rajasthani rap Rapanui rapanui rar Rarotongan rarotonga roa Romance (Other) romanes, autres langues rm Raeto-Romance rhéto-roman rom Romany tsigane ro Romanian roumain rn Rundi rundi ru Russian russe sad Sandawe sandawe sg Sango sango sah Yakut iakoute sai South American Indian (Other) indiennes d'Amérique du Sud, autres langues sal Salishan languages salish, langues sam Samaritan Aramaic samaritain sa Sanskrit sanskrit sas Sasak sasak sat Santali santal sr Serbian serbe scn Sicilian sicilien sco Scots écossais hr Croatian croate sel Selkup selkoupe sem Semitic (Other) sémitiques, autres langues sga Irish, Old (to 900) irlandais ancien (jusqu'à 900) sgn Sign Languages langues des signes shn Shan chan sid Sidamo sidamo si Sinhala; Sinhalese singhalais sio Siouan languages sioux, langues sit Sino-Tibetan (Other) sino-tibétaines, autres langues sla Slavic (Other) slaves, autres langues sk Slovak slovaque sl Slovenian slovène sma Southern Sami sami du Sud se Northern Sami sami du Nord smi Sami languages (Other) sami, autres langues smj Lule Sami sami de Lule smn Inari Sami sami d'Inari sm Samoan samoan sms Skolt Sami sami skolt sn Shona shona sd Sindhi sindhi snk Soninke soninké sog Sogdian sogdien so Somali somali son Songhai songhai st Sotho, Southern sotho du Sud es Spanish; Castilian espagnol; castillan sc Sardinian sarde srr Serer sérère ssa Nilo-Saharan (Other) nilo-sahariennes, autres langues ss Swati swati suk Sukuma sukuma su Sundanese soundanais sus Susu soussou sux Sumerian sumérien sw Swahili swahili sv Swedish suédois syr Syriac syriaque ty Tahitian tahitien tai Tai (Other) thaïes, autres langues ta Tamil tamoul tt Tatar tatar te Telugu télougou tem Timne temne ter Tereno tereno tet Tetum tetum tg Tajik tadjik tl Tagalog tagalog th Thai thaï bo Tibetan tibétain tig Tigre tigré ti Tigrinya tigrigna tiv Tiv tiv tkl Tokelau tokelau tlh Klingon; tlhIngan-Hol klingon tli Tlingit tlingit tmh Tamashek tamacheq tog Tonga (Nyasa) tonga (Nyasa) to Tonga (Tonga Islands) tongan (Îles Tonga) tpi Tok Pisin tok pisin tsi Tsimshian tsimshian tn Tswana tswana ts Tsonga tsonga tk Turkmen turkmène tum Tumbuka tumbuka tup Tupi languages tupi, langues tr Turkish turc tut Altaic (Other) altaïques, autres langues tvl Tuvalu tuvalu tw Twi twi tyv Tuvinian touva udm Udmurt oudmourte uga Ugaritic ougaritique ug Uighur; Uyghur ouïgour uk Ukrainian ukrainien umb Umbundu umbundu und Undetermined indéterminée ur Urdu ourdou uz Uzbek ouszbek vai Vai vaï ve Venda venda vi Vietnamese vietnamien vo Volapük volapük vot Votic vote wak Wakashan languages wakashennes, langues wal Walamo walamo war Waray waray was Washo washo cy Welsh gallois wen Sorbian languages sorabes, langues wa Walloon wallon wo Wolof wolof xal Kalmyk kalmouk xh Xhosa xhosa yao Yao yao yap Yapese yapois yi Yiddish yiddish yo Yoruba yoruba ypk Yupik languages yupik, langues zap Zapotec zapotèque zen Zenaga zenaga za Zhuang; Chuang zhuang; chuang znd Zande zandé zu Zulu zoulou zun Zuni zuni
libtranslate-0.99/docs/reference/version.xml000644 001750 001750 00000000005 10176430750 022770 0ustar00jylefortjylefort000000 000000 0.99 libtranslate-0.99/docs/reference/libtranslate-docs.sgml000644 001750 001750 00000030035 10172767176 025100 0ustar00jylefortjylefort000000 000000 ]> &lib; Reference Manual for &lib; &version; January 15, 2005 Jean-Yves Lefort jylefort@brutele.be Overview &lib; is a library for translating text and web pages between natural languages. Its modular infrastructure allows to implement new translation services separately from the core library. &lib; is shipped with a generic module supporting web-based translation services such as Babel Fish, Google Language Tools and SYSTRAN. Moreover, the generic module allows to add new services simply by adding a few lines to a XML file (see the services.xml5 manual page). &lib; is implemented on top of the GLib Object System.
Conventions Unless noted otherwise, strings passed to library functions must be encoded in UTF-8. Unless noted otherwise, strings returned by &lib; are encoded in UTF-8. Unless noted otherwise, &lib; is thread-safe.
Compiling &lib; Applications
Compiling on UNIX To compile a &lib; application, you need to tell the compiler where to find the &lib; header files and libraries. This is done with the pkg-config utility. The following interactive shell session demonstrates how pkg-config is used: $ pkg-config --cflags libtranslate -I/usr/local/include/libtranslate -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include $ pkg-config --libs libtranslate -L/usr/local/lib -ltranslate -lgobject-2.0 -lglib-2.0 -liconv The simplest way to compile a program is to use the "backticks" feature of the shell. If you enclose a command in backticks (not single quotes), then its output will be substituted into the command line before execution. So to compile a &lib; Hello World, you would type the following: $ cc `pkg-config --cflags --libs libtranslate` hello.c -o hello
Compiling on UNIX With Autoconf and Automake To compile a &lib; application using GNU Autoconf and GNU Automake, insert the following line at the appropriate place in the configure.ac file: PKG_CHECK_MODULES(LIBTRANSLATE, libtranslate,, [AC_MSG_ERROR([unable to find libtranslate])]) and insert the following lines in the appropriate Makefile.am file: bin_PROGRAMS = hello hello_SOURCES = hello.c hello_CPPFLAGS = $(LIBTRANSLATE_CFLAGS) hello_LDFLAGS = $(LIBTRANSLATE_LIBS)
Compiling &lib; Modules
Compiling on UNIX To compile a &lib; module, you need to tell the compiler where to find the &lib; header files. This is done with the pkg-config utility. For instance, to compile a &lib; Hello World module, you would type the following: $ cc `pkg-config --cflags libtranslate` -shared -fPIC hello.c -o hello.so
Compiling on UNIX With Autoconf, Automake and Libtool To compile a &lib; module using GNU Autoconf, GNU Automake and GNU Libtool, insert the following line at the appropriate place in the configure.ac file: PKG_CHECK_MODULES(LIBTRANSLATE, libtranslate,, [AC_MSG_ERROR([unable to find libtranslate])]) and insert the following lines in the appropriate Makefile.am file: modulesdir = $(libdir)/libtranslate/modules modules_LTLIBRARIES = hello.la hello_la_SOURCES = hello.c hello_la_CPPFLAGS = $(LIBTRANSLATE_CFLAGS) hello_la_LDFLAGS = -avoid-version -module
Module Search Paths &lib; loads modules from prefix/libtranslate/modules (where prefix is the prefix where &lib; is installed) and from ~/.libtranslate/modules (where ~ is the path to your home directory). Filenames not having the system-specific shared object extension (usually .so) are ignored.
Tutorials
Translating Text or Web Pages To translate text or web pages, you need to initialize &lib; with a call to translate_init(), create a new session using translate_session_new(), and call the appropriate translation function, translate_session_translate_text() or translate_session_translate_web_page(). A Simple Command-Line Translator The following example demonstrates how to use &lib; for creating a simple command-line text and web page translator. The source code of this example is available in the &lib; source distribution (docs/reference/example-application.c), and is reproduced below. On UNIX, compile it as follows: $ cc `pkg-config --cflags --libs libtranslate` example-application.c -o example-application &example-application;
Implementing Translation Services To implement a translation service, you need to create a subclass of TranslateService, create an instance of your subclass with g_object_new(), and add the service using translate_add_service(). Web-Based Services If you are implementing support for a web-based service, just adding a definition to the services.xml file (without having to resort to C code) might be sufficient. See the services.xml5 manual page. A Simple Service for Reversing Text The following example demonstrates how to create an add-on service for &lib;, and compile it either as a module or as a standalone application. The source code of this example is available in the &lib; source distribution (docs/reference/example-service.c), and is reproduced below. To build a module on UNIX, compile the source as follows: $ cc `pkg-config --cflags libtranslate` -shared -fPIC example-service.c -o example-service.so To build a standalone application on UNIX, compile the source as follows: $ cc `pkg-config --cflags --libs libtranslate` -DSTANDALONE example-service.c -o example-service &example-service;
API Reference
Object Hierarchy &index-Object-Tree;
&translate; &translate-common; &TranslatePair; &TranslateService; &TranslateSession; &translate-util;
Built-in RFC 3066 Tag to Name Mappings The following tag to name mappings are built into &lib;. Calling translate_get_language_name() for any tag of this table will return its localized language name. &rfc3066-table;
libtranslate-0.99/docs/reference/libtranslate.types000644 001750 001750 00000000146 10164527466 024351 0ustar00jylefortjylefort000000 000000 #include "translate.h" translate_pair_get_type translate_service_get_type translate_session_get_type libtranslate-0.99/docs/reference/libtranslate-sections.txt000644 001750 001750 00000004617 10166111173 025642 0ustar00jylefortjylefort000000 000000
translate-session TranslateSession TranslateSession TRANSLATE_SESSION_ERROR TranslateSessionError translate_session_new translate_session_set_services translate_session_set_max_threads translate_session_set_max_retries translate_session_get_services translate_session_get_pairs translate_session_get_max_threads translate_session_get_max_retries translate_session_translate_text translate_session_translate_web_page TRANSLATE_SESSION TRANSLATE_IS_SESSION TRANSLATE_TYPE_SESSION translate_session_get_type TRANSLATE_SESSION_CLASS TRANSLATE_IS_SESSION_CLASS TRANSLATE_SESSION_GET_CLASS
translate-pair TranslatePair TranslatePair TranslatePairFlags translate_pair_new translate_pair_get_flags translate_pair_get_from translate_pair_get_to translate_pairs_sort_by_tag translate_pairs_sort_by_name translate_pairs_find TRANSLATE_PAIR TRANSLATE_IS_PAIR TRANSLATE_TYPE_PAIR translate_pair_get_type TRANSLATE_PAIR_CLASS TRANSLATE_IS_PAIR_CLASS TRANSLATE_PAIR_GET_CLASS
translate-service TranslateService TranslateService TranslateServiceClass translate_service_get_name translate_service_get_nick translate_service_get_max_chunk_len translate_service_get_pairs TRANSLATE_SERVICE TRANSLATE_IS_SERVICE TRANSLATE_TYPE_SERVICE translate_service_get_type TRANSLATE_SERVICE_CLASS TRANSLATE_IS_SERVICE_CLASS TRANSLATE_SERVICE_GET_CLASS
translate TRANSLATE_MAJOR_VERSION TRANSLATE_MINOR_VERSION TRANSLATE_MICRO_VERSION translate_major_version translate_minor_version translate_micro_version TRANSLATE_ERROR TRANSLATE_INIT_ERROR TranslateError TranslateInitError TranslateModuleInitFunc translate_initialized translate_init translate_add_service translate_get_service translate_get_services translate_add_language translate_get_language_name translate_set_proxy translate_get_proxy
translate-util translate_ascii_strcase_equal translate_ascii_strcase_hash translate_ascii_strcasestr translate_ascii_strcasestr_len translate_ascii_strcasecoll translate_utf8_strcasecoll translate_utf8_strcmp translate_utf8_strcasecmp translate_utf8_strpbrk translate_utf8_strrpbrk translate_time translate_sgml_ref_expand
translate-common TranslateProgressFunc
libtranslate-0.99/docs/reference/libtranslate-overrides.txt000644 001750 001750 00000000000 10161371573 026002 0ustar00jylefortjylefort000000 000000 libtranslate-0.99/docs/reference/example-application.c000644 001750 001750 00000005755 10173774761 024714 0ustar00jylefortjylefort000000 000000 /* * Copyright (C) 2005 Jean-Yves Lefort * All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in the * documentation and/or other materials provided with the distribution. * 3. Neither the name of Jean-Yves Lefort nor the names of its contributors * may be used to endorse or promote products derived from this software * without specific prior written permission. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND * CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, * INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF * MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE * DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS * BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, * EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED * TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON * ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, * OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY * OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE * POSSIBILITY OF SUCH DAMAGE. */ #include #include #include int main (int argc, char **argv) { GError *err = NULL; GSList *services; TranslateSession *session; char *translation; setlocale(LC_ALL, ""); /* use user's locale */ if (argc != 4) { g_printerr("Usage: translate FROM TO {TEXT | HTTP_URL | HTTPS_URL}\n"); exit(1); } /* initialize libtranslate */ if (! translate_init(&err)) { g_printerr("Unable to initialize libtranslate: %s\n", err->message); g_error_free(err); exit(1); } /* create a session which will use all the services */ services = translate_get_services(); session = translate_session_new(services); g_slist_foreach(services, (GFunc) g_object_unref, NULL); g_slist_free(services); /* translate text or web page, depending on the string given */ translation = (g_str_has_prefix(argv[3], "http://") || g_str_has_prefix(argv[3], "https://")) ? translate_session_translate_web_page(session, argv[3], argv[1], argv[2], NULL, NULL, &err) : translate_session_translate_text(session, argv[3], argv[1], argv[2], NULL, NULL, &err); /* handle failure */ if (! translation) { g_printerr("Unable to translate: %s\n", err->message); g_error_free(err); exit(1); } /* success, print the translation, cleanup and exit */ g_print("%s\n", translation); g_free(translation); g_object_unref(session); return 0; } libtranslate-0.99/docs/reference/example-service.c000644 001750 001750 00000013200 10173774771 024032 0ustar00jylefortjylefort000000 000000 /* * Copyright (C) 2005 Jean-Yves Lefort * All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in the * documentation and/or other materials provided with the distribution. * 3. Neither the name of Jean-Yves Lefort nor the names of its contributors * may be used to endorse or promote products derived from this software * without specific prior written permission. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND * CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, * INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF * MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE * DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS * BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, * EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED * TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON * ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, * OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY * OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE * POSSIBILITY OF SUCH DAMAGE. */ #include #include #include #include #define REVERSE_TYPE_SERVICE (reverse_service_get_type()) typedef struct { TranslateService parent; } ReverseService; typedef struct { TranslateServiceClass parent; } ReverseServiceClass; static gboolean reverse_service_get_pairs (TranslateService *service, GSList **pairs, TranslateProgressFunc progress_func, gpointer user_data, GError **err) { /* initialize the list */ *pairs = NULL; /* add the English -> English (reversed) pair */ *pairs = g_slist_append(*pairs, translate_pair_new(TRANSLATE_PAIR_TEXT, "en", "en-x-rev")); /* add the English (reversed) -> English pair */ *pairs = g_slist_append(*pairs, translate_pair_new(TRANSLATE_PAIR_TEXT, "en-x-rev", "en")); return TRUE; /* success */ } static char * reverse_service_translate_text (TranslateService *service, const char *text, const char *from, const char *to, TranslateProgressFunc progress_func, gpointer user_data, GError **err) { return g_utf8_strreverse(text, -1); } static void reverse_service_class_init (ReverseServiceClass *class) { TranslateServiceClass *service_class = TRANSLATE_SERVICE_CLASS(class); service_class->get_pairs = reverse_service_get_pairs; service_class->translate_text = reverse_service_translate_text; } static void reverse_service_register_type (GType *type) { static const GTypeInfo info = { sizeof(ReverseServiceClass), NULL, NULL, (GClassInitFunc) reverse_service_class_init, NULL, NULL, sizeof(ReverseService), 0, NULL }; *type = g_type_register_static(TRANSLATE_TYPE_SERVICE, "ReverseService", &info, 0); } static GType reverse_service_get_type (void) { static GType type; static GOnce once = G_ONCE_INIT; g_once(&once, (GThreadFunc) reverse_service_register_type, &type); return type; } static TranslateService * reverse_service_new (void) { return g_object_new(REVERSE_TYPE_SERVICE, "name", "reverse", "nick", "Reverse", NULL); } static void reverse_service_register_tag (void) { /* * Register our en-x-rev custom tag. The tag name was chosen * according to rules specified in RFC 3066 section 2.2. * * Note that registering a language name is optional and has * aesthetical purposes only. If no name exists for a particular * tag, the tag itself will be used. */ translate_add_language("en-x-rev", "English (reversed)"); } #ifdef STANDALONE int main (int argc, char **argv) { GError *err = NULL; GSList *services = NULL; TranslateSession *session; char *reversed; setlocale(LC_ALL, ""); /* use user's locale */ if (argc != 2) { g_printerr("Usage: rev TEXT\n"); exit(1); } /* initialize libtranslate */ if (! translate_init(&err)) { g_printerr("Unable to initialize libtranslate: %s\n", err->message); g_error_free(err); exit(1); } /* register our custom tag */ reverse_service_register_tag(); /* create a session which will use our reverse service */ services = g_slist_append(services, reverse_service_new()); session = translate_session_new(services); g_slist_foreach(services, (GFunc) g_object_unref, NULL); g_slist_free(services); /* reverse the given text */ reversed = translate_session_translate_text(session, argv[1], "en", "en-x-rev", NULL, NULL, &err); /* handle failure */ if (! reversed) { g_printerr("Unable to reverse text: %s\n", err->message); g_error_free(err); exit(1); } /* success, print the reversed text, cleanup and exit */ g_print("%s", reversed); g_free(reversed); g_object_unref(session); return 0; } #else /* ! STANDALONE */ G_MODULE_EXPORT gboolean translate_module_init (GError **err) { TranslateService *service; /* register our custom tag */ reverse_service_register_tag(); /* add the reverse service */ service = reverse_service_new(); translate_add_service(service); g_object_unref(service); return TRUE; /* success */ } #endif /* ! STANDALONE */ libtranslate-0.99/docs/reference/lang2xml.sh000755 001750 001750 00000004345 10172766154 022665 0ustar00jylefortjylefort000000 000000 #!/bin/sh # # lang2xml.sh - convert a RFC 3066 language table to a DocBook XML file # # Copyright (C) 2005 Jean-Yves Lefort # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. Neither the name of Jean-Yves Lefort nor the names of its contributors # may be used to endorse or promote products derived from this software # without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND # CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, # INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE # DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS # BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, # EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED # TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON # ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, # OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY # OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. cat < Built-in RFC 3066 Tag to Name Mappings RFC 3066 Tag English Name French Name EOF IFS="|" while read tag english_name french_name; do cat < $tag $english_name $french_name EOF done cat <
EOF libtranslate-0.99/docs/reference/tmpl000777 001750 001750 00000000000 10176431055 021466 5ustar00jylefortjylefort000000 000000 libtranslate-0.99/docs/reference/tmpl/translate-service.sgml000644 001750 001750 00000013422 10176431055 026062 0ustar00jylefortjylefort000000 000000 TranslateService service object A #TranslateService object defines a set of language pairs as well as the methods to translate a text or web page using one of the pairs. A new translation service can be implemented in two ways: Adding a definition to the services.xml file The generic module provides an abstract framework for supporting web-based translation services. At runtime, the generic module reads service definitions from services.xml files and creates the services defined in these files. If you are adding support for a web-based translation service, this is the way to go. See the services.xml5 manual page for more details. Creating a #TranslateService subclass If the services.xml file cannot satisfactorily be used to describe the service you want to implement, you need to program the service in C by creating a subclass of #TranslateService and overriding the @get_pairs, @translate_text and/or @translate_web_page methods. If you want all the applications using libtranslate to be able to use the new service, you need to create a libtranslate module and install it in the appropriate path (see Compiling libtranslate Modules). Otherwise, just integrate the service with your application. In either case, you need to expose an instance of the service to libtranslate by calling translate_add_service(). If the service is included in a module, this needs to be done from translate_module_init(). Otherwise, do it from your application initialization code, somewhere after the call to translate_init(). The #TranslateService struct contains private data only, and should be accessed using the functions below. The service class contains methods which should be implemented by subclasses in order to provide the service functionality. Implementing the @get_pairs method is mandatory. The @translate_text and @translate_web_page methods are only required if any pair returned by the @get_pairs method has the #TRANSLATE_PAIR_TEXT or #TRANSLATE_PAIR_WEB_PAGE flag set, respectively. @parent: the parent class @get_pairs: Specifies the function which is called to retrieve the list of language pairs implemented by @service. The function should return %TRUE and store a list of #TranslatePair objects in @pairs on success, or return %FALSE and store an error in @err on failure. If @progress_func is not %NULL, @get_pairs should call it at regular intervals with a progress update (or -1 if the progress is unknown), and the @user_data argument. If, when called, @progress_func returns %FALSE, @get_pairs must cancel the operation as soon as possible, return %NULL, and set @err to an error of domain #TRANSLATE_ERROR and code #TRANSLATE_ERROR_CANCELLED. @translate_text: Specifies the function which is called to translate a chunk of text. The function should return a newly-allocated string containing the translation of @text on success, or return %NULL and set @err on failure. If the max-chunk-len property of service is not 0, it is guaranteed that the number of UTF-8 characters in @text will not exceed max-chunk-len . It is guaranteed that the @from/@to pair will be a member (with the flag #TRANSLATE_PAIR_TEXT set) of the list returned by the @get_pairs method. If @progress_func is not %NULL, @translate_text should call it at regular intervals with a progress update (or -1 if the progress is unknown), and the @user_data argument. If, when called, @progress_func returns %FALSE, @translate_text must cancel the translation as soon as possible, return %NULL, and set @err to an error of domain #TRANSLATE_ERROR and code #TRANSLATE_ERROR_CANCELLED. @translate_web_page: Specifies the function which is called to translate a web page. The function should return a newly-allocated string containing the URL of the translated web page on success, or return %NULL and set @err on failure. It is guaranteed that the @from/@to pair will be a member (with the flag #TRANSLATE_PAIR_WEB_PAGE set) of the list returned by the @get_pairs method. If @progress_func is not %NULL, @translate_web_page should call it at regular intervals with a progress update (or -1 if the progress is unknown), and the @user_data argument. If, when called, @progress_func returns %FALSE, @translate_web_page must cancel the translation as soon as possible, return %NULL, and set @err to an error of domain #TRANSLATE_ERROR and code #TRANSLATE_ERROR_CANCELLED. @service: @Returns: @service: @Returns: @service: @Returns: @service: @Returns: libtranslate-0.99/docs/reference/tmpl/translate-util.sgml000644 001750 001750 00000003111 10176431055 025371 0ustar00jylefortjylefort000000 000000 translate-util miscellaneous utility functions The following functions may come in handy to manipulate ASCII or UTF-8 strings, get the current time, or expand SGML character references and XHTML character entities. @s1: @s2: @Returns: @key: @Returns: @big: @little: @Returns: @big: @big_len: @little: @Returns: @s1: @s2: @Returns: @s1: @s2: @Returns: @s1: @s2: @Returns: @s1: @s2: @Returns: @p: @len: @charset: @Returns: @p: @len: @charset: @Returns: @Returns: @str: @Returns: libtranslate-0.99/docs/reference/tmpl/translate-session.sgml000644 001750 001750 00000005071 10176431055 026106 0ustar00jylefortjylefort000000 000000 TranslateSession session object A #TranslateSession object is used to translate a text or web page using a set of translation services. After creating a new session with translate_session_new(), you can translate a text or web page using translate_session_translate_text() or translate_session_translate_web_page(). The #TranslateSession struct contains private data only, and should be accessed using the functions below. The error domain of translate_session_translate_text() and translate_session_translate_web_page(). Errors in this domain are from the #TranslateSessionError enumeration. Error codes returned by translate_session_translate_text() and translate_session_translate_web_page(). @TRANSLATE_SESSION_ERROR_NO_SERVICE: no service could translate using the given language pair @services: @Returns: @session: @services: @session: @max_threads: @session: @max_retries: @session: @Returns: @session: @Returns: @session: @Returns: @session: @Returns: @session: @text: @from: @to: @progress_func: @user_data: @err: @Returns: @session: @url: @from: @to: @progress_func: @user_data: @err: @Returns: libtranslate-0.99/docs/reference/tmpl/translate.sgml000644 001750 001750 00000007550 10176431055 024431 0ustar00jylefortjylefort000000 000000 translate library initialization and core functions The following functions, variables and macros are used to determine the libtranslate version, initialize libtranslate, manipulate services, languages and the network proxy. Like #translate_major_version, but from the headers used at application compile time, rather than from the library linked against at application runtime. Like #translate_minor_version, but from the headers used at application compile time, rather than from the library linked against at application runtime. Like #translate_micro_version, but from the headers used at application compile time, rather than from the library linked against at application runtime. The major version number of libtranslate. This variable is in the library, so it represents the translate library you have linked against. Contrast with the #TRANSLATE_MAJOR_VERSION macro, which represents the major version of the libtranslate headers you have included. The minor version number of libtranslate. This variable is in the library, so it represents the translate library you have linked against. Contrast with the #TRANSLATE_MINOR_VERSION macro, which represents the minor version of the libtranslate headers you have included. The micro version number of libtranslate. This variable is in the library, so it represents the translate library you have linked against. Contrast with the #TRANSLATE_MICRO_VERSION macro, which represents the micro version of the libtranslate headers you have included. Generic libtranslate error domain. Errors in this domain are from the #TranslateError enumeration. The error domain of translate_init(). Errors in this domain are from the #TranslateInitError enumeration. Generic error codes returned by libtranslate routines when more specialized error codes are not relevant. @TRANSLATE_ERROR_FAILED: a generic error has occurred @TRANSLATE_ERROR_CANCELLED: the user has cancelled the operation Error codes returned by translate_init(). @TRANSLATE_INIT_ERROR_MULTI_THREADING_NOT_SUPPORTED: multi-threading is not supported @err: @Returns: Whether libtranslate is initialized or not (read-only). You probably do not need to use this variable, as translate_init() can be called multiple times. @err: @Returns: @service: @Returns: @name: @Returns: @Returns: @tag: @name: @Returns: @tag: @Returns: @uri: @Returns: libtranslate-0.99/docs/reference/tmpl/translate-pair.sgml000644 001750 001750 00000003446 10176431055 025362 0ustar00jylefortjylefort000000 000000 TranslatePair language pair object and functions for handling pair lists A #TranslatePair object defines the source and destination languages of a translation, as well as flags specifying the contexts of application of the pair. You only need to create pairs if you are implementing a service (see the @get_pairs method of #TranslateServiceClass). The #TranslatePair struct contains private data only, and should be accessed using the functions below. Specifies the features of a #TranslatePair object. @TRANSLATE_PAIR_TEXT: the pair can be used to translate text @TRANSLATE_PAIR_WEB_PAGE: the pair can be used to translate a web page @flags: @from: @to: @Returns: @pair: @Returns: @pair: @Returns: @pair: @Returns: @pairs: @Returns: @pairs: @Returns: @pairs: @from: @to: @Returns: libtranslate-0.99/docs/reference/tmpl/translate-common.sgml000644 001750 001750 00000000623 10176431055 025711 0ustar00jylefortjylefort000000 000000 translate-common common declarations The following declaration is used in several places. @progress: @user_data: @Returns: libtranslate-0.99/docs/reference/tmpl/libtranslate-unused.sgml000644 001750 001750 00000000000 10176431055 026400 0ustar00jylefortjylefort000000 000000 libtranslate-0.99/docs/reference/xml000777 001750 001750 00000000000 10176431055 021312 5ustar00jylefortjylefort000000 000000 libtranslate-0.99/docs/reference/xml/translate.xml000644 001750 001750 00000043736 10176431055 024121 0ustar00jylefortjylefort000000 000000 translate 3 LIBTRANSLATE Library translatelibrary initialization and core functions Synopsis #define TRANSLATE_MAJOR_VERSION #define TRANSLATE_MINOR_VERSION #define TRANSLATE_MICRO_VERSION extern const unsigned int translate_major_version; extern const unsigned int translate_minor_version; extern const unsigned int translate_micro_version; #define TRANSLATE_ERROR #define TRANSLATE_INIT_ERROR enum TranslateError; enum TranslateInitError; gboolean (*TranslateModuleInitFunc) (GError **err); extern gboolean translate_initialized; gboolean translate_init (GError **err); gboolean translate_add_service (TranslateService *service); TranslateService* translate_get_service (const char *name); GSList* translate_get_services (void); gboolean translate_add_language (const char *tag, const char *name); const char* translate_get_language_name (const char *tag); void translate_set_proxy (const char *uri); char* translate_get_proxy (void); Description The following functions, variables and macros are used to determine the libtranslate version, initialize libtranslate, manipulate services, languages and the network proxy. Details <anchor id="TRANSLATE-MAJOR-VERSION-CAPS"/>TRANSLATE_MAJOR_VERSION TRANSLATE_MAJOR_VERSION#define TRANSLATE_MAJOR_VERSION 0 Like translate_major_version, but from the headers used at application compile time, rather than from the library linked against at application runtime. <anchor id="TRANSLATE-MINOR-VERSION-CAPS"/>TRANSLATE_MINOR_VERSION TRANSLATE_MINOR_VERSION#define TRANSLATE_MINOR_VERSION 99 Like translate_minor_version, but from the headers used at application compile time, rather than from the library linked against at application runtime. <anchor id="TRANSLATE-MICRO-VERSION-CAPS"/>TRANSLATE_MICRO_VERSION TRANSLATE_MICRO_VERSION#define TRANSLATE_MICRO_VERSION 0 Like translate_micro_version, but from the headers used at application compile time, rather than from the library linked against at application runtime. <anchor id="translate-major-version"/>translate_major_version translate_major_versionextern const unsigned int translate_major_version; The major version number of libtranslate. This variable is in the library, so it represents the translate library you have linked against. Contrast with the TRANSLATE_MAJOR_VERSION macro, which represents the major version of the libtranslate headers you have included. <anchor id="translate-minor-version"/>translate_minor_version translate_minor_versionextern const unsigned int translate_minor_version; The minor version number of libtranslate. This variable is in the library, so it represents the translate library you have linked against. Contrast with the TRANSLATE_MINOR_VERSION macro, which represents the minor version of the libtranslate headers you have included. <anchor id="translate-micro-version"/>translate_micro_version translate_micro_versionextern const unsigned int translate_micro_version; The micro version number of libtranslate. This variable is in the library, so it represents the translate library you have linked against. Contrast with the TRANSLATE_MICRO_VERSION macro, which represents the micro version of the libtranslate headers you have included. <anchor id="TRANSLATE-ERROR-CAPS"/>TRANSLATE_ERROR TRANSLATE_ERROR#define TRANSLATE_ERROR (translate_error_quark()) Generic libtranslate error domain. Errors in this domain are from the TranslateError enumeration. <anchor id="TRANSLATE-INIT-ERROR-CAPS"/>TRANSLATE_INIT_ERROR TRANSLATE_INIT_ERROR#define TRANSLATE_INIT_ERROR (translate_init_error_quark()) The error domain of translate_init(). Errors in this domain are from the TranslateInitError enumeration. <anchor id="TranslateError"/>enum TranslateError TranslateErrortypedef enum { TRANSLATE_ERROR_FAILED, TRANSLATE_ERROR_CANCELLED } TranslateError; Generic error codes returned by libtranslate routines when more specialized error codes are not relevant. TRANSLATE_ERROR_FAILED a generic error has occurred TRANSLATE_ERROR_CANCELLED the user has cancelled the operation <anchor id="TranslateInitError"/>enum TranslateInitError TranslateInitErrortypedef enum { TRANSLATE_INIT_ERROR_MULTI_THREADING_NOT_SUPPORTED } TranslateInitError; Error codes returned by translate_init(). TRANSLATE_INIT_ERROR_MULTI_THREADING_NOT_SUPPORTED multi-threading is not supported <anchor id="TranslateModuleInitFunc"/>TranslateModuleInitFunc () TranslateModuleInitFuncgboolean (*TranslateModuleInitFunc) (GError **err); Specifies the type of the module initialization function. A libtranslate module must contain a function named translate_module_init(), which is called when the module is loaded. err : a location to report errors, or NULL. Returns : the function should return FALSE if the module could not be initialized. In such case it should also set err, which is printed by libtranslate. <anchor id="translate-initialized"/>translate_initialized translate_initializedextern gboolean translate_initialized; Whether libtranslate is initialized or not (read-only). You probably do not need to use this variable, as translate_init() can be called multiple times. <anchor id="translate-init"/>translate_init () translate_initgboolean translate_init (GError **err); Initializes libtranslate. This function can safely be called multiple times (however, it is not thread-safe, read below). When it is called more than once, it returns the status (and error if any) of the initial invocation. Unlike other libtranslate functions, translate_init() is not thread-safe, and must not be called while any mutex is held. The reason is that translate_init() may call g_thread_init(). Refer to the g_thread_init() documentation for more details. err : a location to report errors, or NULL. Any of the errors in TranslateInitError or other domains may occur. Returns : TRUE if the initialization was successful, FALSE otherwise (in such case err is set to the error that has occurred). <anchor id="translate-add-service"/>translate_add_service () translate_add_servicegboolean translate_add_service (TranslateService *service); Adds service to the libtranslate service list. If a service with the same name is already in the list, nothing is done and FALSE is returned. service : a service. Returns : TRUE if the service was added, FALSE if it was already in the list. <anchor id="translate-get-service"/>translate_get_service () translate_get_serviceTranslateService* translate_get_service (const char *name); Looks up a service in the libtranslate service list. name : a service name, encoded in ASCII. Returns : a new reference to the service with name name, or NULL if not found. <anchor id="translate-get-services"/>translate_get_services () translate_get_servicesGSList* translate_get_services (void); Gets a copy of the libtranslate service list. When no longer needed, the list should be freed with: g_slist_foreach(list, (GFunc) g_object_unref, NULL); g_slist_free(list); Returns : a copy of the libtranslate service list. <anchor id="translate-add-language"/>translate_add_language () translate_add_languagegboolean translate_add_language (const char *tag, const char *name); Adds a language tag to name mapping to the libtranslate language database. If a language with the same tag already exists in the database, nothing is done and FALSE is returned. Some RFC 3066 tag to name mappings are built into libtranslate and do not need to be added. tag : a RFC 3066 language tag. name : the language human-readable name. Returns : TRUE if the language was added, FALSE if it was already in the database. <anchor id="translate-get-language-name"/>translate_get_language_name () translate_get_language_nameconst char* translate_get_language_name (const char *tag); Looks up a language tag in the libtranslate language database, and returns its human-readable name. tag : a RFC 3066 language tag. Returns : the human-readable name of the language with tag tag, or tag itself if not found. If the returned string is not tag, it is owned by libtranslate and must not be modified or freed. <anchor id="translate-set-proxy"/>translate_set_proxy () translate_set_proxyvoid translate_set_proxy (const char *uri); Sets the URI of a proxy server to use for network transfers. uri : the URI of a proxy server, or NULL to unset. <anchor id="translate-get-proxy"/>translate_get_proxy () translate_get_proxychar* translate_get_proxy (void); Gets the URI thas has been previously set with translate_set_proxy(). If you are implementing a service, you must use this URI for proxying network transfers. Returns : the libtranslate proxy URI, or NULL if no proxy is set. The returned string should be freed when no longer needed. libtranslate-0.99/docs/reference/xml/translate-util.xml000644 001750 001750 00000045033 10176431055 025064 0ustar00jylefortjylefort000000 000000 translate-util 3 LIBTRANSLATE Library translate-utilmiscellaneous utility functions Synopsis gboolean translate_ascii_strcase_equal (gconstpointer s1, gconstpointer s2); unsigned int translate_ascii_strcase_hash (gconstpointer key); char* translate_ascii_strcasestr (const char *big, const char *little); char* translate_ascii_strcasestr_len (const char *big, unsigned int big_len, const char *little); int translate_ascii_strcasecoll (const char *s1, const char *s2); int translate_utf8_strcasecoll (const char *s1, const char *s2); int translate_utf8_strcmp (const char *s1, const char *s2); int translate_utf8_strcasecmp (const char *s1, const char *s2); char* translate_utf8_strpbrk (const char *p, gssize len, const char *charset); char* translate_utf8_strrpbrk (const char *p, gssize len, const char *charset); time_t translate_time (void); char* translate_sgml_ref_expand (const char *str); Description The following functions may come in handy to manipulate ASCII or UTF-8 strings, get the current time, or expand SGML character references and XHTML character entities. Details <anchor id="translate-ascii-strcase-equal"/>translate_ascii_strcase_equal () translate_ascii_strcase_equalgboolean translate_ascii_strcase_equal (gconstpointer s1, gconstpointer s2); Compares two strings, ignoring the case of ASCII characters of both strings, and returns TRUE if they are equal. It can be passed to g_hash_table_new() as the key_equal_func parameter, when using strings as case-insensitive keys in a GHashTable. s1 : a nul-terminated string. s2 : a nul-terminated string. Returns : TRUE if the two strings match. <anchor id="translate-ascii-strcase-hash"/>translate_ascii_strcase_hash () translate_ascii_strcase_hashunsigned int translate_ascii_strcase_hash (gconstpointer key); Converts a string to a hash value, ignoring the case of ASCII characters of the string. It can be passed to g_hash_table_new() as the hash_func parameter, when using strings as case-insensitive keys in a GHashTable. key : a string key. Returns : a hash value corresponding to the key. <anchor id="translate-ascii-strcasestr"/>translate_ascii_strcasestr () translate_ascii_strcasestrchar* translate_ascii_strcasestr (const char *big, const char *little); Locates the first occurrence of little in big, ignoring the case of ASCII characters of both strings. big : a nul-terminated string, which may not be encoded in UTF-8. little : the nul-terminated string to search for, which may not be encoded in UTF-8. Returns : if little is an empty string, big is returned; if little occurs nowhere in big, NULL is returned; otherwise a pointer to the first character of the first occurrence of little in big is returned. <anchor id="translate-ascii-strcasestr-len"/>translate_ascii_strcasestr_len () translate_ascii_strcasestr_lenchar* translate_ascii_strcasestr_len (const char *big, unsigned int big_len, const char *little); Locates the first occurrence of little in big, ignoring the case of ASCII characters of both strings, and limiting the length of the search to big_len. big : a nul-terminated string, which may not be encoded in UTF-8. big_len : length of big in bytes, or -1 if big is nul-terminated. little : the nul-terminated string to search for, which may not be encoded in UTF-8. Returns : if little is an empty string, big is returned; if little occurs nowhere in big, NULL is returned; otherwise a pointer to the first character of the first occurrence of little in big is returned. <anchor id="translate-ascii-strcasecoll"/>translate_ascii_strcasecoll () translate_ascii_strcasecollint translate_ascii_strcasecoll (const char *s1, const char *s2); Compares two strings for ordering using the linguistically correct rules for the current locale, ignoring the case of ASCII characters of both strings. s1 : a nul-terminated string, which may not be encoded in UTF-8. s2 : a nul-terminated string, which may not be encoded in UTF-8. Returns : an integer greater than, equal to, or less than 0, according as s1 is greater than, equal to, or less than s2. <anchor id="translate-utf8-strcasecoll"/>translate_utf8_strcasecoll () translate_utf8_strcasecollint translate_utf8_strcasecoll (const char *s1, const char *s2); Compares two UTF-8 strings for ordering using the linguistically correct rules for the current locale, ignoring the case of both strings. s1 : a nul-terminated string. s2 : a nul-terminated string. Returns : an integer greater than, equal to, or less than 0, according as s1 is greater than, equal to, or less than s2. <anchor id="translate-utf8-strcmp"/>translate_utf8_strcmp () translate_utf8_strcmpint translate_utf8_strcmp (const char *s1, const char *s2); Compares two UTF-8 strings for ordering. s1 : a nul-terminated string. s2 : a nul-terminated string. Returns : an integer greater than, equal to, or less than 0, according as s1 is greater than, equal to, or less than s2. <anchor id="translate-utf8-strcasecmp"/>translate_utf8_strcasecmp () translate_utf8_strcasecmpint translate_utf8_strcasecmp (const char *s1, const char *s2); Compares two UTF-8 strings for ordering, ignoring the case of both strings. s1 : a nul-terminated string. s2 : a nul-terminated string. Returns : an integer greater than, equal to, or less than 0, according as s1 is greater than, equal to, or less than s2. <anchor id="translate-utf8-strpbrk"/>translate_utf8_strpbrk () translate_utf8_strpbrkchar* translate_utf8_strpbrk (const char *p, gssize len, const char *charset); Locates in p the first occurrence of any character in the string charset. p : a nul-terminated string. len : length of p in bytes, or -1 if p is nul-terminated. charset : the set of characters to search for. Returns : the first occurrence of any character of charset in p, or NULL if no characters from charset occur anywhere in p. <anchor id="translate-utf8-strrpbrk"/>translate_utf8_strrpbrk () translate_utf8_strrpbrkchar* translate_utf8_strrpbrk (const char *p, gssize len, const char *charset); Locates in p the last occurrence of any character in the string charset. p : a nul-terminated string. len : length of p in bytes, or -1 if p is nul-terminated. charset : the set of characters to search for. Returns : the last occurrence of any character of charset in p, or NULL if no characters from charset occur anywhere in p. <anchor id="translate-time"/>translate_time () translate_timetime_t translate_time (void); Returns the current time, issuing a warning if an error occurs. Returns : the number of seconds since 0 hours, 0 minutes, 0 seconds, January 1, 1970, Coordinated Universal Time, or 0 if an error has occurred. <anchor id="translate-sgml-ref-expand"/>translate_sgml_ref_expand () translate_sgml_ref_expandchar* translate_sgml_ref_expand (const char *str); Parses str, expanding its SGML character references and XHTML character entities into their Unicode character value. Numerical SGML character references as well as XHTML entities are supported. Unsupported entities will be inserted verbatim into the result. str : a nul-terminated string. Returns : the expansion of str. The returned string should be freed when no longer needed. libtranslate-0.99/docs/reference/xml/translate-session.xml000644 001750 001750 00000056332 10176431055 025576 0ustar00jylefortjylefort000000 000000 TranslateSession 3 LIBTRANSLATE Library TranslateSessionsession object Synopsis struct TranslateSession; #define TRANSLATE_SESSION_ERROR enum TranslateSessionError; TranslateSession* translate_session_new (const GSList *services); void translate_session_set_services (TranslateSession *session, const GSList *services); void translate_session_set_max_threads (TranslateSession *session, unsigned int max_threads); void translate_session_set_max_retries (TranslateSession *session, unsigned int max_retries); GSList* translate_session_get_services (TranslateSession *session); GSList* translate_session_get_pairs (TranslateSession *session); unsigned int translate_session_get_max_threads (TranslateSession *session); int translate_session_get_max_retries (TranslateSession *session); char* translate_session_translate_text (TranslateSession *session, const char *text, const char *from, const char *to, TranslateProgressFunc progress_func, gpointer user_data, GError **err); char* translate_session_translate_web_page (TranslateSession *session, const char *url, const char *from, const char *to, TranslateProgressFunc progress_func, gpointer user_data, GError **err); Object Hierarchy GObject +----TranslateSession Properties "max-retries" gint : Read / Write / Construct "max-threads" guint : Read / Write / Construct "pairs" gpointer : Read "services" gpointer : Read / Write / Construct Description A TranslateSession object is used to translate a text or web page using a set of translation services. After creating a new session with translate_session_new(), you can translate a text or web page using translate_session_translate_text() or translate_session_translate_web_page(). Details <anchor id="TranslateSession-struct"/>struct TranslateSession TranslateSessionstruct TranslateSession; The TranslateSession struct contains private data only, and should be accessed using the functions below. <anchor id="TRANSLATE-SESSION-ERROR-CAPS"/>TRANSLATE_SESSION_ERROR TRANSLATE_SESSION_ERROR#define TRANSLATE_SESSION_ERROR (translate_session_error_quark()) The error domain of translate_session_translate_text() and translate_session_translate_web_page(). Errors in this domain are from the TranslateSessionError enumeration. <anchor id="TranslateSessionError"/>enum TranslateSessionError TranslateSessionErrortypedef enum { TRANSLATE_SESSION_ERROR_NO_SERVICE } TranslateSessionError; Error codes returned by translate_session_translate_text() and translate_session_translate_web_page(). TRANSLATE_SESSION_ERROR_NO_SERVICE no service could translate using the given language pair <anchor id="translate-session-new"/>translate_session_new () translate_session_newTranslateSession* translate_session_new (const GSList *services); Creates a new translation session, which will use services for performing translations. services : a list of TranslateService objects to use. See translate_session_set_services(). Returns : a new translation session. <anchor id="translate-session-set-services"/>translate_session_set_services () translate_session_set_servicesvoid translate_session_set_services (TranslateSession *session, const GSList *services); Sets the services used by session. Default value: NULL. The list of services determines the available language pairs (see translate_session_get_pairs()). The order of the list is important, as translate_session_translate_text() and translate_session_translate_web_page() iterate over the list until the translation can be performed. session : a session. services : a list of TranslateService objects to use. <anchor id="translate-session-set-max-threads"/>translate_session_set_max_threads () translate_session_set_max_threadsvoid translate_session_set_max_threads (TranslateSession *session, unsigned int max_threads); Sets the maximum number of concurrent threads to use for translating text. Default value: 8. session : a session. max_threads : a maximum number of threads. <anchor id="translate-session-set-max-retries"/>translate_session_set_max_retries () translate_session_set_max_retriesvoid translate_session_set_max_retries (TranslateSession *session, unsigned int max_retries); Sets the maximum number of retries per text chunk. Default value: 3. session : a session. max_retries : a maximum number of retries. <anchor id="translate-session-get-services"/>translate_session_get_services () translate_session_get_servicesGSList* translate_session_get_services (TranslateSession *session); Gets the services used by session. When no longer needed, the list should be freed with: g_slist_foreach(list, (GFunc) g_object_unref, NULL); g_slist_free(list); session : a session. Returns : the list of TranslateService objects used by session. <anchor id="translate-session-get-pairs"/>translate_session_get_pairs () translate_session_get_pairsGSList* translate_session_get_pairs (TranslateSession *session); Gets the list of language pairs available for translations. When no longer needed, the list should be freed with: g_slist_foreach(list, (GFunc) g_object_unref, NULL); g_slist_free(list); session : a session. Returns : the list of TranslatePair objects available for translations. <anchor id="translate-session-get-max-threads"/>translate_session_get_max_threads () translate_session_get_max_threadsunsigned int translate_session_get_max_threads (TranslateSession *session); Gets the maximum number of concurrent threads to use for translating text. session : a session. Returns : the maximum number of threads. <anchor id="translate-session-get-max-retries"/>translate_session_get_max_retries () translate_session_get_max_retriesint translate_session_get_max_retries (TranslateSession *session); Gets the maximum number of retries per text chunk. session : a session. Returns : the maximum number of retries. <anchor id="translate-session-translate-text"/>translate_session_translate_text () translate_session_translate_textchar* translate_session_translate_text (TranslateSession *session, const char *text, const char *from, const char *to, TranslateProgressFunc progress_func, gpointer user_data, GError **err); Translates text from the language from into the language to. If progress_func is specified, it may be called periodically to report progress. If, when called, progress_func returns FALSE, the translation is cancelled as soon as possible, NULL is returned, and err is set to an error of domain TRANSLATE_ERROR and code TRANSLATE_ERROR_CANCELLED. session : a session. text : a nul-terminated string. from : a RFC 3066 language tag. to : a RFC 3066 language tag. progress_func : a function to call when progressing, or NULL. user_data : data to pass to progress_func, or NULL. err : a location to report errors, or NULL. Any of the errors in TranslateSessionError, TranslateError or other domains may occur. Returns : the translated text on success, or NULL on failure (in such case err is set). The returned string should be freed when no longer needed. <anchor id="translate-session-translate-web-page"/>translate_session_translate_web_page () translate_session_translate_web_pagechar* translate_session_translate_web_page (TranslateSession *session, const char *url, const char *from, const char *to, TranslateProgressFunc progress_func, gpointer user_data, GError **err); Translates a web page from the language from into the language to. If progress_func is specified, it may be called periodically to report progress. If, when called, progress_func returns FALSE, the translation is cancelled as soon as possible, NULL is returned, and err is set to an error of domain TRANSLATE_ERROR and code TRANSLATE_ERROR_CANCELLED. session : a session. url : an URL. from : a RFC 3066 language tag. to : a RFC 3066 language tag. progress_func : a function to call when progressing, or NULL. user_data : data to pass to progress_func, or NULL. err : a location to report errors, or NULL. Any of the errors in TranslateSessionError, TranslateError or other domains may occur. Returns : an URL pointing to the translated web page on success, or NULL on failure (in such case err is set). The returned string should be freed when no longer needed. Properties "max-retries" (gint : Read / Write / Construct) The maximum number of times to retry a translation of the same chunk (-1 for unlimited). "max-threads" (guint : Read / Write / Construct) The maximum number of translation threads to use. "pairs" (gpointer : Read) The list of pairs this session supports. "services" (gpointer : Read / Write / Construct) The list of services used by this session. libtranslate-0.99/docs/reference/xml/translate-service.xml000644 001750 001750 00000037521 10176431055 025552 0ustar00jylefortjylefort000000 000000 TranslateService 3 LIBTRANSLATE Library TranslateServiceservice object Synopsis struct TranslateService; struct TranslateServiceClass; const char* translate_service_get_name (TranslateService *service); const char* translate_service_get_nick (TranslateService *service); unsigned int translate_service_get_max_chunk_len (TranslateService *service); const GSList* translate_service_get_pairs (TranslateService *service); Object Hierarchy GObject +----TranslateService Properties "max-chunk-len" guint : Read / Write / Construct Only "name" gchararray : Read / Write / Construct Only "nick" gchararray : Read / Write / Construct Only "pairs" gpointer : Read Description A TranslateService object defines a set of language pairs as well as the methods to translate a text or web page using one of the pairs. A new translation service can be implemented in two ways: Adding a definition to the services.xml file The generic module provides an abstract framework for supporting web-based translation services. At runtime, the generic module reads service definitions from services.xml files and creates the services defined in these files. If you are adding support for a web-based translation service, this is the way to go. See the services.xml5 manual page for more details. Creating a TranslateService subclass If the services.xml file cannot satisfactorily be used to describe the service you want to implement, you need to program the service in C by creating a subclass of TranslateService and overriding the get_pairs, translate_text and/or translate_web_page methods. If you want all the applications using libtranslate to be able to use the new service, you need to create a libtranslate module and install it in the appropriate path (see Compiling libtranslate Modules). Otherwise, just integrate the service with your application. In either case, you need to expose an instance of the service to libtranslate by calling translate_add_service(). If the service is included in a module, this needs to be done from translate_module_init(). Otherwise, do it from your application initialization code, somewhere after the call to translate_init(). Details <anchor id="TranslateService-struct"/>struct TranslateService TranslateServicestruct TranslateService; The TranslateService struct contains private data only, and should be accessed using the functions below. <anchor id="TranslateServiceClass"/>struct TranslateServiceClass TranslateServiceClassstruct TranslateServiceClass { GObjectClass parent; gboolean (*get_pairs) (TranslateService *service, GSList **pairs, TranslateProgressFunc progress_func, gpointer user_data, GError **err); char *(*translate_text) (TranslateService *service, const char *text, const char *from, const char *to, TranslateProgressFunc progress_func, gpointer user_data, GError **err); char *(*translate_web_page) (TranslateService *service, const char *url, const char *from, const char *to, TranslateProgressFunc progress_func, gpointer user_data, GError **err); }; The service class contains methods which should be implemented by subclasses in order to provide the service functionality. Implementing the get_pairs method is mandatory. The translate_text and translate_web_page methods are only required if any pair returned by the get_pairs method has the TRANSLATE_PAIR_TEXT or TRANSLATE_PAIR_WEB_PAGE flag set, respectively. GObjectClass parent the parent class gboolean (*get_pairs) (TranslateService *service, GSList **pairs, TranslateProgressFunc progress_func, gpointer user_data, GError **err) Specifies the function which is called to retrieve the list of language pairs implemented by service. The function should return TRUE and store a list of TranslatePair objects in pairs on success, or return FALSE and store an error in err on failure. If progress_func is not NULL, get_pairs should call it at regular intervals with a progress update (or -1 if the progress is unknown), and the user_data argument. If, when called, progress_func returns FALSE, get_pairs must cancel the operation as soon as possible, return NULL, and set err to an error of domain TRANSLATE_ERROR and code TRANSLATE_ERROR_CANCELLED. char* (*translate_text) (TranslateService *service, const char *text, const char *from, const char *to, TranslateProgressFunc progress_func, gpointer user_data, GError **err) Specifies the function which is called to translate a chunk of text. The function should return a newly-allocated string containing the translation of text on success, or return NULL and set err on failure. If the max-chunk-len property of service is not 0, it is guaranteed that the number of UTF-8 characters in text will not exceed max-chunk-len . It is guaranteed that the from/to pair will be a member (with the flag TRANSLATE_PAIR_TEXT set) of the list returned by the get_pairs method. If progress_func is not NULL, translate_text should call it at regular intervals with a progress update (or -1 if the progress is unknown), and the user_data argument. If, when called, progress_func returns FALSE, translate_text must cancel the translation as soon as possible, return NULL, and set err to an error of domain TRANSLATE_ERROR and code TRANSLATE_ERROR_CANCELLED. char* (*translate_web_page) (TranslateService *service, const char *url, const char *from, const char *to, TranslateProgressFunc progress_func, gpointer user_data, GError **err) Specifies the function which is called to translate a web page. The function should return a newly-allocated string containing the URL of the translated web page on success, or return NULL and set err on failure. It is guaranteed that the from/to pair will be a member (with the flag TRANSLATE_PAIR_WEB_PAGE set) of the list returned by the get_pairs method. If progress_func is not NULL, translate_web_page should call it at regular intervals with a progress update (or -1 if the progress is unknown), and the user_data argument. If, when called, progress_func returns FALSE, translate_web_page must cancel the translation as soon as possible, return NULL, and set err to an error of domain TRANSLATE_ERROR and code TRANSLATE_ERROR_CANCELLED. <anchor id="translate-service-get-name"/>translate_service_get_name () translate_service_get_nameconst char* translate_service_get_name (TranslateService *service); Gets the symbolic name of service. service : a service. Returns : the symbolic name of service, encoded in ASCII. <anchor id="translate-service-get-nick"/>translate_service_get_nick () translate_service_get_nickconst char* translate_service_get_nick (TranslateService *service); Gets the human-readable name of service. service : a service. Returns : the human-readable name of service. <anchor id="translate-service-get-max-chunk-len"/>translate_service_get_max_chunk_len () translate_service_get_max_chunk_lenunsigned int translate_service_get_max_chunk_len (TranslateService *service); Gets the maximum chunk length of service. service : a service. Returns : the maximum chunk length of service, in characters. <anchor id="translate-service-get-pairs"/>translate_service_get_pairs () translate_service_get_pairsconst GSList* translate_service_get_pairs (TranslateService *service); Gets the list of language pairs implemented by service. service : a service. Returns : a list of TranslatePair objects. Properties "max-chunk-len" (guint : Read / Write / Construct Only) The maximum length of an input chunk, in characters (0 means unlimited). "name" (gchararray : Read / Write / Construct Only) The service symbolic name, encoded in ASCII. "nick" (gchararray : Read / Write / Construct Only) The service human-readable name. "pairs" (gpointer : Read) The list of language pairs this service implements. libtranslate-0.99/docs/reference/xml/translate-pair.xml000644 001750 001750 00000030374 10176431055 025044 0ustar00jylefortjylefort000000 000000 TranslatePair 3 LIBTRANSLATE Library TranslatePairlanguage pair object and functions for handling pair lists Synopsis struct TranslatePair; enum TranslatePairFlags; TranslatePair* translate_pair_new (TranslatePairFlags flags, const char *from, const char *to); TranslatePairFlags translate_pair_get_flags (TranslatePair *pair); const char* translate_pair_get_from (TranslatePair *pair); const char* translate_pair_get_to (TranslatePair *pair); GSList* translate_pairs_sort_by_tag (GSList *pairs); GSList* translate_pairs_sort_by_name (GSList *pairs); TranslatePair* translate_pairs_find (const GSList *pairs, const char *from, const char *to); Object Hierarchy GObject +----TranslatePair Properties "flags" TranslatePairFlags : Read / Write / Construct Only "from" gchararray : Read / Write / Construct Only "to" gchararray : Read / Write / Construct Only Description A TranslatePair object defines the source and destination languages of a translation, as well as flags specifying the contexts of application of the pair. You only need to create pairs if you are implementing a service (see the get_pairs method of TranslateServiceClass). Details <anchor id="TranslatePair-struct"/>struct TranslatePair TranslatePairstruct TranslatePair; The TranslatePair struct contains private data only, and should be accessed using the functions below. <anchor id="TranslatePairFlags"/>enum TranslatePairFlags TranslatePairFlagstypedef enum { TRANSLATE_PAIR_TEXT = 1 << 0, TRANSLATE_PAIR_WEB_PAGE = 1 << 1 } TranslatePairFlags; Specifies the features of a TranslatePair object. TRANSLATE_PAIR_TEXT the pair can be used to translate text TRANSLATE_PAIR_WEB_PAGE the pair can be used to translate a web page <anchor id="translate-pair-new"/>translate_pair_new () translate_pair_newTranslatePair* translate_pair_new (TranslatePairFlags flags, const char *from, const char *to); Creates a new language pair. flags : the pair flags. from : the source language RFC 3066 tag. to : the destination language RFC 3066 tag. Returns : a new language pair. <anchor id="translate-pair-get-flags"/>translate_pair_get_flags () translate_pair_get_flagsTranslatePairFlags translate_pair_get_flags (TranslatePair *pair); Gets the flags of pair. pair : a pair. Returns : the pair flags. <anchor id="translate-pair-get-from"/>translate_pair_get_from () translate_pair_get_fromconst char* translate_pair_get_from (TranslatePair *pair); Gets the source language of pair. pair : a pair. Returns : the RFC 3066 tag of the source language of pair. <anchor id="translate-pair-get-to"/>translate_pair_get_to () translate_pair_get_toconst char* translate_pair_get_to (TranslatePair *pair); Gets the destination language of pair. pair : a pair. Returns : the RFC 3066 tag of the destination language of pair. <anchor id="translate-pairs-sort-by-tag"/>translate_pairs_sort_by_tag () translate_pairs_sort_by_tagGSList* translate_pairs_sort_by_tag (GSList *pairs); Sorts a pair list by source and destination RFC 3066 tag. Tag comparisons are performed using translate_ascii_strcasecoll(). pairs : a list of TranslatePair objects. Returns : pairs sorted. <anchor id="translate-pairs-sort-by-name"/>translate_pairs_sort_by_name () translate_pairs_sort_by_nameGSList* translate_pairs_sort_by_name (GSList *pairs); Sorts a pair list by source and destination human-readable language name. Names are obtained using translate_get_language_name(), and are compared using translate_utf8_strcasecoll(). pairs : a list of TranslatePair objects. Returns : pairs sorted. <anchor id="translate-pairs-find"/>translate_pairs_find () translate_pairs_findTranslatePair* translate_pairs_find (const GSList *pairs, const char *from, const char *to); Finds the first pair in pairs whose source and/or destination language match from and/or to. pairs : a list of TranslatePair objects. from : a RFC 3066 tag, or NULL. to : a RFC 3066 tag, or NULL. Returns : a pair, or NULL if not found. The returned pair belongs to pairs, its reference count is not incremented. Properties "flags" (TranslatePairFlags : Read / Write / Construct Only) The pair flags. "from" (gchararray : Read / Write / Construct Only) The source language RFC 3066 tag. "to" (gchararray : Read / Write / Construct Only) The destination language RFC 3066 tag. libtranslate-0.99/docs/reference/xml/translate-common.xml000644 001750 001750 00000003662 10176431055 025401 0ustar00jylefortjylefort000000 000000 translate-common 3 LIBTRANSLATE Library translate-commoncommon declarations Synopsis gboolean (*TranslateProgressFunc) (double progress, gpointer user_data); Description The following declaration is used in several places. Details <anchor id="TranslateProgressFunc"/>TranslateProgressFunc () TranslateProgressFuncgboolean (*TranslateProgressFunc) (double progress, gpointer user_data); Specifies the type of function which is called when a task has just progressed. progress : the task progress from 0.0 to 1.0 inclusive, or -1 if the progress is not known. user_data : data associated with the function. Returns : the function should return FALSE if the task must be cancelled. libtranslate-0.99/docs/reference/html000777 001750 001750 00000000000 10176431055 021456 5ustar00jylefortjylefort000000 000000 libtranslate-0.99/docs/reference/html/TranslatePair.html000644 001750 001750 00000035445 10176431055 025203 0ustar00jylefortjylefort000000 000000 TranslatePair

TranslatePair

TranslatePair — language pair object and functions for handling pair lists

Synopsis




struct      TranslatePair;
enum        TranslatePairFlags;
TranslatePair* translate_pair_new           (TranslatePairFlags flags,
                                             const char *from,
                                             const char *to);
TranslatePairFlags translate_pair_get_flags (TranslatePair *pair);
const char* translate_pair_get_from         (TranslatePair *pair);
const char* translate_pair_get_to           (TranslatePair *pair);
GSList*     translate_pairs_sort_by_tag     (GSList *pairs);
GSList*     translate_pairs_sort_by_name    (GSList *pairs);
TranslatePair* translate_pairs_find         (const GSList *pairs,
                                             const char *from,
                                             const char *to);

Object Hierarchy


  GObject
   +----TranslatePair

Properties


  "flags"                TranslatePairFlags   : Read / Write / Construct Only
  "from"                 gchararray           : Read / Write / Construct Only
  "to"                   gchararray           : Read / Write / Construct Only

Description

A TranslatePair object defines the source and destination languages of a translation, as well as flags specifying the contexts of application of the pair.

You only need to create pairs if you are implementing a service (see the get_pairs method of TranslateServiceClass).

Details

struct TranslatePair

struct TranslatePair;

The TranslatePair struct contains private data only, and should be accessed using the functions below.


enum TranslatePairFlags

typedef enum
{
  TRANSLATE_PAIR_TEXT		= 1 << 0,
  TRANSLATE_PAIR_WEB_PAGE	= 1 << 1
} TranslatePairFlags;

Specifies the features of a TranslatePair object.

TRANSLATE_PAIR_TEXTthe pair can be used to translate text
TRANSLATE_PAIR_WEB_PAGEthe pair can be used to translate a web page

translate_pair_new ()

TranslatePair* translate_pair_new           (TranslatePairFlags flags,
                                             const char *from,
                                             const char *to);

Creates a new language pair.

flags: the pair flags.
from: the source language RFC 3066 tag.
to: the destination language RFC 3066 tag.
Returns : a new language pair.

translate_pair_get_flags ()

TranslatePairFlags translate_pair_get_flags (TranslatePair *pair);

Gets the flags of pair.

pair: a pair.
Returns : the pair flags.

translate_pair_get_from ()

const char* translate_pair_get_from         (TranslatePair *pair);

Gets the source language of pair.

pair: a pair.
Returns : the RFC 3066 tag of the source language of pair.

translate_pair_get_to ()

const char* translate_pair_get_to           (TranslatePair *pair);

Gets the destination language of pair.

pair: a pair.
Returns : the RFC 3066 tag of the destination language of pair.

translate_pairs_sort_by_tag ()

GSList*     translate_pairs_sort_by_tag     (GSList *pairs);

Sorts a pair list by source and destination RFC 3066 tag. Tag comparisons are performed using translate_ascii_strcasecoll().

pairs: a list of TranslatePair objects.
Returns : pairs sorted.

translate_pairs_sort_by_name ()

GSList*     translate_pairs_sort_by_name    (GSList *pairs);

Sorts a pair list by source and destination human-readable language name. Names are obtained using translate_get_language_name(), and are compared using translate_utf8_strcasecoll().

pairs: a list of TranslatePair objects.
Returns : pairs sorted.

translate_pairs_find ()

TranslatePair* translate_pairs_find         (const GSList *pairs,
                                             const char *from,
                                             const char *to);

Finds the first pair in pairs whose source and/or destination language match from and/or to.

pairs: a list of TranslatePair objects.
from: a RFC 3066 tag, or NULL.
to: a RFC 3066 tag, or NULL.
Returns : a pair, or NULL if not found. The returned pair belongs to pairs, its reference count is not incremented.

Properties

"flags" (TranslatePairFlags : Read / Write / Construct Only)

The pair flags.

"from" (gchararray : Read / Write / Construct Only)

The source language RFC 3066 tag.

"to" (gchararray : Read / Write / Construct Only)

The destination language RFC 3066 tag.

libtranslate-0.99/docs/reference/html/tutorials.html000644 001750 001750 00000016110 10176431055 024444 0ustar00jylefortjylefort000000 000000 Tutorials

Tutorials

Translating Text or Web Pages

To translate text or web pages, you need to initialize libtranslate with a call to translate_init(), create a new session using translate_session_new(), and call the appropriate translation function, translate_session_translate_text() or translate_session_translate_web_page().

Example1.A Simple Command-Line Translator

The following example demonstrates how to use libtranslate for creating a simple command-line text and web page translator.

The source code of this example is available in the libtranslate source distribution (docs/reference/example-application.c), and is reproduced below. On UNIX, compile it as follows:

$ cc `pkg-config --cflags --libs libtranslate` example-application.c -o example-application

/*
 * Copyright (C) 2005 Jean-Yves Lefort
 * All rights reserved.
 *
 * Redistribution and use in source and binary forms, with or without
 * modification, are permitted provided that the following conditions
 * are met:
 * 1. Redistributions of source code must retain the above copyright
 *    notice, this list of conditions and the following disclaimer.
 * 2. Redistributions in binary form must reproduce the above copyright
 *    notice, this list of conditions and the following disclaimer in the
 *    documentation and/or other materials provided with the distribution.
 * 3. Neither the name of Jean-Yves Lefort nor the names of its contributors
 *    may be used to endorse or promote products derived from this software
 *    without specific prior written permission.
 *
 * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND
 * CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES,
 * INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF
 * MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE
 * DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS
 * BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL,
 * EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED
 * TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE,
 * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON
 * ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY,
 * OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY
 * OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE
 * POSSIBILITY OF SUCH DAMAGE.
 */

#include <locale.h>
#include <stdlib.h>
#include <translate.h>

int
main (int argc, char **argv)
{
  GError *err = NULL;
  GSList *services;
  TranslateSession *session;
  char *translation;

  setlocale(LC_ALL, "");	/* use user's locale */

  if (argc != 4)
    {
      g_printerr("Usage: translate FROM TO {TEXT | HTTP_URL | HTTPS_URL}\n");
      exit(1);
    }

  /* initialize libtranslate */
  if (! translate_init(&err))
    {
      g_printerr("Unable to initialize libtranslate: %s\n", err->message);
      g_error_free(err);
      exit(1);
    }

  /* create a session which will use all the services */
  services = translate_get_services();
  session = translate_session_new(services);
  g_slist_foreach(services, (GFunc) g_object_unref, NULL);
  g_slist_free(services);

  /* translate text or web page, depending on the string given */
  translation = (g_str_has_prefix(argv[3], "http://")
		 || g_str_has_prefix(argv[3], "https://"))
    ? translate_session_translate_web_page(session, argv[3], argv[1], argv[2],
					   NULL, NULL, &err)
    : translate_session_translate_text(session, argv[3], argv[1], argv[2],
				       NULL, NULL, &err);

  /* handle failure */
  if (! translation)
    {
      g_printerr("Unable to translate: %s\n", err->message);
      g_error_free(err);
      exit(1);
    }

  /* success, print the translation, cleanup and exit */
  g_print("%s\n", translation);
  g_free(translation);
  g_object_unref(session);

  return 0;
}
libtranslate-0.99/docs/reference/html/right.png000444 001750 001750 00000000730 10176431055 023352 0ustar00jylefortjylefort000000 000000 PNG  IHDRw=bKGD pHYs  ~tIME2 I%=eIDATx!o@.'**M0$$?1~vIeEuLl&4䝠Bݛ|>$ݶocAppendixA.Built-in RFC 3066 Tag to Name Mappings

AppendixA.Built-in RFC 3066 Tag to Name Mappings

The following tag to name mappings are built into libtranslate. Calling translate_get_language_name() for any tag of this table will return its localized language name.

TableA.1.Built-in RFC 3066 Tag to Name Mappings

RFC 3066 TagEnglish NameFrench Name
aaAfarafar
abAbkhazianabkhaze
aceAchineseaceh
achAcoliacoli
adaAdangmeadangme
adyAdyghe; Adygeiadyghe
afaAfro-Asiatic (Other)afro-asiatiques, autres langues
afhAfrihiliafrihili
afAfrikaansafrikaans
akAkanakan
akkAkkadianakkadien
sqAlbanianalbanais
aleAleutaloute
algAlgonquian languagesalgonquines, langues
amAmharicamharique
angEnglish, Old (ca.450-1100)anglo-saxon (ca.450-1100)
apaApache languagesapache
arArabicarabe
arcAramaicaramen
anAragonesearagonais
hyArmenianarmnien
arnAraucanianaraucan
arpArapahoarapaho
artArtificial (Other)artificielles, autres langues
arwArawakarawak
asAssameseassamais
astAsturian; Bableasturien; bable
athAthapascan languagesathapascanes, langues
ausAustralian languagesaustraliennes, langues
avAvaricavar
aeAvestanavestique
awaAwadhiawadhi
ayAymaraaymara
azAzerbaijaniazri
badBandabanda
baiBamileke languagesbamilks, langues
baBashkirbachkir
balBaluchibaloutchi
bmBambarabambara
banBalinesebalinais
euBasquebasque
basBasabasa
batBaltic (Other)baltiques, autres langues
bejBejabedja
beBelarusianbilorusse
bemBembabemba
bnBengalibengali
berBerber (Other)berbres, autres langues
bhoBhojpuribhojpuri
bhBiharibihari
bikBikolbikol
binBinibini
biBislamabichlamar
blaSiksikablackfoot
bntBantu (Other)bantoues, autres langues
bsBosnianbosniaque
braBrajbraj
brBretonbreton
btkBatak (Indonesia)batak (Indonsie)
buaBuriatbouriate
bugBuginesebugi
bgBulgarianbulgare
myBurmesebirman
bynBlin; Bilinblin; bilen
cadCaddocaddo
caiCentral American Indian (Other)indiennes d'Amrique centrale, autres langues
carCaribcaribe
caCatalan; Valenciancatalan; valencien
cauCaucasian (Other)caucasiennes, autres langues
cebCebuanocebuano
celCeltic (Other)celtiques, autres langues
chChamorrochamorro
chbChibchachibcha
ceChechentchtchne
chgChagataidjaghata
zhChinesechinois
chkChuukesechuuk
chmMarimari
chnChinook jargonchinook, jargon
choChoctawchoctaw
chpChipewyanchipewyan
chrCherokeecherokee
cuChurch Slavic; Old Slavonic; Church Slavonic; Old Bulgarian; Old Church Slavonicslavon d'glise; vieux slave; slavon liturgique; vieux bulgare
cvChuvashtchouvache
chyCheyennecheyenne
cmcChamic languageschames, langues
copCopticcopte
kwCornishcornique
coCorsicancorse
cpeCreoles and pidgins, English based (Other)croles et pidgins anglais, autres
cpfCreoles and pidgins, French-based (Other)croles et pidgins franais, autres
cppCreoles and pidgins, Portuguese-based (Other)croles et pidgins portugais, autres
crCreecree
crhCrimean Tatar; Crimean Turkishtatar de Crim
crpCreoles and pidgins (Other)croles et pidgins divers
csbKashubiankachoube
cusCushitic (Other)couchitiques, autres langues
csCzechtchque
dakDakotadakota
daDanishdanois
darDargwadargwa
dayDayakdayak
delDelawaredelaware
denSlave (Athapascan)esclave (athapascan)
dgrDogribdogrib
dinDinkadinka
dvDivehimaldivien
doiDogridogri
draDravidian (Other)dravidiennes, autres langues
dsbLower Sorbianbas-sorabe
duaDualadouala
dumDutch, Middle (ca.1050-1350)nerlandais moyen (ca. 1050-1350)
nlDutch; Flemishnerlandais; flamand
dyuDyuladioula
dzDzongkhadzongkha
efiEfikefik
egyEgyptian (Ancient)gyptien
ekaEkajukekajuk
elxElamitelamite
enEnglishanglais
enmEnglish, Middle (1100-1500)anglais moyen (1100-1500)
eoEsperantoespranto
etEstonianestonien
eeEwew
ewoEwondowondo
fanFangfang
foFaroesefroen
fatFantifanti
fjFijianfidjien
filFilipino; Pilipinofilipino; pilipino
fiFinnishfinnois
fiuFinno-Ugrian (Other)finno-ougriennes, autres langues
fonFonfon
frFrenchfranais
frmFrench, Middle (ca.1400-1800)franais moyen (1400-1800)
froFrench, Old (842-ca.1400)franais ancien (842-ca.1400)
fyFrisianfrison
ffFulahpeul
furFriulianfrioulan
gaaGaga
gayGayogayo
gbaGbayagbaya
gemGermanic (Other)germaniques, autres langues
kaGeorgiangorgien
deGermanallemand
gezGeezguze
gilGilbertesekiribati
gdGaelic; Scottish Gaelicgalique; galique cossais
gaIrishirlandais
glGallegangalicien
gvManxmanx; mannois
gmhGerman, Middle High (ca.1050-1500)allemand, moyen haut (ca. 1050-1500)
gohGerman, Old High (ca.750-1050)allemand, vieux haut (ca. 750-1050)
gonGondigond
gorGorontalogorontalo
gotGothicgothique
grbGrebogrebo
grcGreek, Ancient (to 1453)grec ancien (jusqu' 1453)
elGreek, Modern (1453-)grec moderne (aprs 1453)
gnGuaraniguarani
guGujaratigoudjrati
gwiGwichingwichin
haiHaidahaida
htHaitian; Haitian Creolehatien; crole hatien
haHausahaoussa
hawHawaiianhawaen
heHebrewhbreu
hzHereroherero
hilHiligaynonhiligaynon
himHimachalihimachali
hiHindihindi
hitHittitehittite
hmnHmonghmong
hoHiri Motuhiri motu
hsbUpper Sorbianhaut-sorabe
huHungarianhongrois
hupHupahupa
ibaIbaniban
igIgboigbo
isIcelandicislandais
ioIdoido
iiSichuan Yiyi de Sichuan
ijoIjoijo
iuInuktitutinuktitut
ieInterlingueinterlingue
iloIlokoilocano
iaInterlingua (International Auxiliary Language Association)interlingua (langue auxiliaire internationale)
incIndic (Other)indo-aryennes, autres langues
idIndonesianindonsien
ineIndo-European (Other)indo-europennes, autres langues
inhIngushingouche
ikInupiaqinupiaq
iraIranian (Other)iraniennes, autres langues
iroIroquoian languagesiroquoises, langues (famille)
itItalianitalien
jvJavanesejavanais
jboLojbanlojban
jaJapanesejaponais
jprJudeo-Persianjudo-persan
jrbJudeo-Arabicjudo-arabe
kaaKara-Kalpakkarakalpak
kabKabylekabyle
kacKachinkachin
klKalaallisut; Greenlandicgroenlandais
kamKambakamba
knKannadakannada
karKarenkaren
ksKashmirikashmiri
krKanurikanouri
kawKawikawi
kkKazakhkazakh
kbdKabardiankabardien
khaKhasikhasi
khiKhoisan (Other)khoisan, autres langues
kmKhmerkhmer
khoKhotanesekhotanais
kiKikuyu; Gikuyukikuyu
rwKinyarwandarwanda
kyKirghizkirghize
kmbKimbundukimbundu
kokKonkanikonkani
kvKomikom
kgKongokongo
koKoreancoren
kosKosraeankosrae
kpeKpellekpell
krcKarachay-Balkarkaratchai balkar
kroKrukrou
kruKurukhkurukh
kjKuanyama; Kwanyamakuanyama; kwanyama
kumKumykkoumyk
kuKurdishkurde
kutKutenaikutenai
ladLadinojudo-espagnol
lahLahndalahnda
lamLambalamba
loLaolao
laLatinlatin
lvLatvianletton
lezLezghianlezghien
liLimburgan; Limburger; Limburgishlimbourgeois
lnLingalalingala
ltLithuanianlituanien
lolMongomongo
lozLozilozi
lbLuxembourgish; Letzeburgeschluxembourgeois
luaLuba-Lulualuba-lulua
luLuba-Katangaluba-katanga
lgGandaganda
luiLuisenoluiseno
lunLundalunda
luoLuo (Kenya and Tanzania)luo (Kenya et Tanzanie)
luslushaiLushai
mkMacedonianmacdonien
madMaduresemadourais
magMagahimagahi
mhMarshallesemarshall
maiMaithilimaithili
makMakasarmakassar
mlMalayalammalayalam
manMandingomandingue
miMaorimaori
mapAustronesian (Other)malayo-polynsiennes, autres langues
mrMarathimarathe
masMasaimassa
msMalaymalais
mdfMokshamoksa
mdrMandarmandar
menMendemend
mgaIrish, Middle (900-1200)irlandais moyen (900-1200)
micMi'kmaq; Micmacmi'kmaq; micmac
minMinangkabauminangkabau
misMiscellaneous languagesdiverses, langues
mkhMon-Khmer (Other)mn-khmer, autres langues
mgMalagasymalgache
mtMaltesemaltais
mncManchumandchou
mniManipurimanipuri
mnoManobo languagesmanobo, langues
mohMohawkmohawk
moMoldavianmoldave
mnMongolianmongol
mosMossimor
mulMultiple languagesmultilingue
munMunda languagesmounda, langues
musCreekmuskogee
mwlMirandesemirandais
mwrMarwarimarvari
mynMayan languagesmaya, langues
myvErzyaerza
nahNahuatlnahuatl
naiNorth American Indianindiennes d'Amrique du Nord, autres langues
napNeapolitannapolitain
naNaurunauruan
nvNavajo; Navahonavaho
nrNdebele, South; South Ndebelendbl du Sud
ndNdebele, North; North Ndebelendbl du Nord
ngNdongandonga
ndsLow German; Low Saxon; German, Low; Saxon, Lowbas allemand; bas saxon; allemand, bas; saxon, bas
neNepalinpalais
newNepal Bhasa; Newarinepal bhasa; newari
niaNiasnias
nicNiger-Kordofanian (Other)nigro-congolaises, autres langues
niuNiueanniu
nnNorwegian Nynorsknorvgien nynorsk
nbNorwegian Bokmlnorvgien bokml
nogNogainoga; nogay
nonNorse, Oldnorrois, vieux
noNorwegiannorvgien
nsoNorthern Sotho; Pedi; Sepedisotho du Nord; pedi; sepedi
nubNubian languagesnubiennes, langues
nwcClassical Newari; Old Newari; Classical Nepal Bhasanewari classique
nyChichewa; Chewa; Nyanjachichewa; chewa; nyanja
nymNyamwezinyamwezi
nynNyankolenyankol
nyoNyoronyoro
nziNzimanzema
ocOccitan (post 1500); Provenaloccitan (aprs 1500); provenal
ojOjibwaojibwa
orOriyaoriya
omOromogalla
osaOsageosage
osOssetian; Osseticosste
otaTurkish, Ottoman (1500-1928)turc ottoman (1500-1928)
otoOtomian languagesotomangue, langues
paaPapuan (Other)papoues, autres langues
pagPangasinanpangasinan
palPahlavipahlavi
pamPampangapampangan
paPanjabi; Punjabipendjabi
papPapiamentopapiamento
pauPalauanpalau
peoPersian, Old (ca.600-400 B.C.)perse, vieux (ca. 600-400 av. J.-C.)
faPersianpersan
phiPhilippine (Other)philippines, autres langues
phnPhoenicianphnicien
piPalipali
plPolishpolonais
ponPohnpeianpohnpei
ptPortugueseportugais
praPrakrit languagesprkrit
proProvenal, Old (to 1500)provenal ancien (jusqu' 1500)
psPushtopachto
qaa-qtz Reserved for local userserve l'usage local
quQuechuaquechua
rajRajasthanirajasthani
rapRapanuirapanui
rarRarotonganrarotonga
roaRomance (Other)romanes, autres langues
rmRaeto-Romancerhto-roman
romRomanytsigane
roRomanianroumain
rnRundirundi
ruRussianrusse
sadSandawesandawe
sgSangosango
sahYakutiakoute
saiSouth American Indian (Other)indiennes d'Amrique du Sud, autres langues
salSalishan languagessalish, langues
samSamaritan Aramaicsamaritain
saSanskritsanskrit
sasSasaksasak
satSantalisantal
srSerbianserbe
scnSiciliansicilien
scoScotscossais
hrCroatiancroate
selSelkupselkoupe
semSemitic (Other)smitiques, autres langues
sgaIrish, Old (to 900)irlandais ancien (jusqu' 900)
sgnSign Languageslangues des signes
shnShanchan
sidSidamosidamo
siSinhala; Sinhalesesinghalais
sioSiouan languagessioux, langues
sitSino-Tibetan (Other)sino-tibtaines, autres langues
slaSlavic (Other)slaves, autres langues
skSlovakslovaque
slSlovenianslovne
smaSouthern Samisami du Sud
seNorthern Samisami du Nord
smiSami languages (Other)sami, autres langues
smjLule Samisami de Lule
smnInari Samisami d'Inari
smSamoansamoan
smsSkolt Samisami skolt
snShonashona
sdSindhisindhi
snkSoninkesonink
sogSogdiansogdien
soSomalisomali
sonSonghaisonghai
stSotho, Southernsotho du Sud
esSpanish; Castilianespagnol; castillan
scSardiniansarde
srrSerersrre
ssaNilo-Saharan (Other)nilo-sahariennes, autres langues
ssSwatiswati
sukSukumasukuma
suSundanesesoundanais
susSususoussou
suxSumeriansumrien
swSwahiliswahili
svSwedishsudois
syrSyriacsyriaque
tyTahitiantahitien
taiTai (Other)thaes, autres langues
taTamiltamoul
ttTatartatar
teTelugutlougou
temTimnetemne
terTerenotereno
tetTetumtetum
tgTajiktadjik
tlTagalogtagalog
thThaitha
boTibetantibtain
tigTigretigr
tiTigrinyatigrigna
tivTivtiv
tklTokelautokelau
tlhKlingon; tlhIngan-Holklingon
tliTlingittlingit
tmhTamashektamacheq
togTonga (Nyasa)tonga (Nyasa)
toTonga (Tonga Islands)tongan (les Tonga)
tpiTok Pisintok pisin
tsiTsimshiantsimshian
tnTswanatswana
tsTsongatsonga
tkTurkmenturkmne
tumTumbukatumbuka
tupTupi languagestupi, langues
trTurkishturc
tutAltaic (Other)altaques, autres langues
tvlTuvalutuvalu
twTwitwi
tyvTuviniantouva
udmUdmurtoudmourte
ugaUgariticougaritique
ugUighur; Uyghurougour
ukUkrainianukrainien
umbUmbunduumbundu
undUndeterminedindtermine
urUrduourdou
uzUzbekouszbek
vaiVaiva
veVendavenda
viVietnamesevietnamien
voVolapkvolapk
votVoticvote
wakWakashan languageswakashennes, langues
walWalamowalamo
warWaraywaray
wasWashowasho
cyWelshgallois
wenSorbian languagessorabes, langues
waWalloonwallon
woWolofwolof
xalKalmykkalmouk
xhXhosaxhosa
yaoYaoyao
yapYapeseyapois
yiYiddishyiddish
yoYorubayoruba
ypkYupik languagesyupik, langues
zapZapoteczapotque
zenZenagazenaga
zaZhuang; Chuangzhuang; chuang
zndZandezand
zuZuluzoulou
zunZunizuni
libtranslate-0.99/docs/reference/html/overview.html000644 001750 001750 00000010311 10176431055 024261 0ustar00jylefortjylefort000000 000000 Overview

Overview

libtranslate is a library for translating text and web pages between natural languages. Its modular infrastructure allows to implement new translation services separately from the core library.

libtranslate is shipped with a generic module supporting web-based translation services such as Babel Fish, Google Language Tools and SYSTRAN. Moreover, the generic module allows to add new services simply by adding a few lines to a XML file (see the services.xml(5) manual page).

libtranslate is implemented on top of the GLib Object System.

Conventions

  • Unless noted otherwise, strings passed to library functions must be encoded in UTF-8.

  • Unless noted otherwise, strings returned by libtranslate are encoded in UTF-8.

  • Unless noted otherwise, libtranslate is thread-safe.

libtranslate-0.99/docs/reference/html/libtranslate.devhelp000644 001750 001750 00000020520 10176431055 025565 0ustar00jylefortjylefort000000 000000 libtranslate-0.99/docs/reference/html/libtranslate-translate.html000644 001750 001750 00000052051 10176431055 027101 0ustar00jylefortjylefort000000 000000 translate

translate

translate — library initialization and core functions

Synopsis




#define     TRANSLATE_MAJOR_VERSION
#define     TRANSLATE_MINOR_VERSION
#define     TRANSLATE_MICRO_VERSION
extern      const unsigned int		translate_major_version;
extern      const unsigned int		translate_minor_version;
extern      const unsigned int		translate_micro_version;
#define     TRANSLATE_ERROR
#define     TRANSLATE_INIT_ERROR
enum        TranslateError;
enum        TranslateInitError;
gboolean    (*TranslateModuleInitFunc)      (GError **err);
extern      gboolean	   translate_initialized;
gboolean    translate_init                  (GError **err);
gboolean    translate_add_service           (TranslateService *service);
TranslateService* translate_get_service     (const char *name);
GSList*     translate_get_services          (void);
gboolean    translate_add_language          (const char *tag,
                                             const char *name);
const char* translate_get_language_name     (const char *tag);
void        translate_set_proxy             (const char *uri);
char*       translate_get_proxy             (void);

Description

The following functions, variables and macros are used to determine the libtranslate version, initialize libtranslate, manipulate services, languages and the network proxy.

Details

TRANSLATE_MAJOR_VERSION

#define TRANSLATE_MAJOR_VERSION		0

Like translate_major_version, but from the headers used at application compile time, rather than from the library linked against at application runtime.


TRANSLATE_MINOR_VERSION

#define TRANSLATE_MINOR_VERSION		99

Like translate_minor_version, but from the headers used at application compile time, rather than from the library linked against at application runtime.


TRANSLATE_MICRO_VERSION

#define TRANSLATE_MICRO_VERSION		0

Like translate_micro_version, but from the headers used at application compile time, rather than from the library linked against at application runtime.


translate_major_version

extern const unsigned int		translate_major_version;

The major version number of libtranslate. This variable is in the library, so it represents the translate library you have linked against. Contrast with the TRANSLATE_MAJOR_VERSION macro, which represents the major version of the libtranslate headers you have included.


translate_minor_version

extern const unsigned int		translate_minor_version;

The minor version number of libtranslate. This variable is in the library, so it represents the translate library you have linked against. Contrast with the TRANSLATE_MINOR_VERSION macro, which represents the minor version of the libtranslate headers you have included.


translate_micro_version

extern const unsigned int		translate_micro_version;

The micro version number of libtranslate. This variable is in the library, so it represents the translate library you have linked against. Contrast with the TRANSLATE_MICRO_VERSION macro, which represents the micro version of the libtranslate headers you have included.


TRANSLATE_ERROR

#define TRANSLATE_ERROR			(translate_error_quark())

Generic libtranslate error domain. Errors in this domain are from the TranslateError enumeration.


TRANSLATE_INIT_ERROR

#define TRANSLATE_INIT_ERROR		(translate_init_error_quark())

The error domain of translate_init(). Errors in this domain are from the TranslateInitError enumeration.


enum TranslateError

typedef enum
{
  TRANSLATE_ERROR_FAILED,
  TRANSLATE_ERROR_CANCELLED
} TranslateError;

Generic error codes returned by libtranslate routines when more specialized error codes are not relevant.

TRANSLATE_ERROR_FAILEDa generic error has occurred
TRANSLATE_ERROR_CANCELLEDthe user has cancelled the operation

enum TranslateInitError

typedef enum
{
  TRANSLATE_INIT_ERROR_MULTI_THREADING_NOT_SUPPORTED
} TranslateInitError;

Error codes returned by translate_init().

TRANSLATE_INIT_ERROR_MULTI_THREADING_NOT_SUPPORTEDmulti-threading is not supported

TranslateModuleInitFunc ()

gboolean    (*TranslateModuleInitFunc)      (GError **err);

Specifies the type of the module initialization function.

A libtranslate module must contain a function named translate_module_init(), which is called when the module is loaded.

err: a location to report errors, or NULL.
Returns : the function should return FALSE if the module could not be initialized. In such case it should also set err, which is printed by libtranslate.

translate_initialized

extern gboolean	   translate_initialized;

Whether libtranslate is initialized or not (read-only). You probably do not need to use this variable, as translate_init() can be called multiple times.


translate_init ()

gboolean    translate_init                  (GError **err);

Initializes libtranslate. This function can safely be called multiple times (however, it is not thread-safe, read below). When it is called more than once, it returns the status (and error if any) of the initial invocation.

Important

Unlike other libtranslate functions, translate_init() is not thread-safe, and must not be called while any mutex is held. The reason is that translate_init() may call g_thread_init(). Refer to the g_thread_init() documentation for more details.

err: a location to report errors, or NULL. Any of the errors in TranslateInitError or other domains may occur.
Returns : TRUE if the initialization was successful, FALSE otherwise (in such case err is set to the error that has occurred).

translate_add_service ()

gboolean    translate_add_service           (TranslateService *service);

Adds service to the libtranslate service list. If a service with the same name is already in the list, nothing is done and FALSE is returned.

service: a service.
Returns : TRUE if the service was added, FALSE if it was already in the list.

translate_get_service ()

TranslateService* translate_get_service     (const char *name);

Looks up a service in the libtranslate service list.

name: a service name, encoded in ASCII.
Returns : a new reference to the service with name name, or NULL if not found.

translate_get_services ()

GSList*     translate_get_services          (void);

Gets a copy of the libtranslate service list. When no longer needed, the list should be freed with:

g_slist_foreach(list, (GFunc) g_object_unref, NULL);
g_slist_free(list);

Returns : a copy of the libtranslate service list.

translate_add_language ()

gboolean    translate_add_language          (const char *tag,
                                             const char *name);

Adds a language tag to name mapping to the libtranslate language database. If a language with the same tag already exists in the database, nothing is done and FALSE is returned.

Note

Some RFC 3066 tag to name mappings are built into libtranslate and do not need to be added.

tag: a RFC 3066 language tag.
name: the language human-readable name.
Returns : TRUE if the language was added, FALSE if it was already in the database.

translate_get_language_name ()

const char* translate_get_language_name     (const char *tag);

Looks up a language tag in the libtranslate language database, and returns its human-readable name.

tag: a RFC 3066 language tag.
Returns : the human-readable name of the language with tag tag, or tag itself if not found. If the returned string is not tag, it is owned by libtranslate and must not be modified or freed.

translate_set_proxy ()

void        translate_set_proxy             (const char *uri);

Sets the URI of a proxy server to use for network transfers.

uri: the URI of a proxy server, or NULL to unset.

translate_get_proxy ()

char*       translate_get_proxy             (void);

Gets the URI thas has been previously set with translate_set_proxy().

If you are implementing a service, you must use this URI for proxying network transfers.

Returns : the libtranslate proxy URI, or NULL if no proxy is set. The returned string should be freed when no longer needed.
libtranslate-0.99/docs/reference/html/libtranslate-translate-util.html000644 001750 001750 00000047204 10176431055 030060 0ustar00jylefortjylefort000000 000000 translate-util

translate-util

translate-util — miscellaneous utility functions

Synopsis




gboolean    translate_ascii_strcase_equal   (gconstpointer s1,
                                             gconstpointer s2);
unsigned int translate_ascii_strcase_hash   (gconstpointer key);
char*       translate_ascii_strcasestr      (const char *big,
                                             const char *little);
char*       translate_ascii_strcasestr_len  (const char *big,
                                             unsigned int big_len,
                                             const char *little);
int         translate_ascii_strcasecoll     (const char *s1,
                                             const char *s2);
int         translate_utf8_strcasecoll      (const char *s1,
                                             const char *s2);
int         translate_utf8_strcmp           (const char *s1,
                                             const char *s2);
int         translate_utf8_strcasecmp       (const char *s1,
                                             const char *s2);
char*       translate_utf8_strpbrk          (const char *p,
                                             gssize len,
                                             const char *charset);
char*       translate_utf8_strrpbrk         (const char *p,
                                             gssize len,
                                             const char *charset);
time_t      translate_time                  (void);
char*       translate_sgml_ref_expand       (const char *str);

Description

The following functions may come in handy to manipulate ASCII or UTF-8 strings, get the current time, or expand SGML character references and XHTML character entities.

Details

translate_ascii_strcase_equal ()

gboolean    translate_ascii_strcase_equal   (gconstpointer s1,
                                             gconstpointer s2);

Compares two strings, ignoring the case of ASCII characters of both strings, and returns TRUE if they are equal. It can be passed to g_hash_table_new() as the key_equal_func parameter, when using strings as case-insensitive keys in a GHashTable.

s1: a nul-terminated string.
s2: a nul-terminated string.
Returns : TRUE if the two strings match.

translate_ascii_strcase_hash ()

unsigned int translate_ascii_strcase_hash   (gconstpointer key);

Converts a string to a hash value, ignoring the case of ASCII characters of the string. It can be passed to g_hash_table_new() as the hash_func parameter, when using strings as case-insensitive keys in a GHashTable.

key: a string key.
Returns : a hash value corresponding to the key.

translate_ascii_strcasestr ()

char*       translate_ascii_strcasestr      (const char *big,
                                             const char *little);

Locates the first occurrence of little in big, ignoring the case of ASCII characters of both strings.

big: a nul-terminated string, which may not be encoded in UTF-8.
little: the nul-terminated string to search for, which may not be encoded in UTF-8.
Returns : if little is an empty string, big is returned; if little occurs nowhere in big, NULL is returned; otherwise a pointer to the first character of the first occurrence of little in big is returned.

translate_ascii_strcasestr_len ()

char*       translate_ascii_strcasestr_len  (const char *big,
                                             unsigned int big_len,
                                             const char *little);

Locates the first occurrence of little in big, ignoring the case of ASCII characters of both strings, and limiting the length of the search to big_len.

big: a nul-terminated string, which may not be encoded in UTF-8.
big_len: length of big in bytes, or -1 if big is nul-terminated.
little: the nul-terminated string to search for, which may not be encoded in UTF-8.
Returns : if little is an empty string, big is returned; if little occurs nowhere in big, NULL is returned; otherwise a pointer to the first character of the first occurrence of little in big is returned.

translate_ascii_strcasecoll ()

int         translate_ascii_strcasecoll     (const char *s1,
                                             const char *s2);

Compares two strings for ordering using the linguistically correct rules for the current locale, ignoring the case of ASCII characters of both strings.

s1: a nul-terminated string, which may not be encoded in UTF-8.
s2: a nul-terminated string, which may not be encoded in UTF-8.
Returns : an integer greater than, equal to, or less than 0, according as s1 is greater than, equal to, or less than s2.

translate_utf8_strcasecoll ()

int         translate_utf8_strcasecoll      (const char *s1,
                                             const char *s2);

Compares two UTF-8 strings for ordering using the linguistically correct rules for the current locale, ignoring the case of both strings.

s1: a nul-terminated string.
s2: a nul-terminated string.
Returns : an integer greater than, equal to, or less than 0, according as s1 is greater than, equal to, or less than s2.

translate_utf8_strcmp ()

int         translate_utf8_strcmp           (const char *s1,
                                             const char *s2);

Compares two UTF-8 strings for ordering.

s1: a nul-terminated string.
s2: a nul-terminated string.
Returns : an integer greater than, equal to, or less than 0, according as s1 is greater than, equal to, or less than s2.

translate_utf8_strcasecmp ()

int         translate_utf8_strcasecmp       (const char *s1,
                                             const char *s2);

Compares two UTF-8 strings for ordering, ignoring the case of both strings.

s1: a nul-terminated string.
s2: a nul-terminated string.
Returns : an integer greater than, equal to, or less than 0, according as s1 is greater than, equal to, or less than s2.

translate_utf8_strpbrk ()

char*       translate_utf8_strpbrk          (const char *p,
                                             gssize len,
                                             const char *charset);

Locates in p the first occurrence of any character in the string charset.

p: a nul-terminated string.
len: length of p in bytes, or -1 if p is nul-terminated.
charset: the set of characters to search for.
Returns : the first occurrence of any character of charset in p, or NULL if no characters from charset occur anywhere in p.

translate_utf8_strrpbrk ()

char*       translate_utf8_strrpbrk         (const char *p,
                                             gssize len,
                                             const char *charset);

Locates in p the last occurrence of any character in the string charset.

p: a nul-terminated string.
len: length of p in bytes, or -1 if p is nul-terminated.
charset: the set of characters to search for.
Returns : the last occurrence of any character of charset in p, or NULL if no characters from charset occur anywhere in p.

translate_time ()

time_t      translate_time                  (void);

Returns the current time, issuing a warning if an error occurs.

Returns : the number of seconds since 0 hours, 0 minutes, 0 seconds, January 1, 1970, Coordinated Universal Time, or 0 if an error has occurred.

translate_sgml_ref_expand ()

char*       translate_sgml_ref_expand       (const char *str);

Parses str, expanding its SGML character references and XHTML character entities into their Unicode character value.

Numerical SGML character references as well as XHTML entities are supported. Unsupported entities will be inserted verbatim into the result.

str: a nul-terminated string.
Returns : the expansion of str. The returned string should be freed when no longer needed.
libtranslate-0.99/docs/reference/html/libtranslate-translate-common.html000644 001750 001750 00000010147 10176431055 030367 0ustar00jylefortjylefort000000 000000 translate-common

translate-common

translate-common — common declarations

Synopsis




gboolean    (*TranslateProgressFunc)        (double progress,
                                             gpointer user_data);

Description

The following declaration is used in several places.

Details

TranslateProgressFunc ()

gboolean    (*TranslateProgressFunc)        (double progress,
                                             gpointer user_data);

Specifies the type of function which is called when a task has just progressed.

progress: the task progress from 0.0 to 1.0 inclusive, or -1 if the progress is not known.
user_data: data associated with the function.
Returns : the function should return FALSE if the task must be cancelled.
libtranslate-0.99/docs/reference/html/left.png000444 001750 001750 00000000713 10176431055 023170 0ustar00jylefortjylefort000000 000000 PNG  IHDRw=bKGD pHYs  ~tIME1&[(XIDATx!OPE*ID%~ꊯ"p'ŏ`sܖrKf hmiIz}ܯI.p\`x l?l[,Hk<#c%\AUx[S7n6rzEs1j@NL$ݤi0 5/}\EKIo͓$a0jdFbkIAh>WlC'?tk;|/t*INZ^`y4Nr]׮ J<ڐt`X1@p䀸dZ')hK $V?%]+LsgUK"w53OIENDB`libtranslate-0.99/docs/reference/html/ix01.html000644 001750 001750 00000021544 10176431055 023206 0ustar00jylefortjylefort000000 000000 Index

Index

T

TranslateError, enum TranslateError
TranslateInitError, enum TranslateInitError
TranslateModuleInitFunc, TranslateModuleInitFunc ()
TranslatePair, struct TranslatePair
TranslatePairFlags, enum TranslatePairFlags
TranslateProgressFunc, TranslateProgressFunc ()
TranslateService, struct TranslateService
TranslateServiceClass, struct TranslateServiceClass
TranslateSession, struct TranslateSession
TranslateSessionError, enum TranslateSessionError
translate_add_language, translate_add_language ()
translate_add_service, translate_add_service ()
translate_ascii_strcasecoll, translate_ascii_strcasecoll ()
translate_ascii_strcasestr, translate_ascii_strcasestr ()
translate_ascii_strcasestr_len, translate_ascii_strcasestr_len ()
translate_ascii_strcase_equal, translate_ascii_strcase_equal ()
translate_ascii_strcase_hash, translate_ascii_strcase_hash ()
TRANSLATE_ERROR, TRANSLATE_ERROR
translate_get_language_name, translate_get_language_name ()
translate_get_proxy, translate_get_proxy ()
translate_get_service, translate_get_service ()
translate_get_services, translate_get_services ()
translate_init, translate_init ()
translate_initialized, translate_initialized
TRANSLATE_INIT_ERROR, TRANSLATE_INIT_ERROR
TRANSLATE_MAJOR_VERSION, TRANSLATE_MAJOR_VERSION
translate_major_version, translate_major_version
TRANSLATE_MICRO_VERSION, TRANSLATE_MICRO_VERSION
translate_micro_version, translate_micro_version
TRANSLATE_MINOR_VERSION, TRANSLATE_MINOR_VERSION
translate_minor_version, translate_minor_version
translate_pairs_find, translate_pairs_find ()
translate_pairs_sort_by_name, translate_pairs_sort_by_name ()
translate_pairs_sort_by_tag, translate_pairs_sort_by_tag ()
translate_pair_get_flags, translate_pair_get_flags ()
translate_pair_get_from, translate_pair_get_from ()
translate_pair_get_to, translate_pair_get_to ()
translate_pair_new, translate_pair_new ()
translate_service_get_max_chunk_len, translate_service_get_max_chunk_len ()
translate_service_get_name, translate_service_get_name ()
translate_service_get_nick, translate_service_get_nick ()
translate_service_get_pairs, translate_service_get_pairs ()
TRANSLATE_SESSION_ERROR, TRANSLATE_SESSION_ERROR
translate_session_get_max_retries, translate_session_get_max_retries ()
translate_session_get_max_threads, translate_session_get_max_threads ()
translate_session_get_pairs, translate_session_get_pairs ()
translate_session_get_services, translate_session_get_services ()
translate_session_new, translate_session_new ()
translate_session_set_max_retries, translate_session_set_max_retries ()
translate_session_set_max_threads, translate_session_set_max_threads ()
translate_session_set_services, translate_session_set_services ()
translate_session_translate_text, translate_session_translate_text ()
translate_session_translate_web_page, translate_session_translate_web_page ()
translate_set_proxy, translate_set_proxy ()
translate_sgml_ref_expand, translate_sgml_ref_expand ()
translate_time, translate_time ()
translate_utf8_strcasecmp, translate_utf8_strcasecmp ()
translate_utf8_strcasecoll, translate_utf8_strcasecoll ()
translate_utf8_strcmp, translate_utf8_strcmp ()
translate_utf8_strpbrk, translate_utf8_strpbrk ()
translate_utf8_strrpbrk, translate_utf8_strrpbrk ()
libtranslate-0.99/docs/reference/html/index.sgml000644 001750 001750 00000020325 10176431055 023526 0ustar00jylefortjylefort000000 000000 libtranslate-0.99/docs/reference/html/index.html000644 001750 001750 00000010073 10176431055 023527 0ustar00jylefortjylefort000000 000000 libtranslate Reference Manual

Jean-Yves Lefort

for libtranslate 0.99


Table of Contents

Overview
Conventions
Compiling libtranslate Applications
Compiling libtranslate Modules
Tutorials
Translating Text or Web Pages
Implementing Translation Services
API Reference
Object Hierarchy
translate - library initialization and core functions
translate-common - common declarations
TranslatePair - language pair object and functions for handling pair lists
TranslateService - service object
TranslateSession - session object
translate-util - miscellaneous utility functions
A. Built-in RFC 3066 Tag to Name Mappings
Index
libtranslate-0.99/docs/reference/html/home.png000444 001750 001750 00000001216 10176431055 023165 0ustar00jylefortjylefort000000 000000 PNG  IHDRw=bKGD pHYs  ~tIME1KvIDATxՕkq?rCp ~CnpCAAJ .B-\'G]:ܠC -(8 Ԁ!fDғklbRoyxwpðIJ<of_-@RHf֟t^ښ$Q|pgv;X^^&s(bwwZF9&3඙ ^IRZUE.0Z]]U PYM8HGIekqqҀ! $۬3n e{-/seeeÌXOͷ$8==USQRR'9-s+B^ Cەs+%<7W :2IENDB`libtranslate-0.99/docs/reference/html/compiling-modules.html000644 001750 001750 00000011443 10176431055 026051 0ustar00jylefortjylefort000000 000000 Compiling libtranslate Modules

Compiling libtranslate Modules

Compiling on UNIX

To compile a libtranslate module, you need to tell the compiler where to find the libtranslate header files. This is done with the pkg-config utility.

For instance, to compile a libtranslate Hello World module, you would type the following:

$ cc `pkg-config --cflags libtranslate` -shared -fPIC hello.c -o hello.so

Compiling on UNIX With Autoconf, Automake and Libtool

To compile a libtranslate module using GNU Autoconf, GNU Automake and GNU Libtool, insert the following line at the appropriate place in the configure.ac file:

PKG_CHECK_MODULES(LIBTRANSLATE, libtranslate,, [AC_MSG_ERROR([unable to find libtranslate])])

and insert the following lines in the appropriate Makefile.am file:

modulesdir = $(libdir)/libtranslate/modules
modules_LTLIBRARIES = hello.la
hello_la_SOURCES = hello.c
hello_la_CPPFLAGS = $(LIBTRANSLATE_CFLAGS)
hello_la_LDFLAGS = -avoid-version -module

Module Search Paths

libtranslate loads modules from prefix/libtranslate/modules (where prefix is the prefix where libtranslate is installed) and from ~/.libtranslate/modules (where ~ is the path to your home directory). Filenames not having the system-specific shared object extension (usually .so) are ignored.

libtranslate-0.99/docs/reference/html/ch02s02.html000644 001750 001750 00000023612 10176431055 023504 0ustar00jylefortjylefort000000 000000 Implementing Translation Services

Implementing Translation Services

To implement a translation service, you need to create a subclass of TranslateService, create an instance of your subclass with g_object_new(), and add the service using translate_add_service().

Web-Based Services

If you are implementing support for a web-based service, just adding a definition to the services.xml file (without having to resort to C code) might be sufficient. See the services.xml(5) manual page.

Example2.A Simple Service for Reversing Text

The following example demonstrates how to create an add-on service for libtranslate, and compile it either as a module or as a standalone application.

The source code of this example is available in the libtranslate source distribution (docs/reference/example-service.c), and is reproduced below. To build a module on UNIX, compile the source as follows:

$ cc `pkg-config --cflags libtranslate` -shared -fPIC example-service.c -o example-service.so

To build a standalone application on UNIX, compile the source as follows:

$ cc `pkg-config --cflags --libs libtranslate` -DSTANDALONE example-service.c -o example-service

/*
 * Copyright (C) 2005 Jean-Yves Lefort
 * All rights reserved.
 *
 * Redistribution and use in source and binary forms, with or without
 * modification, are permitted provided that the following conditions
 * are met:
 * 1. Redistributions of source code must retain the above copyright
 *    notice, this list of conditions and the following disclaimer.
 * 2. Redistributions in binary form must reproduce the above copyright
 *    notice, this list of conditions and the following disclaimer in the
 *    documentation and/or other materials provided with the distribution.
 * 3. Neither the name of Jean-Yves Lefort nor the names of its contributors
 *    may be used to endorse or promote products derived from this software
 *    without specific prior written permission.
 *
 * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND
 * CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES,
 * INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF
 * MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE
 * DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS
 * BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL,
 * EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED
 * TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE,
 * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON
 * ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY,
 * OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY
 * OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE
 * POSSIBILITY OF SUCH DAMAGE.
 */

#include <locale.h>
#include <stdlib.h>
#include <gmodule.h>
#include <translate.h>

#define REVERSE_TYPE_SERVICE		(reverse_service_get_type())

typedef struct
{
  TranslateService	parent;
} ReverseService;

typedef struct
{
  TranslateServiceClass	parent;
} ReverseServiceClass;

static gboolean
reverse_service_get_pairs (TranslateService *service,
			   GSList **pairs,
			   TranslateProgressFunc progress_func,
			   gpointer user_data,
			   GError **err)
{
  /* initialize the list */
  *pairs = NULL;

  /* add the English -> English (reversed) pair */
  *pairs = g_slist_append(*pairs,
			  translate_pair_new(TRANSLATE_PAIR_TEXT,
					     "en", "en-x-rev"));

  /* add the English (reversed) -> English pair */
  *pairs = g_slist_append(*pairs,
			  translate_pair_new(TRANSLATE_PAIR_TEXT,
					     "en-x-rev", "en"));

  return TRUE;			/* success */
}

static char *
reverse_service_translate_text (TranslateService *service,
				const char *text,
				const char *from,
				const char *to,
				TranslateProgressFunc progress_func,
				gpointer user_data,
				GError **err)
{
  return g_utf8_strreverse(text, -1);
}

static void
reverse_service_class_init (ReverseServiceClass *class)
{
  TranslateServiceClass *service_class = TRANSLATE_SERVICE_CLASS(class);
  
  service_class->get_pairs = reverse_service_get_pairs;
  service_class->translate_text = reverse_service_translate_text;
}

static void
reverse_service_register_type (GType *type)
{
  static const GTypeInfo info = {
    sizeof(ReverseServiceClass),
    NULL,
    NULL,
    (GClassInitFunc) reverse_service_class_init,
    NULL,
    NULL,
    sizeof(ReverseService),
    0,
    NULL
  };
  
  *type = g_type_register_static(TRANSLATE_TYPE_SERVICE,
				 "ReverseService",
				 &info,
				 0);
}

static GType
reverse_service_get_type (void)
{
  static GType type;
  static GOnce once = G_ONCE_INIT;

  g_once(&once, (GThreadFunc) reverse_service_register_type, &type);

  return type;
}

static TranslateService *
reverse_service_new (void)
{
  return g_object_new(REVERSE_TYPE_SERVICE,
		      "name", "reverse",
		      "nick", "Reverse",
		      NULL);
}

static void
reverse_service_register_tag (void)
{
  /*
   * Register our en-x-rev custom tag. The tag name was chosen
   * according to rules specified in RFC 3066 section 2.2.
   *
   * Note that registering a language name is optional and has
   * aesthetical purposes only. If no name exists for a particular
   * tag, the tag itself will be used.
   */
  translate_add_language("en-x-rev", "English (reversed)");
}

#ifdef STANDALONE

int
main (int argc, char **argv)
{
  GError *err = NULL;
  GSList *services = NULL;
  TranslateSession *session;
  char *reversed;

  setlocale(LC_ALL, "");	/* use user's locale */

  if (argc != 2)
    {
      g_printerr("Usage: rev TEXT\n");
      exit(1);
    }
  
  /* initialize libtranslate */
  if (! translate_init(&err))
    {
      g_printerr("Unable to initialize libtranslate: %s\n", err->message);
      g_error_free(err);
      exit(1);
    }

  /* register our custom tag */
  reverse_service_register_tag();

  /* create a session which will use our reverse service */
  services = g_slist_append(services, reverse_service_new());
  session = translate_session_new(services);
  g_slist_foreach(services, (GFunc) g_object_unref, NULL);
  g_slist_free(services);

  /* reverse the given text */
  reversed = translate_session_translate_text(session, argv[1], "en", "en-x-rev",
					      NULL, NULL, &err);

  /* handle failure */
  if (! reversed)
    {
      g_printerr("Unable to reverse text: %s\n", err->message);
      g_error_free(err);
      exit(1);
    }

  /* success, print the reversed text, cleanup and exit */
  g_print("%s", reversed);
  g_free(reversed);
  g_object_unref(session);

  return 0;
}

#else /* ! STANDALONE */

G_MODULE_EXPORT gboolean
translate_module_init (GError **err)
{
  TranslateService *service;

  /* register our custom tag */
  reverse_service_register_tag();

  /* add the reverse service */
  service = reverse_service_new();
  translate_add_service(service);
  g_object_unref(service);

  return TRUE;			/* success */
}

#endif /* ! STANDALONE */
libtranslate-0.99/docs/reference/html/ch01s02.html000644 001750 001750 00000011237 10176431055 023503 0ustar00jylefortjylefort000000 000000 Compiling libtranslate Applications

Compiling libtranslate Applications

Compiling on UNIX

To compile a libtranslate application, you need to tell the compiler where to find the libtranslate header files and libraries. This is done with the pkg-config utility.

The following interactive shell session demonstrates how pkg-config is used:

$ pkg-config --cflags libtranslate
-I/usr/local/include/libtranslate -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include
$ pkg-config --libs libtranslate
-L/usr/local/lib -ltranslate -lgobject-2.0 -lglib-2.0 -liconv

The simplest way to compile a program is to use the "backticks" feature of the shell. If you enclose a command in backticks (not single quotes), then its output will be substituted into the command line before execution. So to compile a libtranslate Hello World, you would type the following:

$ cc `pkg-config --cflags --libs libtranslate` hello.c -o hello

Compiling on UNIX With Autoconf and Automake

To compile a libtranslate application using GNU Autoconf and GNU Automake, insert the following line at the appropriate place in the configure.ac file:

PKG_CHECK_MODULES(LIBTRANSLATE, libtranslate,, [AC_MSG_ERROR([unable to find libtranslate])])

and insert the following lines in the appropriate Makefile.am file:

bin_PROGRAMS = hello
hello_SOURCES = hello.c
hello_CPPFLAGS = $(LIBTRANSLATE_CFLAGS)
hello_LDFLAGS = $(LIBTRANSLATE_LIBS)

libtranslate-0.99/docs/reference/html/up.png000444 001750 001750 00000000626 10176431055 022665 0ustar00jylefortjylefort000000 000000 PNG  IHDRw=bKGD pHYs  ~tIME2.E#IDATx=J@Fo] !+2[Z<@/9|t$D9nnBjBRIsI:H8UPN1fcsN95M㧖ɵ 束1~pEe$I 7nrDf!;`'ykI䲤sI_]y^^I>O>?YBIENDB`libtranslate-0.99/docs/reference/html/api-reference.html000644 001750 001750 00000007136 10176431055 025133 0ustar00jylefortjylefort000000 000000 API Reference

API Reference

Table of Contents

Object Hierarchy
translate - library initialization and core functions
translate-common - common declarations
TranslatePair - language pair object and functions for handling pair lists
TranslateService - service object
TranslateSession - session object
translate-util - miscellaneous utility functions

Object Hierarchy

    GObject
        TranslatePair
        TranslateService
        TranslateSession
    GInterface
libtranslate-0.99/docs/reference/html/TranslateSession.html000644 001750 001750 00000062713 10176431055 025731 0ustar00jylefortjylefort000000 000000 TranslateSession

TranslateSession

TranslateSession — session object

Synopsis




struct      TranslateSession;
#define     TRANSLATE_SESSION_ERROR
enum        TranslateSessionError;
TranslateSession* translate_session_new     (const GSList *services);
void        translate_session_set_services  (TranslateSession *session,
                                             const GSList *services);
void        translate_session_set_max_threads
                                            (TranslateSession *session,
                                             unsigned int max_threads);
void        translate_session_set_max_retries
                                            (TranslateSession *session,
                                             unsigned int max_retries);
GSList*     translate_session_get_services  (TranslateSession *session);
GSList*     translate_session_get_pairs     (TranslateSession *session);
unsigned int translate_session_get_max_threads
                                            (TranslateSession *session);
int         translate_session_get_max_retries
                                            (TranslateSession *session);
char*       translate_session_translate_text
                                            (TranslateSession *session,
                                             const char *text,
                                             const char *from,
                                             const char *to,
                                             TranslateProgressFunc progress_func,
                                             gpointer user_data,
                                             GError **err);
char*       translate_session_translate_web_page
                                            (TranslateSession *session,
                                             const char *url,
                                             const char *from,
                                             const char *to,
                                             TranslateProgressFunc progress_func,
                                             gpointer user_data,
                                             GError **err);

Object Hierarchy


  GObject
   +----TranslateSession

Properties


  "max-retries"          gint                 : Read / Write / Construct
  "max-threads"          guint                : Read / Write / Construct
  "pairs"                gpointer             : Read
  "services"             gpointer             : Read / Write / Construct

Description

A TranslateSession object is used to translate a text or web page using a set of translation services. After creating a new session with translate_session_new(), you can translate a text or web page using translate_session_translate_text() or translate_session_translate_web_page().

Details

struct TranslateSession

struct TranslateSession;

The TranslateSession struct contains private data only, and should be accessed using the functions below.


TRANSLATE_SESSION_ERROR

#define TRANSLATE_SESSION_ERROR			(translate_session_error_quark())

The error domain of translate_session_translate_text() and translate_session_translate_web_page(). Errors in this domain are from the TranslateSessionError enumeration.


enum TranslateSessionError

typedef enum
{
  TRANSLATE_SESSION_ERROR_NO_SERVICE
} TranslateSessionError;

Error codes returned by translate_session_translate_text() and translate_session_translate_web_page().

TRANSLATE_SESSION_ERROR_NO_SERVICEno service could translate using the given language pair

translate_session_new ()

TranslateSession* translate_session_new     (const GSList *services);

Creates a new translation session, which will use services for performing translations.

services: a list of TranslateService objects to use. See translate_session_set_services().
Returns : a new translation session.

translate_session_set_services ()

void        translate_session_set_services  (TranslateSession *session,
                                             const GSList *services);

Sets the services used by session. Default value: NULL.

The list of services determines the available language pairs (see translate_session_get_pairs()). The order of the list is important, as translate_session_translate_text() and translate_session_translate_web_page() iterate over the list until the translation can be performed.

session: a session.
services: a list of TranslateService objects to use.

translate_session_set_max_threads ()

void        translate_session_set_max_threads
                                            (TranslateSession *session,
                                             unsigned int max_threads);

Sets the maximum number of concurrent threads to use for translating text. Default value: 8.

session: a session.
max_threads: a maximum number of threads.

translate_session_set_max_retries ()

void        translate_session_set_max_retries
                                            (TranslateSession *session,
                                             unsigned int max_retries);

Sets the maximum number of retries per text chunk. Default value: 3.

session: a session.
max_retries: a maximum number of retries.

translate_session_get_services ()

GSList*     translate_session_get_services  (TranslateSession *session);

Gets the services used by session. When no longer needed, the list should be freed with:

g_slist_foreach(list, (GFunc) g_object_unref, NULL);
g_slist_free(list);

session: a session.
Returns : the list of TranslateService objects used by session.

translate_session_get_pairs ()

GSList*     translate_session_get_pairs     (TranslateSession *session);

Gets the list of language pairs available for translations. When no longer needed, the list should be freed with:

g_slist_foreach(list, (GFunc) g_object_unref, NULL);
g_slist_free(list);

session: a session.
Returns : the list of TranslatePair objects available for translations.

translate_session_get_max_threads ()

unsigned int translate_session_get_max_threads
                                            (TranslateSession *session);

Gets the maximum number of concurrent threads to use for translating text.

session: a session.
Returns : the maximum number of threads.

translate_session_get_max_retries ()

int         translate_session_get_max_retries
                                            (TranslateSession *session);

Gets the maximum number of retries per text chunk.

session: a session.
Returns : the maximum number of retries.

translate_session_translate_text ()

char*       translate_session_translate_text
                                            (TranslateSession *session,
                                             const char *text,
                                             const char *from,
                                             const char *to,
                                             TranslateProgressFunc progress_func,
                                             gpointer user_data,
                                             GError **err);

Translates text from the language from into the language to.

If progress_func is specified, it may be called periodically to report progress. If, when called, progress_func returns FALSE, the translation is cancelled as soon as possible, NULL is returned, and err is set to an error of domain TRANSLATE_ERROR and code TRANSLATE_ERROR_CANCELLED.

session: a session.
text: a nul-terminated string.
from: a RFC 3066 language tag.
to: a RFC 3066 language tag.
progress_func: a function to call when progressing, or NULL.
user_data: data to pass to progress_func, or NULL.
err: a location to report errors, or NULL. Any of the errors in TranslateSessionError, TranslateError or other domains may occur.
Returns : the translated text on success, or NULL on failure (in such case err is set). The returned string should be freed when no longer needed.

translate_session_translate_web_page ()

char*       translate_session_translate_web_page
                                            (TranslateSession *session,
                                             const char *url,
                                             const char *from,
                                             const char *to,
                                             TranslateProgressFunc progress_func,
                                             gpointer user_data,
                                             GError **err);

Translates a web page from the language from into the language to.

If progress_func is specified, it may be called periodically to report progress. If, when called, progress_func returns FALSE, the translation is cancelled as soon as possible, NULL is returned, and err is set to an error of domain TRANSLATE_ERROR and code TRANSLATE_ERROR_CANCELLED.

session: a session.
url: an URL.
from: a RFC 3066 language tag.
to: a RFC 3066 language tag.
progress_func: a function to call when progressing, or NULL.
user_data: data to pass to progress_func, or NULL.
err: a location to report errors, or NULL. Any of the errors in TranslateSessionError, TranslateError or other domains may occur.
Returns : an URL pointing to the translated web page on success, or NULL on failure (in such case err is set). The returned string should be freed when no longer needed.

Properties

"max-retries" (gint : Read / Write / Construct)

The maximum number of times to retry a translation of the same chunk (-1 for unlimited).

"max-threads" (guint : Read / Write / Construct)

The maximum number of translation threads to use.

"pairs" (gpointer : Read)

The list of pairs this session supports.

"services" (gpointer : Read / Write / Construct)

The list of services used by this session.

libtranslate-0.99/docs/reference/html/TranslateService.html000644 001750 001750 00000045112 10176431055 025700 0ustar00jylefortjylefort000000 000000 TranslateService

TranslateService

TranslateService — service object

Object Hierarchy


  GObject
   +----TranslateService

Properties


  "max-chunk-len"        guint                : Read / Write / Construct Only
  "name"                 gchararray           : Read / Write / Construct Only
  "nick"                 gchararray           : Read / Write / Construct Only
  "pairs"                gpointer             : Read

Description

A TranslateService object defines a set of language pairs as well as the methods to translate a text or web page using one of the pairs.

A new translation service can be implemented in two ways:

Adding a definition to the services.xml file

The generic module provides an abstract framework for supporting web-based translation services. At runtime, the generic module reads service definitions from services.xml files and creates the services defined in these files.

If you are adding support for a web-based translation service, this is the way to go. See the services.xml(5) manual page for more details.

Creating a TranslateService subclass

If the services.xml file cannot satisfactorily be used to describe the service you want to implement, you need to program the service in C by creating a subclass of TranslateService and overriding the get_pairs, translate_text and/or translate_web_page methods.

If you want all the applications using libtranslate to be able to use the new service, you need to create a libtranslate module and install it in the appropriate path (see Compiling libtranslate Modules). Otherwise, just integrate the service with your application. In either case, you need to expose an instance of the service to libtranslate by calling translate_add_service(). If the service is included in a module, this needs to be done from translate_module_init(). Otherwise, do it from your application initialization code, somewhere after the call to translate_init().

Details

struct TranslateService

struct TranslateService;

The TranslateService struct contains private data only, and should be accessed using the functions below.


struct TranslateServiceClass

struct TranslateServiceClass {

  GObjectClass		parent;


  gboolean	 (*get_pairs)		(TranslateService	 *service,
					 GSList			**pairs,
					 TranslateProgressFunc	  progress_func,
					 gpointer		  user_data,
					 GError			**err);
  char		*(*translate_text)	(TranslateService	 *service,
					 const char		 *text,
					 const char		 *from,
					 const char		 *to,
					 TranslateProgressFunc	  progress_func,
					 gpointer		  user_data,
					 GError			**err);
  char		*(*translate_web_page)	(TranslateService	 *service,
					 const char		 *url,
					 const char		 *from,
					 const char		 *to,
					 TranslateProgressFunc	  progress_func,
					 gpointer		  user_data,
					 GError			**err);

};

The service class contains methods which should be implemented by subclasses in order to provide the service functionality.

Implementing the get_pairs method is mandatory. The translate_text and translate_web_page methods are only required if any pair returned by the get_pairs method has the TRANSLATE_PAIR_TEXT or TRANSLATE_PAIR_WEB_PAGE flag set, respectively.

GObjectClass parentthe parent class
gboolean (*get_pairs) (TranslateService *service, GSList **pairs, TranslateProgressFunc progress_func, gpointer user_data, GError **err)Specifies the function which is called to retrieve the list of language pairs implemented by service. The function should return TRUE and store a list of TranslatePair objects in pairs on success, or return FALSE and store an error in err on failure. If progress_func is not NULL, get_pairs should call it at regular intervals with a progress update (or -1 if the progress is unknown), and the user_data argument. If, when called, progress_func returns FALSE, get_pairs must cancel the operation as soon as possible, return NULL, and set err to an error of domain TRANSLATE_ERROR and code TRANSLATE_ERROR_CANCELLED.
char* (*translate_text) (TranslateService *service, const char *text, const char *from, const char *to, TranslateProgressFunc progress_func, gpointer user_data, GError **err)Specifies the function which is called to translate a chunk of text. The function should return a newly-allocated string containing the translation of text on success, or return NULL and set err on failure. If the max-chunk-len property of service is not 0, it is guaranteed that the number of UTF-8 characters in text will not exceed max-chunk-len . It is guaranteed that the from/to pair will be a member (with the flag TRANSLATE_PAIR_TEXT set) of the list returned by the get_pairs method. If progress_func is not NULL, translate_text should call it at regular intervals with a progress update (or -1 if the progress is unknown), and the user_data argument. If, when called, progress_func returns FALSE, translate_text must cancel the translation as soon as possible, return NULL, and set err to an error of domain TRANSLATE_ERROR and code TRANSLATE_ERROR_CANCELLED.
char* (*translate_web_page) (TranslateService *service, const char *url, const char *from, const char *to, TranslateProgressFunc progress_func, gpointer user_data, GError **err)Specifies the function which is called to translate a web page. The function should return a newly-allocated string containing the URL of the translated web page on success, or return NULL and set err on failure. It is guaranteed that the from/to pair will be a member (with the flag TRANSLATE_PAIR_WEB_PAGE set) of the list returned by the get_pairs method. If progress_func is not NULL, translate_web_page should call it at regular intervals with a progress update (or -1 if the progress is unknown), and the user_data argument. If, when called, progress_func returns FALSE, translate_web_page must cancel the translation as soon as possible, return NULL, and set err to an error of domain TRANSLATE_ERROR and code TRANSLATE_ERROR_CANCELLED.

translate_service_get_name ()

const char* translate_service_get_name      (TranslateService *service);

Gets the symbolic name of service.

service: a service.
Returns : the symbolic name of service, encoded in ASCII.

translate_service_get_nick ()

const char* translate_service_get_nick      (TranslateService *service);

Gets the human-readable name of service.

service: a service.
Returns : the human-readable name of service.

translate_service_get_max_chunk_len ()

unsigned int translate_service_get_max_chunk_len
                                            (TranslateService *service);

Gets the maximum chunk length of service.

service: a service.
Returns : the maximum chunk length of service, in characters.

translate_service_get_pairs ()

const GSList* translate_service_get_pairs   (TranslateService *service);

Gets the list of language pairs implemented by service.

service: a service.
Returns : a list of TranslatePair objects.

Properties

"max-chunk-len" (guint : Read / Write / Construct Only)

The maximum length of an input chunk, in characters (0 means unlimited).

"name" (gchararray : Read / Write / Construct Only)

The service symbolic name, encoded in ASCII.

"nick" (gchararray : Read / Write / Construct Only)

The service human-readable name.

"pairs" (gpointer : Read)

The list of language pairs this service implements.

libtranslate-0.99/docs/Makefile.am000644 001750 001750 00000000030 10164777127 020666 0ustar00jylefortjylefort000000 000000 SUBDIRS = man reference libtranslate-0.99/docs/Makefile.in000644 001750 001750 00000037362 10176430640 020706 0ustar00jylefortjylefort000000 000000 # Makefile.in generated by automake 1.9.2 from Makefile.am. # @configure_input@ # Copyright (C) 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001, 2002, # 2003, 2004 Free Software Foundation, Inc. # This Makefile.in is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY, to the extent permitted by law; without # even the implied warranty of MERCHANTABILITY or FITNESS FOR A # PARTICULAR PURPOSE. @SET_MAKE@ srcdir = @srcdir@ top_srcdir = @top_srcdir@ VPATH = @srcdir@ pkgdatadir = $(datadir)/@PACKAGE@ pkglibdir = $(libdir)/@PACKAGE@ pkgincludedir = $(includedir)/@PACKAGE@ top_builddir = .. am__cd = CDPATH="$${ZSH_VERSION+.}$(PATH_SEPARATOR)" && cd INSTALL = @INSTALL@ install_sh_DATA = $(install_sh) -c -m 644 install_sh_PROGRAM = $(install_sh) -c install_sh_SCRIPT = $(install_sh) -c INSTALL_HEADER = $(INSTALL_DATA) transform = $(program_transform_name) NORMAL_INSTALL = : PRE_INSTALL = : POST_INSTALL = : NORMAL_UNINSTALL = : PRE_UNINSTALL = : POST_UNINSTALL = : build_triplet = @build@ host_triplet = @host@ subdir = docs DIST_COMMON = $(srcdir)/Makefile.am $(srcdir)/Makefile.in ACLOCAL_M4 = $(top_srcdir)/aclocal.m4 am__aclocal_m4_deps = $(top_srcdir)/m4/talkfilters.m4 \ $(top_srcdir)/acinclude.m4 $(top_srcdir)/configure.ac am__configure_deps = $(am__aclocal_m4_deps) $(CONFIGURE_DEPENDENCIES) \ $(ACLOCAL_M4) mkinstalldirs = $(SHELL) $(top_srcdir)/mkinstalldirs CONFIG_HEADER = $(top_builddir)/config.h CONFIG_CLEAN_FILES = SOURCES = DIST_SOURCES = RECURSIVE_TARGETS = all-recursive check-recursive dvi-recursive \ html-recursive info-recursive install-data-recursive \ install-exec-recursive install-info-recursive \ install-recursive installcheck-recursive installdirs-recursive \ pdf-recursive ps-recursive uninstall-info-recursive \ uninstall-recursive ETAGS = etags CTAGS = ctags DIST_SUBDIRS = $(SUBDIRS) DISTFILES = $(DIST_COMMON) $(DIST_SOURCES) $(TEXINFOS) $(EXTRA_DIST) ACLOCAL = @ACLOCAL@ AMDEP_FALSE = @AMDEP_FALSE@ AMDEP_TRUE = @AMDEP_TRUE@ AMTAR = @AMTAR@ AR = @AR@ AUTOCONF = @AUTOCONF@ AUTOHEADER = @AUTOHEADER@ AUTOMAKE = @AUTOMAKE@ AWK = @AWK@ CATALOGS = @CATALOGS@ CATOBJEXT = @CATOBJEXT@ CC = @CC@ CCDEPMODE = @CCDEPMODE@ CFLAGS = @CFLAGS@ CPP = @CPP@ CPPFLAGS = @CPPFLAGS@ CXX = @CXX@ CXXCPP = @CXXCPP@ CXXDEPMODE = @CXXDEPMODE@ CXXFLAGS = @CXXFLAGS@ CYGPATH_W = @CYGPATH_W@ DATADIRNAME = @DATADIRNAME@ DEFS = @DEFS@ DEPDIR = @DEPDIR@ ECHO = @ECHO@ ECHO_C = @ECHO_C@ ECHO_N = @ECHO_N@ ECHO_T = @ECHO_T@ EGREP = @EGREP@ ENABLE_GTK_DOC_FALSE = @ENABLE_GTK_DOC_FALSE@ ENABLE_GTK_DOC_TRUE = @ENABLE_GTK_DOC_TRUE@ EXEEXT = @EXEEXT@ F77 = @F77@ FFLAGS = @FFLAGS@ GETTEXT_PACKAGE = @GETTEXT_PACKAGE@ GLIB_CFLAGS = @GLIB_CFLAGS@ GLIB_LIBS = @GLIB_LIBS@ GMOFILES = @GMOFILES@ GMSGFMT = @GMSGFMT@ GTK_DOC_USE_LIBTOOL_FALSE = @GTK_DOC_USE_LIBTOOL_FALSE@ GTK_DOC_USE_LIBTOOL_TRUE = @GTK_DOC_USE_LIBTOOL_TRUE@ HTML_DIR = @HTML_DIR@ ICONV = @ICONV@ INSTALL_DATA = @INSTALL_DATA@ INSTALL_PROGRAM = @INSTALL_PROGRAM@ INSTALL_SCRIPT = @INSTALL_SCRIPT@ INSTALL_STRIP_PROGRAM = @INSTALL_STRIP_PROGRAM@ INSTOBJEXT = @INSTOBJEXT@ INTLLIBS = @INTLLIBS@ INTLTOOL_CAVES_RULE = @INTLTOOL_CAVES_RULE@ INTLTOOL_DESKTOP_RULE = @INTLTOOL_DESKTOP_RULE@ INTLTOOL_DIRECTORY_RULE = @INTLTOOL_DIRECTORY_RULE@ INTLTOOL_EXTRACT = @INTLTOOL_EXTRACT@ INTLTOOL_KBD_RULE = @INTLTOOL_KBD_RULE@ INTLTOOL_KEYS_RULE = @INTLTOOL_KEYS_RULE@ INTLTOOL_MERGE = @INTLTOOL_MERGE@ INTLTOOL_OAF_RULE = @INTLTOOL_OAF_RULE@ INTLTOOL_PERL = @INTLTOOL_PERL@ INTLTOOL_PONG_RULE = @INTLTOOL_PONG_RULE@ INTLTOOL_PROP_RULE = @INTLTOOL_PROP_RULE@ INTLTOOL_SCHEMAS_RULE = @INTLTOOL_SCHEMAS_RULE@ INTLTOOL_SERVER_RULE = @INTLTOOL_SERVER_RULE@ INTLTOOL_SHEET_RULE = @INTLTOOL_SHEET_RULE@ INTLTOOL_SOUNDLIST_RULE = @INTLTOOL_SOUNDLIST_RULE@ INTLTOOL_THEME_RULE = @INTLTOOL_THEME_RULE@ INTLTOOL_UI_RULE = @INTLTOOL_UI_RULE@ INTLTOOL_UPDATE = @INTLTOOL_UPDATE@ INTLTOOL_XAM_RULE = @INTLTOOL_XAM_RULE@ INTLTOOL_XML_NOMERGE_RULE = @INTLTOOL_XML_NOMERGE_RULE@ INTLTOOL_XML_RULE = @INTLTOOL_XML_RULE@ LDFLAGS = @LDFLAGS@ LIBOBJS = @LIBOBJS@ LIBS = @LIBS@ LIBTOOL = @LIBTOOL@ LIBXML_CFLAGS = @LIBXML_CFLAGS@ LIBXML_LIBS = @LIBXML_LIBS@ LN_S = @LN_S@ LTLIBOBJS = @LTLIBOBJS@ MAINT = @MAINT@ MAINTAINER_MODE_FALSE = @MAINTAINER_MODE_FALSE@ MAINTAINER_MODE_TRUE = @MAINTAINER_MODE_TRUE@ MAKEINFO = @MAKEINFO@ MKINSTALLDIRS = @MKINSTALLDIRS@ MSGFMT = @MSGFMT@ MSGMERGE = @MSGMERGE@ OBJEXT = @OBJEXT@ PACKAGE = @PACKAGE@ PACKAGE_BUGREPORT = @PACKAGE_BUGREPORT@ PACKAGE_NAME = @PACKAGE_NAME@ PACKAGE_STRING = @PACKAGE_STRING@ PACKAGE_TARNAME = @PACKAGE_TARNAME@ PACKAGE_VERSION = @PACKAGE_VERSION@ PATH_SEPARATOR = @PATH_SEPARATOR@ PKG_CONFIG = @PKG_CONFIG@ POFILES = @POFILES@ POSUB = @POSUB@ PO_IN_DATADIR_FALSE = @PO_IN_DATADIR_FALSE@ PO_IN_DATADIR_TRUE = @PO_IN_DATADIR_TRUE@ RANLIB = @RANLIB@ SET_MAKE = @SET_MAKE@ SHELL = @SHELL@ SOUP_CFLAGS = @SOUP_CFLAGS@ SOUP_LIBS = @SOUP_LIBS@ STRIP = @STRIP@ TALKFILTERS_CFLAGS = @TALKFILTERS_CFLAGS@ TALKFILTERS_LIBS = @TALKFILTERS_LIBS@ USE_NLS = @USE_NLS@ VERSION = @VERSION@ WARN_CFLAGS = @WARN_CFLAGS@ WITH_GENERIC_FALSE = @WITH_GENERIC_FALSE@ WITH_GENERIC_TRUE = @WITH_GENERIC_TRUE@ WITH_REGRESSION_TESTS_FALSE = @WITH_REGRESSION_TESTS_FALSE@ WITH_REGRESSION_TESTS_TRUE = @WITH_REGRESSION_TESTS_TRUE@ WITH_TALKFILTERS_FALSE = @WITH_TALKFILTERS_FALSE@ WITH_TALKFILTERS_TRUE = @WITH_TALKFILTERS_TRUE@ XGETTEXT = @XGETTEXT@ ac_ct_AR = @ac_ct_AR@ ac_ct_CC = @ac_ct_CC@ ac_ct_CXX = @ac_ct_CXX@ ac_ct_F77 = @ac_ct_F77@ ac_ct_RANLIB = @ac_ct_RANLIB@ ac_ct_STRIP = @ac_ct_STRIP@ am__fastdepCC_FALSE = @am__fastdepCC_FALSE@ am__fastdepCC_TRUE = @am__fastdepCC_TRUE@ am__fastdepCXX_FALSE = @am__fastdepCXX_FALSE@ am__fastdepCXX_TRUE = @am__fastdepCXX_TRUE@ am__include = @am__include@ am__leading_dot = @am__leading_dot@ am__quote = @am__quote@ am__tar = @am__tar@ am__untar = @am__untar@ bindir = @bindir@ build = @build@ build_alias = @build_alias@ build_cpu = @build_cpu@ build_os = @build_os@ build_vendor = @build_vendor@ datadir = @datadir@ exec_prefix = @exec_prefix@ host = @host@ host_alias = @host_alias@ host_cpu = @host_cpu@ host_os = @host_os@ host_vendor = @host_vendor@ includedir = @includedir@ infodir = @infodir@ install_sh = @install_sh@ libdir = @libdir@ libexecdir = @libexecdir@ localstatedir = @localstatedir@ mandir = @mandir@ mkdir_p = @mkdir_p@ oldincludedir = @oldincludedir@ prefix = @prefix@ program_transform_name = @program_transform_name@ sbindir = @sbindir@ sharedstatedir = @sharedstatedir@ sysconfdir = @sysconfdir@ target_alias = @target_alias@ SUBDIRS = man reference all: all-recursive .SUFFIXES: $(srcdir)/Makefile.in: @MAINTAINER_MODE_TRUE@ $(srcdir)/Makefile.am $(am__configure_deps) @for dep in $?; do \ case '$(am__configure_deps)' in \ *$$dep*) \ cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh \ && exit 0; \ exit 1;; \ esac; \ done; \ echo ' cd $(top_srcdir) && $(AUTOMAKE) --foreign docs/Makefile'; \ cd $(top_srcdir) && \ $(AUTOMAKE) --foreign docs/Makefile .PRECIOUS: Makefile Makefile: $(srcdir)/Makefile.in $(top_builddir)/config.status @case '$?' in \ *config.status*) \ cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh;; \ *) \ echo ' cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe)'; \ cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe);; \ esac; $(top_builddir)/config.status: $(top_srcdir)/configure $(CONFIG_STATUS_DEPENDENCIES) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh $(top_srcdir)/configure: @MAINTAINER_MODE_TRUE@ $(am__configure_deps) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh $(ACLOCAL_M4): @MAINTAINER_MODE_TRUE@ $(am__aclocal_m4_deps) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh mostlyclean-libtool: -rm -f *.lo clean-libtool: -rm -rf .libs _libs distclean-libtool: -rm -f libtool uninstall-info-am: # This directory's subdirectories are mostly independent; you can cd # into them and run `make' without going through this Makefile. # To change the values of `make' variables: instead of editing Makefiles, # (1) if the variable is set in `config.status', edit `config.status' # (which will cause the Makefiles to be regenerated when you run `make'); # (2) otherwise, pass the desired values on the `make' command line. $(RECURSIVE_TARGETS): @set fnord $$MAKEFLAGS; amf=$$2; \ dot_seen=no; \ target=`echo $@ | sed s/-recursive//`; \ list='$(SUBDIRS)'; for subdir in $$list; do \ echo "Making $$target in $$subdir"; \ if test "$$subdir" = "."; then \ dot_seen=yes; \ local_target="$$target-am"; \ else \ local_target="$$target"; \ fi; \ (cd $$subdir && $(MAKE) $(AM_MAKEFLAGS) $$local_target) \ || case "$$amf" in *=*) exit 1;; *k*) fail=yes;; *) exit 1;; esac; \ done; \ if test "$$dot_seen" = "no"; then \ $(MAKE) $(AM_MAKEFLAGS) "$$target-am" || exit 1; \ fi; test -z "$$fail" mostlyclean-recursive clean-recursive distclean-recursive \ maintainer-clean-recursive: @set fnord $$MAKEFLAGS; amf=$$2; \ dot_seen=no; \ case "$@" in \ distclean-* | maintainer-clean-*) list='$(DIST_SUBDIRS)' ;; \ *) list='$(SUBDIRS)' ;; \ esac; \ rev=''; for subdir in $$list; do \ if test "$$subdir" = "."; then :; else \ rev="$$subdir $$rev"; \ fi; \ done; \ rev="$$rev ."; \ target=`echo $@ | sed s/-recursive//`; \ for subdir in $$rev; do \ echo "Making $$target in $$subdir"; \ if test "$$subdir" = "."; then \ local_target="$$target-am"; \ else \ local_target="$$target"; \ fi; \ (cd $$subdir && $(MAKE) $(AM_MAKEFLAGS) $$local_target) \ || case "$$amf" in *=*) exit 1;; *k*) fail=yes;; *) exit 1;; esac; \ done && test -z "$$fail" tags-recursive: list='$(SUBDIRS)'; for subdir in $$list; do \ test "$$subdir" = . || (cd $$subdir && $(MAKE) $(AM_MAKEFLAGS) tags); \ done ctags-recursive: list='$(SUBDIRS)'; for subdir in $$list; do \ test "$$subdir" = . || (cd $$subdir && $(MAKE) $(AM_MAKEFLAGS) ctags); \ done ID: $(HEADERS) $(SOURCES) $(LISP) $(TAGS_FILES) list='$(SOURCES) $(HEADERS) $(LISP) $(TAGS_FILES)'; \ unique=`for i in $$list; do \ if test -f "$$i"; then echo $$i; else echo $(srcdir)/$$i; fi; \ done | \ $(AWK) ' { files[$$0] = 1; } \ END { for (i in files) print i; }'`; \ mkid -fID $$unique tags: TAGS TAGS: tags-recursive $(HEADERS) $(SOURCES) $(TAGS_DEPENDENCIES) \ $(TAGS_FILES) $(LISP) tags=; \ here=`pwd`; \ if ($(ETAGS) --etags-include --version) >/dev/null 2>&1; then \ include_option=--etags-include; \ empty_fix=.; \ else \ include_option=--include; \ empty_fix=; \ fi; \ list='$(SUBDIRS)'; for subdir in $$list; do \ if test "$$subdir" = .; then :; else \ test ! -f $$subdir/TAGS || \ tags="$$tags $$include_option=$$here/$$subdir/TAGS"; \ fi; \ done; \ list='$(SOURCES) $(HEADERS) $(LISP) $(TAGS_FILES)'; \ unique=`for i in $$list; do \ if test -f "$$i"; then echo $$i; else echo $(srcdir)/$$i; fi; \ done | \ $(AWK) ' { files[$$0] = 1; } \ END { for (i in files) print i; }'`; \ if test -z "$(ETAGS_ARGS)$$tags$$unique"; then :; else \ test -n "$$unique" || unique=$$empty_fix; \ $(ETAGS) $(ETAGSFLAGS) $(AM_ETAGSFLAGS) $(ETAGS_ARGS) \ $$tags $$unique; \ fi ctags: CTAGS CTAGS: ctags-recursive $(HEADERS) $(SOURCES) $(TAGS_DEPENDENCIES) \ $(TAGS_FILES) $(LISP) tags=; \ here=`pwd`; \ list='$(SOURCES) $(HEADERS) $(LISP) $(TAGS_FILES)'; \ unique=`for i in $$list; do \ if test -f "$$i"; then echo $$i; else echo $(srcdir)/$$i; fi; \ done | \ $(AWK) ' { files[$$0] = 1; } \ END { for (i in files) print i; }'`; \ test -z "$(CTAGS_ARGS)$$tags$$unique" \ || $(CTAGS) $(CTAGSFLAGS) $(AM_CTAGSFLAGS) $(CTAGS_ARGS) \ $$tags $$unique GTAGS: here=`$(am__cd) $(top_builddir) && pwd` \ && cd $(top_srcdir) \ && gtags -i $(GTAGS_ARGS) $$here distclean-tags: -rm -f TAGS ID GTAGS GRTAGS GSYMS GPATH tags distdir: $(DISTFILES) @srcdirstrip=`echo "$(srcdir)" | sed 's|.|.|g'`; \ topsrcdirstrip=`echo "$(top_srcdir)" | sed 's|.|.|g'`; \ list='$(DISTFILES)'; for file in $$list; do \ case $$file in \ $(srcdir)/*) file=`echo "$$file" | sed "s|^$$srcdirstrip/||"`;; \ $(top_srcdir)/*) file=`echo "$$file" | sed "s|^$$topsrcdirstrip/|$(top_builddir)/|"`;; \ esac; \ if test -f $$file || test -d $$file; then d=.; else d=$(srcdir); fi; \ dir=`echo "$$file" | sed -e 's,/[^/]*$$,,'`; \ if test "$$dir" != "$$file" && test "$$dir" != "."; then \ dir="/$$dir"; \ $(mkdir_p) "$(distdir)$$dir"; \ else \ dir=''; \ fi; \ if test -d $$d/$$file; then \ if test -d $(srcdir)/$$file && test $$d != $(srcdir); then \ cp -pR $(srcdir)/$$file $(distdir)$$dir || exit 1; \ fi; \ cp -pR $$d/$$file $(distdir)$$dir || exit 1; \ else \ test -f $(distdir)/$$file \ || cp -p $$d/$$file $(distdir)/$$file \ || exit 1; \ fi; \ done list='$(DIST_SUBDIRS)'; for subdir in $$list; do \ if test "$$subdir" = .; then :; else \ test -d "$(distdir)/$$subdir" \ || $(mkdir_p) "$(distdir)/$$subdir" \ || exit 1; \ distdir=`$(am__cd) $(distdir) && pwd`; \ top_distdir=`$(am__cd) $(top_distdir) && pwd`; \ (cd $$subdir && \ $(MAKE) $(AM_MAKEFLAGS) \ top_distdir="$$top_distdir" \ distdir="$$distdir/$$subdir" \ distdir) \ || exit 1; \ fi; \ done check-am: all-am check: check-recursive all-am: Makefile installdirs: installdirs-recursive installdirs-am: install: install-recursive install-exec: install-exec-recursive install-data: install-data-recursive uninstall: uninstall-recursive install-am: all-am @$(MAKE) $(AM_MAKEFLAGS) install-exec-am install-data-am installcheck: installcheck-recursive install-strip: $(MAKE) $(AM_MAKEFLAGS) INSTALL_PROGRAM="$(INSTALL_STRIP_PROGRAM)" \ install_sh_PROGRAM="$(INSTALL_STRIP_PROGRAM)" INSTALL_STRIP_FLAG=-s \ `test -z '$(STRIP)' || \ echo "INSTALL_PROGRAM_ENV=STRIPPROG='$(STRIP)'"` install mostlyclean-generic: clean-generic: distclean-generic: -test -z "$(CONFIG_CLEAN_FILES)" || rm -f $(CONFIG_CLEAN_FILES) maintainer-clean-generic: @echo "This command is intended for maintainers to use" @echo "it deletes files that may require special tools to rebuild." clean: clean-recursive clean-am: clean-generic clean-libtool mostlyclean-am distclean: distclean-recursive -rm -f Makefile distclean-am: clean-am distclean-generic distclean-libtool \ distclean-tags dvi: dvi-recursive dvi-am: html: html-recursive info: info-recursive info-am: install-data-am: install-exec-am: install-info: install-info-recursive install-man: installcheck-am: maintainer-clean: maintainer-clean-recursive -rm -f Makefile maintainer-clean-am: distclean-am maintainer-clean-generic mostlyclean: mostlyclean-recursive mostlyclean-am: mostlyclean-generic mostlyclean-libtool pdf: pdf-recursive pdf-am: ps: ps-recursive ps-am: uninstall-am: uninstall-info-am uninstall-info: uninstall-info-recursive .PHONY: $(RECURSIVE_TARGETS) CTAGS GTAGS all all-am check check-am \ clean clean-generic clean-libtool clean-recursive ctags \ ctags-recursive distclean distclean-generic distclean-libtool \ distclean-recursive distclean-tags distdir dvi dvi-am html \ html-am info info-am install install-am install-data \ install-data-am install-exec install-exec-am install-info \ install-info-am install-man install-strip installcheck \ installcheck-am installdirs installdirs-am maintainer-clean \ maintainer-clean-generic maintainer-clean-recursive \ mostlyclean mostlyclean-generic mostlyclean-libtool \ mostlyclean-recursive pdf pdf-am ps ps-am tags tags-recursive \ uninstall uninstall-am uninstall-info-am # Tell versions [3.59,3.63) of GNU make to not export all variables. # Otherwise a system limit (for SysV at least) may be exceeded. .NOEXPORT: libtranslate-0.99/docs/gtk-doc.make000644 001750 001750 00000010342 10161371573 021020 0ustar00jylefortjylefort000000 000000 # -*- mode: makefile -*- #################################### # Everything below here is generic # #################################### if GTK_DOC_USE_LIBTOOL GTKDOC_CC = $(LIBTOOL) --mode=compile $(CC) $(INCLUDES) $(AM_CFLAGS) $(CFLAGS) GTKDOC_LD = $(LIBTOOL) --mode=link $(CC) $(AM_CFLAGS) $(CFLAGS) $(LDFLAGS) else GTKDOC_CC = $(CC) $(INCLUDES) $(AM_CFLAGS) $(CFLAGS) GTKDOC_LD = $(CC) $(AM_CFLAGS) $(CFLAGS) $(LDFLAGS) endif # We set GPATH here; this gives us semantics for GNU make # which are more like other make's VPATH, when it comes to # whether a source that is a target of one rule is then # searched for in VPATH/GPATH. # GPATH = $(srcdir) TARGET_DIR=$(HTML_DIR)/$(DOC_MODULE) EXTRA_DIST = \ $(content_files) \ $(HTML_IMAGES) \ $(DOC_MAIN_SGML_FILE) \ $(DOC_MODULE).types \ $(DOC_MODULE)-sections.txt \ $(DOC_MODULE)-overrides.txt DOC_STAMPS=scan-build.stamp tmpl-build.stamp sgml-build.stamp html-build.stamp \ $(srcdir)/tmpl.stamp $(srcdir)/sgml.stamp $(srcdir)/html.stamp SCANOBJ_FILES = \ $(DOC_MODULE).args \ $(DOC_MODULE).hierarchy \ $(DOC_MODULE).interfaces \ $(DOC_MODULE).prerequisites \ $(DOC_MODULE).signals CLEANFILES = $(SCANOBJ_FILES) $(DOC_MODULE)-unused.txt $(DOC_STAMPS) if ENABLE_GTK_DOC all-local: html-build.stamp #### scan #### scan-build.stamp: $(HFILE_GLOB) @echo '*** Scanning header files ***' @-chmod -R u+w $(srcdir) if grep -l '^..*$$' $(srcdir)/$(DOC_MODULE).types > /dev/null ; then \ CC="$(GTKDOC_CC)" LD="$(GTKDOC_LD)" CFLAGS="$(GTKDOC_CFLAGS)" LDFLAGS="$(GTKDOC_LIBS)" gtkdoc-scangobj $(SCANGOBJ_OPTIONS) --module=$(DOC_MODULE) --output-dir=$(srcdir) ; \ else \ cd $(srcdir) ; \ for i in $(SCANOBJ_FILES) ; do \ test -f $$i || touch $$i ; \ done \ fi cd $(srcdir) && \ gtkdoc-scan --module=$(DOC_MODULE) --source-dir=$(DOC_SOURCE_DIR) --ignore-headers="$(IGNORE_HFILES)" $(SCAN_OPTIONS) $(EXTRA_HFILES) touch scan-build.stamp $(DOC_MODULE)-decl.txt $(SCANOBJ_FILES): scan-build.stamp @true #### templates #### tmpl-build.stamp: $(DOC_MODULE)-decl.txt $(SCANOBJ_FILES) $(DOC_MODULE)-sections.txt $(DOC_MODULE)-overrides.txt @echo '*** Rebuilding template files ***' @-chmod -R u+w $(srcdir) cd $(srcdir) && gtkdoc-mktmpl --module=$(DOC_MODULE) touch tmpl-build.stamp tmpl.stamp: tmpl-build.stamp @true #### xml #### sgml-build.stamp: tmpl.stamp $(CFILE_GLOB) $(srcdir)/tmpl/*.sgml @echo '*** Building XML ***' @-chmod -R u+w $(srcdir) cd $(srcdir) && \ gtkdoc-mkdb --module=$(DOC_MODULE) --source-dir=$(DOC_SOURCE_DIR) --output-format=xml $(MKDB_OPTIONS) touch sgml-build.stamp sgml.stamp: sgml-build.stamp @true #### html #### html-build.stamp: sgml.stamp $(DOC_MAIN_SGML_FILE) $(content_files) @echo '*** Building HTML ***' @-chmod -R u+w $(srcdir) rm -rf $(srcdir)/html mkdir $(srcdir)/html cd $(srcdir)/html && gtkdoc-mkhtml $(DOC_MODULE) ../$(DOC_MAIN_SGML_FILE) test "x$(HTML_IMAGES)" = "x" || ( cd $(srcdir) && cp $(HTML_IMAGES) html ) @echo '-- Fixing Crossreferences' cd $(srcdir) && gtkdoc-fixxref --module-dir=html --html-dir=$(HTML_DIR) $(FIXXREF_OPTIONS) touch html-build.stamp else all-local: endif ############## clean-local: rm -f *~ *.bak rm -rf .libs maintainer-clean-local: clean cd $(srcdir) && rm -rf xml html $(DOC_MODULE)-decl-list.txt $(DOC_MODULE)-decl.txt install-data-local: installfiles=`echo $(srcdir)/html/*`; \ if test "$$installfiles" = '$(srcdir)/html/*'; \ then echo '-- Nothing to install' ; \ else \ $(mkinstalldirs) $(DESTDIR)$(TARGET_DIR); \ for i in $$installfiles; do \ echo '-- Installing '$$i ; \ $(INSTALL_DATA) $$i $(DESTDIR)$(TARGET_DIR); \ done; \ echo '-- Installing $(srcdir)/html/index.sgml' ; \ $(INSTALL_DATA) $(srcdir)/html/index.sgml $(DESTDIR)$(TARGET_DIR) || :; \ fi uninstall-local: rm -f $(DESTDIR)$(TARGET_DIR)/* # # Require gtk-doc when making dist # if ENABLE_GTK_DOC dist-check-gtkdoc: else dist-check-gtkdoc: @echo "*** gtk-doc must be installed and enabled in order to make dist" @false endif dist-hook: dist-check-gtkdoc dist-hook-local mkdir $(distdir)/tmpl mkdir $(distdir)/xml mkdir $(distdir)/html -cp $(srcdir)/tmpl/*.sgml $(distdir)/tmpl -cp $(srcdir)/xml/*.xml $(distdir)/xml -cp $(srcdir)/html/* $(distdir)/html .PHONY : dist-hook-local libtranslate-0.99/m4000777 001750 001750 00000000000 10176431051 016140 5ustar00jylefortjylefort000000 000000 libtranslate-0.99/m4/talkfilters.m4000644 001750 001750 00000001644 10172766162 021020 0ustar00jylefortjylefort000000 000000 # This file is part of libtranslate. # # Copyright (C) 2005 Jean-Yves Lefort. # # As a special exception to the libtranslate licensing terms, # Jean-Yves Lefort gives unlimited permission to copy, distribute and # modify this file. dnl AM_PATH_TALKFILTERS([ACTION-IF-FOUND], [ACTION-IF-NOT-FOUND]) dnl AC_DEFUN([AM_PATH_TALKFILTERS], [TALKFILTERS_CFLAGS="" TALKFILTERS_LIBS="-ltalkfilters" ac_save_CFLAGS="$CFLAGS" ac_save_LIBS="$LIBS" CFLAGS="$CFLAGS $TALKFILTERS_CFLAGS" LIBS="$LIBS $TALKFILTERS_LIBS" AC_MSG_CHECKING([for GNU Talk Filters]) AC_RUN_IFELSE([ #include int main() { gtf_filter_list; exit(0); } ], [found=yes], [found=no], [found=yes]) AC_MSG_RESULT($found) CFLAGS="$ac_save_CFLAGS" LIBS="$ac_save_LIBS" if test $found = yes; then ifelse([$1],, :, [$1]) else TALKFILTERS_CFLAGS="" TALKFILTERS_LIBS="" ifelse([$2],, :, [$2]) fi AC_SUBST(TALKFILTERS_CFLAGS) AC_SUBST(TALKFILTERS_LIBS)]) libtranslate-0.99/m4/Makefile.am000644 001750 001750 00000000034 10172241320 020236 0ustar00jylefortjylefort000000 000000 EXTRA_DIST = talkfilters.m4 libtranslate-0.99/m4/Makefile.in000644 001750 001750 00000025072 10176430641 020272 0ustar00jylefortjylefort000000 000000 # Makefile.in generated by automake 1.9.2 from Makefile.am. # @configure_input@ # Copyright (C) 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001, 2002, # 2003, 2004 Free Software Foundation, Inc. # This Makefile.in is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY, to the extent permitted by law; without # even the implied warranty of MERCHANTABILITY or FITNESS FOR A # PARTICULAR PURPOSE. @SET_MAKE@ srcdir = @srcdir@ top_srcdir = @top_srcdir@ VPATH = @srcdir@ pkgdatadir = $(datadir)/@PACKAGE@ pkglibdir = $(libdir)/@PACKAGE@ pkgincludedir = $(includedir)/@PACKAGE@ top_builddir = .. am__cd = CDPATH="$${ZSH_VERSION+.}$(PATH_SEPARATOR)" && cd INSTALL = @INSTALL@ install_sh_DATA = $(install_sh) -c -m 644 install_sh_PROGRAM = $(install_sh) -c install_sh_SCRIPT = $(install_sh) -c INSTALL_HEADER = $(INSTALL_DATA) transform = $(program_transform_name) NORMAL_INSTALL = : PRE_INSTALL = : POST_INSTALL = : NORMAL_UNINSTALL = : PRE_UNINSTALL = : POST_UNINSTALL = : build_triplet = @build@ host_triplet = @host@ subdir = m4 DIST_COMMON = $(srcdir)/Makefile.am $(srcdir)/Makefile.in ACLOCAL_M4 = $(top_srcdir)/aclocal.m4 am__aclocal_m4_deps = $(top_srcdir)/m4/talkfilters.m4 \ $(top_srcdir)/acinclude.m4 $(top_srcdir)/configure.ac am__configure_deps = $(am__aclocal_m4_deps) $(CONFIGURE_DEPENDENCIES) \ $(ACLOCAL_M4) mkinstalldirs = $(SHELL) $(top_srcdir)/mkinstalldirs CONFIG_HEADER = $(top_builddir)/config.h CONFIG_CLEAN_FILES = SOURCES = DIST_SOURCES = DISTFILES = $(DIST_COMMON) $(DIST_SOURCES) $(TEXINFOS) $(EXTRA_DIST) ACLOCAL = @ACLOCAL@ AMDEP_FALSE = @AMDEP_FALSE@ AMDEP_TRUE = @AMDEP_TRUE@ AMTAR = @AMTAR@ AR = @AR@ AUTOCONF = @AUTOCONF@ AUTOHEADER = @AUTOHEADER@ AUTOMAKE = @AUTOMAKE@ AWK = @AWK@ CATALOGS = @CATALOGS@ CATOBJEXT = @CATOBJEXT@ CC = @CC@ CCDEPMODE = @CCDEPMODE@ CFLAGS = @CFLAGS@ CPP = @CPP@ CPPFLAGS = @CPPFLAGS@ CXX = @CXX@ CXXCPP = @CXXCPP@ CXXDEPMODE = @CXXDEPMODE@ CXXFLAGS = @CXXFLAGS@ CYGPATH_W = @CYGPATH_W@ DATADIRNAME = @DATADIRNAME@ DEFS = @DEFS@ DEPDIR = @DEPDIR@ ECHO = @ECHO@ ECHO_C = @ECHO_C@ ECHO_N = @ECHO_N@ ECHO_T = @ECHO_T@ EGREP = @EGREP@ ENABLE_GTK_DOC_FALSE = @ENABLE_GTK_DOC_FALSE@ ENABLE_GTK_DOC_TRUE = @ENABLE_GTK_DOC_TRUE@ EXEEXT = @EXEEXT@ F77 = @F77@ FFLAGS = @FFLAGS@ GETTEXT_PACKAGE = @GETTEXT_PACKAGE@ GLIB_CFLAGS = @GLIB_CFLAGS@ GLIB_LIBS = @GLIB_LIBS@ GMOFILES = @GMOFILES@ GMSGFMT = @GMSGFMT@ GTK_DOC_USE_LIBTOOL_FALSE = @GTK_DOC_USE_LIBTOOL_FALSE@ GTK_DOC_USE_LIBTOOL_TRUE = @GTK_DOC_USE_LIBTOOL_TRUE@ HTML_DIR = @HTML_DIR@ ICONV = @ICONV@ INSTALL_DATA = @INSTALL_DATA@ INSTALL_PROGRAM = @INSTALL_PROGRAM@ INSTALL_SCRIPT = @INSTALL_SCRIPT@ INSTALL_STRIP_PROGRAM = @INSTALL_STRIP_PROGRAM@ INSTOBJEXT = @INSTOBJEXT@ INTLLIBS = @INTLLIBS@ INTLTOOL_CAVES_RULE = @INTLTOOL_CAVES_RULE@ INTLTOOL_DESKTOP_RULE = @INTLTOOL_DESKTOP_RULE@ INTLTOOL_DIRECTORY_RULE = @INTLTOOL_DIRECTORY_RULE@ INTLTOOL_EXTRACT = @INTLTOOL_EXTRACT@ INTLTOOL_KBD_RULE = @INTLTOOL_KBD_RULE@ INTLTOOL_KEYS_RULE = @INTLTOOL_KEYS_RULE@ INTLTOOL_MERGE = @INTLTOOL_MERGE@ INTLTOOL_OAF_RULE = @INTLTOOL_OAF_RULE@ INTLTOOL_PERL = @INTLTOOL_PERL@ INTLTOOL_PONG_RULE = @INTLTOOL_PONG_RULE@ INTLTOOL_PROP_RULE = @INTLTOOL_PROP_RULE@ INTLTOOL_SCHEMAS_RULE = @INTLTOOL_SCHEMAS_RULE@ INTLTOOL_SERVER_RULE = @INTLTOOL_SERVER_RULE@ INTLTOOL_SHEET_RULE = @INTLTOOL_SHEET_RULE@ INTLTOOL_SOUNDLIST_RULE = @INTLTOOL_SOUNDLIST_RULE@ INTLTOOL_THEME_RULE = @INTLTOOL_THEME_RULE@ INTLTOOL_UI_RULE = @INTLTOOL_UI_RULE@ INTLTOOL_UPDATE = @INTLTOOL_UPDATE@ INTLTOOL_XAM_RULE = @INTLTOOL_XAM_RULE@ INTLTOOL_XML_NOMERGE_RULE = @INTLTOOL_XML_NOMERGE_RULE@ INTLTOOL_XML_RULE = @INTLTOOL_XML_RULE@ LDFLAGS = @LDFLAGS@ LIBOBJS = @LIBOBJS@ LIBS = @LIBS@ LIBTOOL = @LIBTOOL@ LIBXML_CFLAGS = @LIBXML_CFLAGS@ LIBXML_LIBS = @LIBXML_LIBS@ LN_S = @LN_S@ LTLIBOBJS = @LTLIBOBJS@ MAINT = @MAINT@ MAINTAINER_MODE_FALSE = @MAINTAINER_MODE_FALSE@ MAINTAINER_MODE_TRUE = @MAINTAINER_MODE_TRUE@ MAKEINFO = @MAKEINFO@ MKINSTALLDIRS = @MKINSTALLDIRS@ MSGFMT = @MSGFMT@ MSGMERGE = @MSGMERGE@ OBJEXT = @OBJEXT@ PACKAGE = @PACKAGE@ PACKAGE_BUGREPORT = @PACKAGE_BUGREPORT@ PACKAGE_NAME = @PACKAGE_NAME@ PACKAGE_STRING = @PACKAGE_STRING@ PACKAGE_TARNAME = @PACKAGE_TARNAME@ PACKAGE_VERSION = @PACKAGE_VERSION@ PATH_SEPARATOR = @PATH_SEPARATOR@ PKG_CONFIG = @PKG_CONFIG@ POFILES = @POFILES@ POSUB = @POSUB@ PO_IN_DATADIR_FALSE = @PO_IN_DATADIR_FALSE@ PO_IN_DATADIR_TRUE = @PO_IN_DATADIR_TRUE@ RANLIB = @RANLIB@ SET_MAKE = @SET_MAKE@ SHELL = @SHELL@ SOUP_CFLAGS = @SOUP_CFLAGS@ SOUP_LIBS = @SOUP_LIBS@ STRIP = @STRIP@ TALKFILTERS_CFLAGS = @TALKFILTERS_CFLAGS@ TALKFILTERS_LIBS = @TALKFILTERS_LIBS@ USE_NLS = @USE_NLS@ VERSION = @VERSION@ WARN_CFLAGS = @WARN_CFLAGS@ WITH_GENERIC_FALSE = @WITH_GENERIC_FALSE@ WITH_GENERIC_TRUE = @WITH_GENERIC_TRUE@ WITH_REGRESSION_TESTS_FALSE = @WITH_REGRESSION_TESTS_FALSE@ WITH_REGRESSION_TESTS_TRUE = @WITH_REGRESSION_TESTS_TRUE@ WITH_TALKFILTERS_FALSE = @WITH_TALKFILTERS_FALSE@ WITH_TALKFILTERS_TRUE = @WITH_TALKFILTERS_TRUE@ XGETTEXT = @XGETTEXT@ ac_ct_AR = @ac_ct_AR@ ac_ct_CC = @ac_ct_CC@ ac_ct_CXX = @ac_ct_CXX@ ac_ct_F77 = @ac_ct_F77@ ac_ct_RANLIB = @ac_ct_RANLIB@ ac_ct_STRIP = @ac_ct_STRIP@ am__fastdepCC_FALSE = @am__fastdepCC_FALSE@ am__fastdepCC_TRUE = @am__fastdepCC_TRUE@ am__fastdepCXX_FALSE = @am__fastdepCXX_FALSE@ am__fastdepCXX_TRUE = @am__fastdepCXX_TRUE@ am__include = @am__include@ am__leading_dot = @am__leading_dot@ am__quote = @am__quote@ am__tar = @am__tar@ am__untar = @am__untar@ bindir = @bindir@ build = @build@ build_alias = @build_alias@ build_cpu = @build_cpu@ build_os = @build_os@ build_vendor = @build_vendor@ datadir = @datadir@ exec_prefix = @exec_prefix@ host = @host@ host_alias = @host_alias@ host_cpu = @host_cpu@ host_os = @host_os@ host_vendor = @host_vendor@ includedir = @includedir@ infodir = @infodir@ install_sh = @install_sh@ libdir = @libdir@ libexecdir = @libexecdir@ localstatedir = @localstatedir@ mandir = @mandir@ mkdir_p = @mkdir_p@ oldincludedir = @oldincludedir@ prefix = @prefix@ program_transform_name = @program_transform_name@ sbindir = @sbindir@ sharedstatedir = @sharedstatedir@ sysconfdir = @sysconfdir@ target_alias = @target_alias@ EXTRA_DIST = talkfilters.m4 all: all-am .SUFFIXES: $(srcdir)/Makefile.in: @MAINTAINER_MODE_TRUE@ $(srcdir)/Makefile.am $(am__configure_deps) @for dep in $?; do \ case '$(am__configure_deps)' in \ *$$dep*) \ cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh \ && exit 0; \ exit 1;; \ esac; \ done; \ echo ' cd $(top_srcdir) && $(AUTOMAKE) --foreign m4/Makefile'; \ cd $(top_srcdir) && \ $(AUTOMAKE) --foreign m4/Makefile .PRECIOUS: Makefile Makefile: $(srcdir)/Makefile.in $(top_builddir)/config.status @case '$?' in \ *config.status*) \ cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh;; \ *) \ echo ' cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe)'; \ cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe);; \ esac; $(top_builddir)/config.status: $(top_srcdir)/configure $(CONFIG_STATUS_DEPENDENCIES) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh $(top_srcdir)/configure: @MAINTAINER_MODE_TRUE@ $(am__configure_deps) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh $(ACLOCAL_M4): @MAINTAINER_MODE_TRUE@ $(am__aclocal_m4_deps) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh mostlyclean-libtool: -rm -f *.lo clean-libtool: -rm -rf .libs _libs distclean-libtool: -rm -f libtool uninstall-info-am: tags: TAGS TAGS: ctags: CTAGS CTAGS: distdir: $(DISTFILES) @srcdirstrip=`echo "$(srcdir)" | sed 's|.|.|g'`; \ topsrcdirstrip=`echo "$(top_srcdir)" | sed 's|.|.|g'`; \ list='$(DISTFILES)'; for file in $$list; do \ case $$file in \ $(srcdir)/*) file=`echo "$$file" | sed "s|^$$srcdirstrip/||"`;; \ $(top_srcdir)/*) file=`echo "$$file" | sed "s|^$$topsrcdirstrip/|$(top_builddir)/|"`;; \ esac; \ if test -f $$file || test -d $$file; then d=.; else d=$(srcdir); fi; \ dir=`echo "$$file" | sed -e 's,/[^/]*$$,,'`; \ if test "$$dir" != "$$file" && test "$$dir" != "."; then \ dir="/$$dir"; \ $(mkdir_p) "$(distdir)$$dir"; \ else \ dir=''; \ fi; \ if test -d $$d/$$file; then \ if test -d $(srcdir)/$$file && test $$d != $(srcdir); then \ cp -pR $(srcdir)/$$file $(distdir)$$dir || exit 1; \ fi; \ cp -pR $$d/$$file $(distdir)$$dir || exit 1; \ else \ test -f $(distdir)/$$file \ || cp -p $$d/$$file $(distdir)/$$file \ || exit 1; \ fi; \ done check-am: all-am check: check-am all-am: Makefile installdirs: install: install-am install-exec: install-exec-am install-data: install-data-am uninstall: uninstall-am install-am: all-am @$(MAKE) $(AM_MAKEFLAGS) install-exec-am install-data-am installcheck: installcheck-am install-strip: $(MAKE) $(AM_MAKEFLAGS) INSTALL_PROGRAM="$(INSTALL_STRIP_PROGRAM)" \ install_sh_PROGRAM="$(INSTALL_STRIP_PROGRAM)" INSTALL_STRIP_FLAG=-s \ `test -z '$(STRIP)' || \ echo "INSTALL_PROGRAM_ENV=STRIPPROG='$(STRIP)'"` install mostlyclean-generic: clean-generic: distclean-generic: -test -z "$(CONFIG_CLEAN_FILES)" || rm -f $(CONFIG_CLEAN_FILES) maintainer-clean-generic: @echo "This command is intended for maintainers to use" @echo "it deletes files that may require special tools to rebuild." clean: clean-am clean-am: clean-generic clean-libtool mostlyclean-am distclean: distclean-am -rm -f Makefile distclean-am: clean-am distclean-generic distclean-libtool dvi: dvi-am dvi-am: html: html-am info: info-am info-am: install-data-am: install-exec-am: install-info: install-info-am install-man: installcheck-am: maintainer-clean: maintainer-clean-am -rm -f Makefile maintainer-clean-am: distclean-am maintainer-clean-generic mostlyclean: mostlyclean-am mostlyclean-am: mostlyclean-generic mostlyclean-libtool pdf: pdf-am pdf-am: ps: ps-am ps-am: uninstall-am: uninstall-info-am .PHONY: all all-am check check-am clean clean-generic clean-libtool \ distclean distclean-generic distclean-libtool distdir dvi \ dvi-am html html-am info info-am install install-am \ install-data install-data-am install-exec install-exec-am \ install-info install-info-am install-man install-strip \ installcheck installcheck-am installdirs maintainer-clean \ maintainer-clean-generic mostlyclean mostlyclean-generic \ mostlyclean-libtool pdf pdf-am ps ps-am uninstall uninstall-am \ uninstall-info-am # Tell versions [3.59,3.63) of GNU make to not export all variables. # Otherwise a system limit (for SysV at least) may be exceeded. .NOEXPORT: libtranslate-0.99/po000777 001750 001750 00000000000 10176431053 016240 5ustar00jylefortjylefort000000 000000 libtranslate-0.99/po/Makefile.in.in000644 001750 001750 00000016532 10165776122 021003 0ustar00jylefortjylefort000000 000000 # Makefile for program source directory in GNU NLS utilities package. # Copyright (C) 1995, 1996, 1997 by Ulrich Drepper # # This file file be copied and used freely without restrictions. It can # be used in projects which are not available under the GNU Public License # but which still want to provide support for the GNU gettext functionality. # Please note that the actual code is *not* freely available. # # - Modified by Owen Taylor to use GETTEXT_PACKAGE # instead of PACKAGE and to look for po2tbl in ./ not in intl/ # # - Modified by jacob berkman to install # Makefile.in.in and po2tbl.sed.in for use with glib-gettextize GETTEXT_PACKAGE = @GETTEXT_PACKAGE@ PACKAGE = @PACKAGE@ VERSION = @VERSION@ SHELL = /bin/sh @SET_MAKE@ srcdir = @srcdir@ top_srcdir = @top_srcdir@ top_builddir = .. VPATH = @srcdir@ prefix = @prefix@ exec_prefix = @exec_prefix@ datadir = @datadir@ libdir = @libdir@ localedir = $(libdir)/locale gnulocaledir = $(datadir)/locale gettextsrcdir = $(datadir)/glib-2.0/gettext/po subdir = po install_sh = @install_sh@ mkdir_p = @mkdir_p@ mkinstalldirs = $(SHELL) $(top_srcdir)/mkinstalldirs INSTALL = @INSTALL@ INSTALL_DATA = @INSTALL_DATA@ CC = @CC@ GENCAT = @GENCAT@ GMSGFMT = @GMSGFMT@ MSGFMT = @MSGFMT@ XGETTEXT = @XGETTEXT@ INTLTOOL_UPDATE = @INTLTOOL_UPDATE@ INTLTOOL_EXTRACT = @INTLTOOL_EXTRACT@ MSGMERGE = INTLTOOL_EXTRACT=$(INTLTOOL_EXTRACT) $(INTLTOOL_UPDATE) --gettext-package $(GETTEXT_PACKAGE) --dist GENPOT = INTLTOOL_EXTRACT=$(INTLTOOL_EXTRACT) $(INTLTOOL_UPDATE) --gettext-package $(GETTEXT_PACKAGE) --pot DEFS = @DEFS@ CFLAGS = @CFLAGS@ CPPFLAGS = @CPPFLAGS@ INCLUDES = -I.. -I$(top_srcdir)/intl COMPILE = $(CC) -c $(DEFS) $(INCLUDES) $(CPPFLAGS) $(CFLAGS) $(XCFLAGS) SOURCES = POFILES = @POFILES@ GMOFILES = @GMOFILES@ DISTFILES = Makefile.in.in POTFILES.in $(GETTEXT_PACKAGE).pot \ $(POFILES) $(GMOFILES) $(SOURCES) POTFILES = \ CATALOGS = @CATALOGS@ CATOBJEXT = @CATOBJEXT@ INSTOBJEXT = @INSTOBJEXT@ .SUFFIXES: .SUFFIXES: .c .o .po .pox .gmo .mo .msg .cat .c.o: $(COMPILE) $< .po.pox: $(MAKE) $(GETTEXT_PACKAGE).pot $(MSGMERGE) $< $(srcdir)/$(GETTEXT_PACKAGE).pot -o $*pox .po.mo: $(MSGFMT) -o $@ $< .po.gmo: file=$(srcdir)/`echo $* | sed 's,.*/,,'`.gmo \ && rm -f $$file && $(GMSGFMT) -o $$file $< .po.cat: sed -f ../intl/po2msg.sed < $< > $*.msg \ && rm -f $@ && $(GENCAT) $@ $*.msg all: all-@USE_NLS@ all-yes: $(CATALOGS) all-no: $(srcdir)/$(GETTEXT_PACKAGE).pot: $(POTFILES) $(GENPOT) install: install-exec install-data install-exec: install-data: install-data-@USE_NLS@ install-data-no: all install-data-yes: all if test -n "$(MKINSTALLDIRS)"; then \ $(MKINSTALLDIRS) $(DESTDIR)$(datadir); \ else \ $(SHELL) $(top_srcdir)/mkinstalldirs $(DESTDIR)$(datadir); \ fi @catalogs='$(CATALOGS)'; \ for cat in $$catalogs; do \ cat=`basename $$cat`; \ case "$$cat" in \ *.gmo) destdir=$(gnulocaledir);; \ *) destdir=$(localedir);; \ esac; \ lang=`echo $$cat | sed 's/\$(CATOBJEXT)$$//'`; \ dir=$(DESTDIR)$$destdir/$$lang/LC_MESSAGES; \ if test -n "$(MKINSTALLDIRS)"; then \ $(MKINSTALLDIRS) $$dir; \ else \ $(SHELL) $(top_srcdir)/mkinstalldirs $$dir; \ fi; \ if test -r $$cat; then \ $(INSTALL_DATA) $$cat $$dir/$(GETTEXT_PACKAGE)$(INSTOBJEXT); \ echo "installing $$cat as $$dir/$(GETTEXT_PACKAGE)$(INSTOBJEXT)"; \ else \ $(INSTALL_DATA) $(srcdir)/$$cat $$dir/$(GETTEXT_PACKAGE)$(INSTOBJEXT); \ echo "installing $(srcdir)/$$cat as" \ "$$dir/$(GETTEXT_PACKAGE)$(INSTOBJEXT)"; \ fi; \ if test -r $$cat.m; then \ $(INSTALL_DATA) $$cat.m $$dir/$(GETTEXT_PACKAGE)$(INSTOBJEXT).m; \ echo "installing $$cat.m as $$dir/$(GETTEXT_PACKAGE)$(INSTOBJEXT).m"; \ else \ if test -r $(srcdir)/$$cat.m ; then \ $(INSTALL_DATA) $(srcdir)/$$cat.m \ $$dir/$(GETTEXT_PACKAGE)$(INSTOBJEXT).m; \ echo "installing $(srcdir)/$$cat as" \ "$$dir/$(GETTEXT_PACKAGE)$(INSTOBJEXT).m"; \ else \ true; \ fi; \ fi; \ done if test "$(PACKAGE)" = "glib"; then \ if test -n "$(MKINSTALLDIRS)"; then \ $(MKINSTALLDIRS) $(DESTDIR)$(gettextsrcdir); \ else \ $(SHELL) $(top_srcdir)/mkinstalldirs $(DESTDIR)$(gettextsrcdir); \ fi; \ $(INSTALL_DATA) $(srcdir)/Makefile.in.in \ $(DESTDIR)$(gettextsrcdir)/Makefile.in.in; \ else \ : ; \ fi # Define this as empty until I found a useful application. installcheck: uninstall: catalogs='$(CATALOGS)'; \ for cat in $$catalogs; do \ cat=`basename $$cat`; \ lang=`echo $$cat | sed 's/\$(CATOBJEXT)$$//'`; \ rm -f $(DESTDIR)$(localedir)/$$lang/LC_MESSAGES/$(GETTEXT_PACKAGE)$(INSTOBJEXT); \ rm -f $(DESTDIR)$(localedir)/$$lang/LC_MESSAGES/$(GETTEXT_PACKAGE)$(INSTOBJEXT).m; \ rm -f $(DESTDIR)$(gnulocaledir)/$$lang/LC_MESSAGES/$(GETTEXT_PACKAGE)$(INSTOBJEXT); \ rm -f $(DESTDIR)$(gnulocaledir)/$$lang/LC_MESSAGES/$(GETTEXT_PACKAGE)$(INSTOBJEXT).m; \ done if test "$(PACKAGE)" = "glib"; then \ rm -f $(DESTDIR)$(gettextsrcdir)/Makefile.in.in; \ fi check: all dvi info tags TAGS ID: mostlyclean: rm -f core core.* *.pox $(GETTEXT_PACKAGE).po *.old.po cat-id-tbl.tmp rm -fr *.o rm -f .intltool-merge-cache clean: mostlyclean distclean: clean rm -f Makefile Makefile.in POTFILES *.mo *.msg *.cat *.cat.m maintainer-clean: distclean @echo "This command is intended for maintainers to use;" @echo "it deletes files that may require special tools to rebuild." rm -f $(GMOFILES) distdir = ../$(GETTEXT_PACKAGE)-$(VERSION)/$(subdir) dist distdir: update-po $(DISTFILES) dists="$(DISTFILES)"; \ for file in $$dists; do \ ln $(srcdir)/$$file $(distdir) 2> /dev/null \ || cp -p $(srcdir)/$$file $(distdir); \ done update-po: Makefile $(MAKE) $(GETTEXT_PACKAGE).pot tmpdir=`pwd`; \ cd $(srcdir); \ catalogs='$(CATALOGS)'; \ for cat in $$catalogs; do \ cat=`basename $$cat`; \ lang=`echo $$cat | sed 's/\$(CATOBJEXT)$$//'`; \ echo "$$lang:"; \ if $$tmpdir/$(INTLTOOL_UPDATE) --gettext-package $(GETTEXT_PACKAGE) --dist -o $$tmpdir/$$lang.new.po $$lang; then \ if cmp $$lang.po $$tmpdir/$$lang.new.po >/dev/null 2>&1; then \ rm -f $$tmpdir/$$lang.new.po; \ else \ if mv -f $$tmpdir/$$lang.new.po $$lang.po; then \ :; \ else \ echo "msgmerge for $$lang.po failed: cannot move $$tmpdir/$$lang.new.po to $$lang.po" 1>&2; \ rm -f $$tmpdir/$$lang.new.po; \ exit 1; \ fi; \ fi; \ else \ echo "msgmerge for $$cat failed!"; \ rm -f $$tmpdir/$$lang.new.po; \ fi; \ done # POTFILES is created from POTFILES.in by stripping comments, empty lines # and Intltool tags (enclosed in square brackets), and appending a full # relative path to them POTFILES: POTFILES.in ( if test 'x$(srcdir)' != 'x.'; then \ posrcprefix='$(top_srcdir)/'; \ else \ posrcprefix="../"; \ fi; \ rm -f $@-t $@ \ && (sed -e '/^#/d' \ -e "s/^\[.*\] +//" \ -e '/^[ ]*$$/d' \ -e "s@.*@ $$posrcprefix& \\\\@" < $(srcdir)/$@.in \ | sed -e '$$s/\\$$//') > $@-t \ && chmod a-w $@-t \ && mv $@-t $@ ) Makefile: Makefile.in.in ../config.status POTFILES cd .. \ && CONFIG_FILES=$(subdir)/$@.in CONFIG_HEADERS= \ $(SHELL) ./config.status # Tell versions [3.59,3.63) of GNU make not to export all variables. # Otherwise a system limit (for SysV at least) may be exceeded. .NOEXPORT: libtranslate-0.99/po/POTFILES.in000644 001750 001750 00000001357 10170044363 020074 0ustar00jylefortjylefort000000 000000 [encoding: UTF-8] data/services.xml.in src/modules/translate-generic-main.c src/modules/translate-generic-main.h src/modules/translate-generic-parser.c src/modules/translate-generic-parser.h src/modules/translate-generic-service.c src/modules/translate-generic-service.h src/modules/translate-generic-soup-cookie-jar.c src/modules/translate-generic-soup-cookie-jar.h src/modules/translate-talkfilters.c src/translate-cli.c src/translate-common.h src/translate-pair-private.h src/translate-pair.c src/translate-pair.h src/translate-service-private.h src/translate-service.c src/translate-service.h src/translate-session.c src/translate-session.h src/translate-util.c src/translate-util.h src/translate.c src/translate.h src/translate-rfc3066-private.h libtranslate-0.99/po/libtranslate.pot000644 001750 001750 00000121513 10176431052 021525 0ustar00jylefortjylefort000000 000000 # SOME DESCRIPTIVE TITLE. # Copyright (C) YEAR THE PACKAGE'S COPYRIGHT HOLDER # This file is distributed under the same license as the PACKAGE package. # FIRST AUTHOR , YEAR. # #, fuzzy msgid "" msgstr "" "Project-Id-Version: PACKAGE VERSION\n" "Report-Msgid-Bugs-To: \n" "POT-Creation-Date: 2005-01-28 13:38+0100\n" "PO-Revision-Date: YEAR-MO-DA HO:MI+ZONE\n" "Last-Translator: FULL NAME \n" "Language-Team: LANGUAGE \n" "MIME-Version: 1.0\n" "Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" #: data/services.xml.in.h:1 msgid "Chinese (Taiwan)" msgstr "" #: src/modules/translate-generic-parser.c:128 #, c-format msgid "unable to open %s: %s" msgstr "" #: src/modules/translate-generic-parser.c:135 #, c-format msgid "unable to read %s: %s" msgstr "" #: src/modules/translate-generic-parser.c:160 #, c-format msgid "%s: service \"%s\" already exists, ignored" msgstr "" #: src/modules/translate-generic-parser.c:167 #, c-format msgid "unable to parse %s: %s" msgstr "" #: src/modules/translate-generic-parser.c:226 #, c-format msgid "language \"%s\" already exists, ignored" msgstr "" #: src/modules/translate-generic-parser.c:251 msgid "max-chunk-len is empty" msgstr "" #: src/modules/translate-generic-parser.c:253 #, c-format msgid "max-chunk-len \"%s\" is not an unsigned integer" msgstr "" #: src/modules/translate-generic-parser.c:324 msgid "element \"text-translation\" already specified" msgstr "" #: src/modules/translate-generic-parser.c:363 msgid "element \"post-marker\" already specified" msgstr "" #: src/modules/translate-generic-parser.c:388 msgid "element \"web-page-translation\" already specified" msgstr "" #: src/modules/translate-generic-parser.c:403 #, c-format msgid "unknown element \"%s\", ignored" msgstr "" #: src/modules/translate-generic-parser.c:475 #, c-format msgid "attribute \"%s\" already specified" msgstr "" #: src/modules/translate-generic-parser.c:487 #, c-format msgid "required attribute \"%s\" missing" msgstr "" #: src/modules/translate-generic-parser.c:500 #, c-format msgid "unknown attribute \"%s\", ignored" msgstr "" #: src/modules/translate-generic-parser.c:525 #, c-format msgid "%s: around line %i: %s" msgstr "" #: src/modules/translate-generic-service.c:47 #, c-format msgid "in %s, group %i, \"%s\" attribute of \"%s\" element" msgstr "" #: src/modules/translate-generic-service.c:413 #, c-format msgid "unable to parse URI \"%s\"" msgstr "" #: src/modules/translate-generic-service.c:510 msgid "invalid UTF-8" msgstr "" #: src/modules/translate-generic-service.c:564 #, c-format msgid "connecting to %s:%i" msgstr "" #: src/modules/translate-generic-service.c:820 msgid "invalid redirect URL" msgstr "" #: src/modules/translate-generic-service.c:916 msgid "server failure" msgstr "" #: src/modules/translate-generic-service.c:985 msgid "unable to parse server data" msgstr "" #: src/modules/translate-generic-service.c:1150 #, c-format msgid "%s: unknown variable \"%s\"" msgstr "" #: src/modules/translate-generic-service.c:1173 #, c-format msgid "%s: value specified for \"escape\" modifier" msgstr "" #: src/modules/translate-generic-service.c:1185 #, c-format msgid "%s: unable to convert to \"%s\": %s" msgstr "" #: src/modules/translate-generic-service.c:1190 #, c-format msgid "%s: value of \"charset\" modifier missing" msgstr "" #: src/modules/translate-generic-service.c:1193 #, c-format msgid "%s: unknown modifier \"%s\"" msgstr "" #: src/modules/translate-generic-service.c:1309 #, c-format msgid "unable to parse proxy URI \"%s\"" msgstr "" #: src/modules/translate-talkfilters.c:192 #, c-format msgid "English (%s)" msgstr "" #: src/translate-cli.c:167 msgid "too many arguments" msgstr "" #: src/translate-cli.c:179 #, c-format msgid "unable to initialize libtranslate: %s" msgstr "" #: src/translate-cli.c:206 #, c-format msgid "unknown service \"%s\"" msgstr "" #: src/translate-cli.c:261 msgid "Synopsis:" msgstr "" #: src/translate-cli.c:267 msgid "Options:" msgstr "" #: src/translate-cli.c:268 msgid "Show this help" msgstr "" #: src/translate-cli.c:269 msgid "Show version information" msgstr "" #: src/translate-cli.c:270 msgid "List the available services" msgstr "" #: src/translate-cli.c:271 msgid "Specify the list of services to use" msgstr "" #: src/translate-cli.c:272 msgid "Specify the source language" msgstr "" #: src/translate-cli.c:273 msgid "Specify the destination language" msgstr "" #: src/translate-cli.c:274 msgid "List the available language pairs" msgstr "" #: src/translate-cli.c:275 msgid "Specify the maximum number of threads to use" msgstr "" #: src/translate-cli.c:276 msgid "Specify the maximum number of retries per chunk" msgstr "" #: src/translate-cli.c:282 #, c-format msgid "%s version %s\n" msgstr "" #: src/translate-cli.c:331 msgid "text, web page" msgstr "" #: src/translate-cli.c:333 msgid "text" msgstr "" #: src/translate-cli.c:335 msgid "web page" msgstr "" #: src/translate-cli.c:400 #, c-format msgid "unable to open \"%s\": %s" msgstr "" #: src/translate-cli.c:413 #, c-format msgid "unable to read from standard input: %s" msgstr "" #: src/translate-cli.c:415 #, c-format msgid "unable to read from \"%s\": %s" msgstr "" #: src/translate-cli.c:429 #, c-format msgid "unable to convert input text to UTF-8: %s" msgstr "" #: src/translate-cli.c:453 #, c-format msgid "unable to translate: %s" msgstr "" #: src/translate-cli.c:491 #, c-format msgid "unable to get URL of translated web page: %s" msgstr "" #: src/translate-pair.c:142 msgid "Flags" msgstr "" #: src/translate-pair.c:143 msgid "The pair flags" msgstr "" #: src/translate-pair.c:150 msgid "From" msgstr "" #: src/translate-pair.c:151 msgid "The source language RFC 3066 tag" msgstr "" #: src/translate-pair.c:157 msgid "To" msgstr "" #: src/translate-pair.c:158 msgid "The destination language RFC 3066 tag" msgstr "" #: src/translate-service.c:123 msgid "Name" msgstr "" #: src/translate-service.c:124 msgid "The service symbolic name, encoded in ASCII" msgstr "" #: src/translate-service.c:130 msgid "Nick" msgstr "" #: src/translate-service.c:131 msgid "The service human-readable name" msgstr "" #: src/translate-service.c:137 msgid "Maximum chunk length" msgstr "" #: src/translate-service.c:138 msgid "The maximum length of an input chunk, in characters (0 means unlimited)" msgstr "" #: src/translate-service.c:146 src/translate-session.c:159 msgid "Pairs" msgstr "" #: src/translate-service.c:147 msgid "The list of language pairs this service implements" msgstr "" #: src/translate-service.c:247 #, c-format msgid "" "%s: the TRANSLATE_PAIR_TEXT flag is set for %s->%s, but the translate_text " "method is not implemented (this indicates a programming error in the service " "implementation): unsetting the flag" msgstr "" #: src/translate-service.c:256 #, c-format msgid "" "%s: the TRANSLATE_PAIR_WEB_PAGE flag is set for %s->%s, but the " "translate_web_page method is not implemented (this indicates a programming " "error in the service implementation): unsetting the flag" msgstr "" #: src/translate-service.c:268 #, c-format msgid "%s: unable to get language pairs: %s" msgstr "" #: src/translate-service.c:273 #, c-format msgid "" "%s: the get_pairs method is not implemented (this indicates a programming " "error in the service implementation)" msgstr "" #: src/translate-session.c:153 msgid "Services" msgstr "" #: src/translate-session.c:154 msgid "The list of services used by this session" msgstr "" #: src/translate-session.c:160 msgid "The list of pairs this session supports" msgstr "" #: src/translate-session.c:165 msgid "Maximum number of threads" msgstr "" #: src/translate-session.c:166 msgid "The maximum number of translation threads to use" msgstr "" #: src/translate-session.c:174 msgid "Maximum number of retries" msgstr "" #: src/translate-session.c:175 msgid "" "The maximum number of times to retry a translation of the same chunk (-1 for " "unlimited)" msgstr "" #: src/translate-session.c:543 #, c-format msgid "no service provides %s to %s text translation" msgstr "" #: src/translate-session.c:633 msgid "cancelled by user" msgstr "" #: src/translate-session.c:737 #, c-format msgid "unable to translate chunk using %s: %s" msgstr "" #: src/translate-session.c:761 msgid "no service could translate chunk" msgstr "" #: src/translate-session.c:915 #, c-format msgid "no service provides %s to %s web page translation" msgstr "" #: src/translate-session.c:942 #, c-format msgid "unable to translate web page using %s: %s" msgstr "" #: src/translate-session.c:957 msgid "no service could translate web page" msgstr "" #: src/translate-util.c:301 #, c-format msgid "cannot get current time: %s" msgstr "" #: src/translate.c:131 msgid "multi-threading is not supported" msgstr "" #: src/translate.c:156 #, c-format msgid "unable to scan modules directory \"%s\": %s" msgstr "" #: src/translate.c:173 #, c-format msgid "unable to load module \"%s\": %s" msgstr "" #: src/translate.c:210 msgid "unable to find translate_module_init() function" msgstr "" #: src/translate-rfc3066-private.h:15 msgid "Afar" msgstr "" #: src/translate-rfc3066-private.h:16 msgid "Abkhazian" msgstr "" #: src/translate-rfc3066-private.h:17 msgid "Achinese" msgstr "" #: src/translate-rfc3066-private.h:18 msgid "Acoli" msgstr "" #: src/translate-rfc3066-private.h:19 msgid "Adangme" msgstr "" #: src/translate-rfc3066-private.h:20 msgid "Adyghe; Adygei" msgstr "" #: src/translate-rfc3066-private.h:21 msgid "Afro-Asiatic (Other)" msgstr "" #: src/translate-rfc3066-private.h:22 msgid "Afrihili" msgstr "" #: src/translate-rfc3066-private.h:23 msgid "Afrikaans" msgstr "" #: src/translate-rfc3066-private.h:24 msgid "Akan" msgstr "" #: src/translate-rfc3066-private.h:25 msgid "Akkadian" msgstr "" #: src/translate-rfc3066-private.h:26 msgid "Albanian" msgstr "" #: src/translate-rfc3066-private.h:27 msgid "Aleut" msgstr "" #: src/translate-rfc3066-private.h:28 msgid "Algonquian languages" msgstr "" #: src/translate-rfc3066-private.h:29 msgid "Amharic" msgstr "" #: src/translate-rfc3066-private.h:30 msgid "English, Old (ca.450-1100)" msgstr "" #: src/translate-rfc3066-private.h:31 msgid "Apache languages" msgstr "" #: src/translate-rfc3066-private.h:32 msgid "Arabic" msgstr "" #: src/translate-rfc3066-private.h:33 msgid "Aramaic" msgstr "" #: src/translate-rfc3066-private.h:34 msgid "Aragonese" msgstr "" #: src/translate-rfc3066-private.h:35 msgid "Armenian" msgstr "" #: src/translate-rfc3066-private.h:36 msgid "Araucanian" msgstr "" #: src/translate-rfc3066-private.h:37 msgid "Arapaho" msgstr "" #: src/translate-rfc3066-private.h:38 msgid "Artificial (Other)" msgstr "" #: src/translate-rfc3066-private.h:39 msgid "Arawak" msgstr "" #: src/translate-rfc3066-private.h:40 msgid "Assamese" msgstr "" #: src/translate-rfc3066-private.h:41 msgid "Asturian; Bable" msgstr "" #: src/translate-rfc3066-private.h:42 msgid "Athapascan languages" msgstr "" #: src/translate-rfc3066-private.h:43 msgid "Australian languages" msgstr "" #: src/translate-rfc3066-private.h:44 msgid "Avaric" msgstr "" #: src/translate-rfc3066-private.h:45 msgid "Avestan" msgstr "" #: src/translate-rfc3066-private.h:46 msgid "Awadhi" msgstr "" #: src/translate-rfc3066-private.h:47 msgid "Aymara" msgstr "" #: src/translate-rfc3066-private.h:48 msgid "Azerbaijani" msgstr "" #: src/translate-rfc3066-private.h:49 msgid "Banda" msgstr "" #: src/translate-rfc3066-private.h:50 msgid "Bamileke languages" msgstr "" #: src/translate-rfc3066-private.h:51 msgid "Bashkir" msgstr "" #: src/translate-rfc3066-private.h:52 msgid "Baluchi" msgstr "" #: src/translate-rfc3066-private.h:53 msgid "Bambara" msgstr "" #: src/translate-rfc3066-private.h:54 msgid "Balinese" msgstr "" #: src/translate-rfc3066-private.h:55 msgid "Basque" msgstr "" #: src/translate-rfc3066-private.h:56 msgid "Basa" msgstr "" #: src/translate-rfc3066-private.h:57 msgid "Baltic (Other)" msgstr "" #: src/translate-rfc3066-private.h:58 msgid "Beja" msgstr "" #: src/translate-rfc3066-private.h:59 msgid "Belarusian" msgstr "" #: src/translate-rfc3066-private.h:60 msgid "Bemba" msgstr "" #: src/translate-rfc3066-private.h:61 msgid "Bengali" msgstr "" #: src/translate-rfc3066-private.h:62 msgid "Berber (Other)" msgstr "" #: src/translate-rfc3066-private.h:63 msgid "Bhojpuri" msgstr "" #: src/translate-rfc3066-private.h:64 msgid "Bihari" msgstr "" #: src/translate-rfc3066-private.h:65 msgid "Bikol" msgstr "" #: src/translate-rfc3066-private.h:66 msgid "Bini" msgstr "" #: src/translate-rfc3066-private.h:67 msgid "Bislama" msgstr "" #: src/translate-rfc3066-private.h:68 msgid "Siksika" msgstr "" #: src/translate-rfc3066-private.h:69 msgid "Bantu (Other)" msgstr "" #: src/translate-rfc3066-private.h:70 msgid "Bosnian" msgstr "" #: src/translate-rfc3066-private.h:71 msgid "Braj" msgstr "" #: src/translate-rfc3066-private.h:72 msgid "Breton" msgstr "" #: src/translate-rfc3066-private.h:73 msgid "Batak (Indonesia)" msgstr "" #: src/translate-rfc3066-private.h:74 msgid "Buriat" msgstr "" #: src/translate-rfc3066-private.h:75 msgid "Buginese" msgstr "" #: src/translate-rfc3066-private.h:76 msgid "Bulgarian" msgstr "" #: src/translate-rfc3066-private.h:77 msgid "Burmese" msgstr "" #: src/translate-rfc3066-private.h:78 msgid "Blin; Bilin" msgstr "" #: src/translate-rfc3066-private.h:79 msgid "Caddo" msgstr "" #: src/translate-rfc3066-private.h:80 msgid "Central American Indian (Other)" msgstr "" #: src/translate-rfc3066-private.h:81 msgid "Carib" msgstr "" #: src/translate-rfc3066-private.h:82 msgid "Catalan; Valencian" msgstr "" #: src/translate-rfc3066-private.h:83 msgid "Caucasian (Other)" msgstr "" #: src/translate-rfc3066-private.h:84 msgid "Cebuano" msgstr "" #: src/translate-rfc3066-private.h:85 msgid "Celtic (Other)" msgstr "" #: src/translate-rfc3066-private.h:86 msgid "Chamorro" msgstr "" #: src/translate-rfc3066-private.h:87 msgid "Chibcha" msgstr "" #: src/translate-rfc3066-private.h:88 msgid "Chechen" msgstr "" #: src/translate-rfc3066-private.h:89 msgid "Chagatai" msgstr "" #: src/translate-rfc3066-private.h:90 msgid "Chinese" msgstr "" #: src/translate-rfc3066-private.h:91 msgid "Chuukese" msgstr "" #: src/translate-rfc3066-private.h:92 msgid "Mari" msgstr "" #: src/translate-rfc3066-private.h:93 msgid "Chinook jargon" msgstr "" #: src/translate-rfc3066-private.h:94 msgid "Choctaw" msgstr "" #: src/translate-rfc3066-private.h:95 msgid "Chipewyan" msgstr "" #: src/translate-rfc3066-private.h:96 msgid "Cherokee" msgstr "" #: src/translate-rfc3066-private.h:97 msgid "" "Church Slavic; Old Slavonic; Church Slavonic; Old Bulgarian; Old Church " "Slavonic" msgstr "" #: src/translate-rfc3066-private.h:98 msgid "Chuvash" msgstr "" #: src/translate-rfc3066-private.h:99 msgid "Cheyenne" msgstr "" #: src/translate-rfc3066-private.h:100 msgid "Chamic languages" msgstr "" #: src/translate-rfc3066-private.h:101 msgid "Coptic" msgstr "" #: src/translate-rfc3066-private.h:102 msgid "Cornish" msgstr "" #: src/translate-rfc3066-private.h:103 msgid "Corsican" msgstr "" #: src/translate-rfc3066-private.h:104 msgid "Creoles and pidgins, English based (Other)" msgstr "" #: src/translate-rfc3066-private.h:105 msgid "Creoles and pidgins, French-based (Other)" msgstr "" #: src/translate-rfc3066-private.h:106 msgid "Creoles and pidgins, Portuguese-based (Other)" msgstr "" #: src/translate-rfc3066-private.h:107 msgid "Cree" msgstr "" #: src/translate-rfc3066-private.h:108 msgid "Crimean Tatar; Crimean Turkish" msgstr "" #: src/translate-rfc3066-private.h:109 msgid "Creoles and pidgins (Other)" msgstr "" #: src/translate-rfc3066-private.h:110 msgid "Kashubian" msgstr "" #: src/translate-rfc3066-private.h:111 msgid "Cushitic (Other)" msgstr "" #: src/translate-rfc3066-private.h:112 msgid "Czech" msgstr "" #: src/translate-rfc3066-private.h:113 msgid "Dakota" msgstr "" #: src/translate-rfc3066-private.h:114 msgid "Danish" msgstr "" #: src/translate-rfc3066-private.h:115 msgid "Dargwa" msgstr "" #: src/translate-rfc3066-private.h:116 msgid "Dayak" msgstr "" #: src/translate-rfc3066-private.h:117 msgid "Delaware" msgstr "" #: src/translate-rfc3066-private.h:118 msgid "Slave (Athapascan)" msgstr "" #: src/translate-rfc3066-private.h:119 msgid "Dogrib" msgstr "" #: src/translate-rfc3066-private.h:120 msgid "Dinka" msgstr "" #: src/translate-rfc3066-private.h:121 msgid "Divehi" msgstr "" #: src/translate-rfc3066-private.h:122 msgid "Dogri" msgstr "" #: src/translate-rfc3066-private.h:123 msgid "Dravidian (Other)" msgstr "" #: src/translate-rfc3066-private.h:124 msgid "Lower Sorbian" msgstr "" #: src/translate-rfc3066-private.h:125 msgid "Duala" msgstr "" #: src/translate-rfc3066-private.h:126 msgid "Dutch, Middle (ca.1050-1350)" msgstr "" #: src/translate-rfc3066-private.h:127 msgid "Dutch; Flemish" msgstr "" #: src/translate-rfc3066-private.h:128 msgid "Dyula" msgstr "" #: src/translate-rfc3066-private.h:129 msgid "Dzongkha" msgstr "" #: src/translate-rfc3066-private.h:130 msgid "Efik" msgstr "" #: src/translate-rfc3066-private.h:131 msgid "Egyptian (Ancient)" msgstr "" #: src/translate-rfc3066-private.h:132 msgid "Ekajuk" msgstr "" #: src/translate-rfc3066-private.h:133 msgid "Elamite" msgstr "" #: src/translate-rfc3066-private.h:134 msgid "English" msgstr "" #: src/translate-rfc3066-private.h:135 msgid "English, Middle (1100-1500)" msgstr "" #: src/translate-rfc3066-private.h:136 msgid "Esperanto" msgstr "" #: src/translate-rfc3066-private.h:137 msgid "Estonian" msgstr "" #: src/translate-rfc3066-private.h:138 msgid "Ewe" msgstr "" #: src/translate-rfc3066-private.h:139 msgid "Ewondo" msgstr "" #: src/translate-rfc3066-private.h:140 msgid "Fang" msgstr "" #: src/translate-rfc3066-private.h:141 msgid "Faroese" msgstr "" #: src/translate-rfc3066-private.h:142 msgid "Fanti" msgstr "" #: src/translate-rfc3066-private.h:143 msgid "Fijian" msgstr "" #: src/translate-rfc3066-private.h:144 msgid "Filipino; Pilipino" msgstr "" #: src/translate-rfc3066-private.h:145 msgid "Finnish" msgstr "" #: src/translate-rfc3066-private.h:146 msgid "Finno-Ugrian (Other)" msgstr "" #: src/translate-rfc3066-private.h:147 msgid "Fon" msgstr "" #: src/translate-rfc3066-private.h:148 msgid "French" msgstr "" #: src/translate-rfc3066-private.h:149 msgid "French, Middle (ca.1400-1800)" msgstr "" #: src/translate-rfc3066-private.h:150 msgid "French, Old (842-ca.1400)" msgstr "" #: src/translate-rfc3066-private.h:151 msgid "Frisian" msgstr "" #: src/translate-rfc3066-private.h:152 msgid "Fulah" msgstr "" #: src/translate-rfc3066-private.h:153 msgid "Friulian" msgstr "" #: src/translate-rfc3066-private.h:154 msgid "Ga" msgstr "" #: src/translate-rfc3066-private.h:155 msgid "Gayo" msgstr "" #: src/translate-rfc3066-private.h:156 msgid "Gbaya" msgstr "" #: src/translate-rfc3066-private.h:157 msgid "Germanic (Other)" msgstr "" #: src/translate-rfc3066-private.h:158 msgid "Georgian" msgstr "" #: src/translate-rfc3066-private.h:159 msgid "German" msgstr "" #: src/translate-rfc3066-private.h:160 msgid "Geez" msgstr "" #: src/translate-rfc3066-private.h:161 msgid "Gilbertese" msgstr "" #: src/translate-rfc3066-private.h:162 msgid "Gaelic; Scottish Gaelic" msgstr "" #: src/translate-rfc3066-private.h:163 msgid "Irish" msgstr "" #: src/translate-rfc3066-private.h:164 msgid "Gallegan" msgstr "" #: src/translate-rfc3066-private.h:165 msgid "Manx" msgstr "" #: src/translate-rfc3066-private.h:166 msgid "German, Middle High (ca.1050-1500)" msgstr "" #: src/translate-rfc3066-private.h:167 msgid "German, Old High (ca.750-1050)" msgstr "" #: src/translate-rfc3066-private.h:168 msgid "Gondi" msgstr "" #: src/translate-rfc3066-private.h:169 msgid "Gorontalo" msgstr "" #: src/translate-rfc3066-private.h:170 msgid "Gothic" msgstr "" #: src/translate-rfc3066-private.h:171 msgid "Grebo" msgstr "" #: src/translate-rfc3066-private.h:172 msgid "Greek, Ancient (to 1453)" msgstr "" #: src/translate-rfc3066-private.h:173 msgid "Greek, Modern (1453-)" msgstr "" #: src/translate-rfc3066-private.h:174 msgid "Guarani" msgstr "" #: src/translate-rfc3066-private.h:175 msgid "Gujarati" msgstr "" #: src/translate-rfc3066-private.h:176 msgid "Gwich´in" msgstr "" #: src/translate-rfc3066-private.h:177 msgid "Haida" msgstr "" #: src/translate-rfc3066-private.h:178 msgid "Haitian; Haitian Creole" msgstr "" #: src/translate-rfc3066-private.h:179 msgid "Hausa" msgstr "" #: src/translate-rfc3066-private.h:180 msgid "Hawaiian" msgstr "" #: src/translate-rfc3066-private.h:181 msgid "Hebrew" msgstr "" #: src/translate-rfc3066-private.h:182 msgid "Herero" msgstr "" #: src/translate-rfc3066-private.h:183 msgid "Hiligaynon" msgstr "" #: src/translate-rfc3066-private.h:184 msgid "Himachali" msgstr "" #: src/translate-rfc3066-private.h:185 msgid "Hindi" msgstr "" #: src/translate-rfc3066-private.h:186 msgid "Hittite" msgstr "" #: src/translate-rfc3066-private.h:187 msgid "Hmong" msgstr "" #: src/translate-rfc3066-private.h:188 msgid "Hiri Motu" msgstr "" #: src/translate-rfc3066-private.h:189 msgid "Upper Sorbian" msgstr "" #: src/translate-rfc3066-private.h:190 msgid "Hungarian" msgstr "" #: src/translate-rfc3066-private.h:191 msgid "Hupa" msgstr "" #: src/translate-rfc3066-private.h:192 msgid "Iban" msgstr "" #: src/translate-rfc3066-private.h:193 msgid "Igbo" msgstr "" #: src/translate-rfc3066-private.h:194 msgid "Icelandic" msgstr "" #: src/translate-rfc3066-private.h:195 msgid "Ido" msgstr "" #: src/translate-rfc3066-private.h:196 msgid "Sichuan Yi" msgstr "" #: src/translate-rfc3066-private.h:197 msgid "Ijo" msgstr "" #: src/translate-rfc3066-private.h:198 msgid "Inuktitut" msgstr "" #: src/translate-rfc3066-private.h:199 msgid "Interlingue" msgstr "" #: src/translate-rfc3066-private.h:200 msgid "Iloko" msgstr "" #: src/translate-rfc3066-private.h:201 msgid "Interlingua (International Auxiliary Language Association)" msgstr "" #: src/translate-rfc3066-private.h:202 msgid "Indic (Other)" msgstr "" #: src/translate-rfc3066-private.h:203 msgid "Indonesian" msgstr "" #: src/translate-rfc3066-private.h:204 msgid "Indo-European (Other)" msgstr "" #: src/translate-rfc3066-private.h:205 msgid "Ingush" msgstr "" #: src/translate-rfc3066-private.h:206 msgid "Inupiaq" msgstr "" #: src/translate-rfc3066-private.h:207 msgid "Iranian (Other)" msgstr "" #: src/translate-rfc3066-private.h:208 msgid "Iroquoian languages" msgstr "" #: src/translate-rfc3066-private.h:209 msgid "Italian" msgstr "" #: src/translate-rfc3066-private.h:210 msgid "Javanese" msgstr "" #: src/translate-rfc3066-private.h:211 msgid "Lojban" msgstr "" #: src/translate-rfc3066-private.h:212 msgid "Japanese" msgstr "" #: src/translate-rfc3066-private.h:213 msgid "Judeo-Persian" msgstr "" #: src/translate-rfc3066-private.h:214 msgid "Judeo-Arabic" msgstr "" #: src/translate-rfc3066-private.h:215 msgid "Kara-Kalpak" msgstr "" #: src/translate-rfc3066-private.h:216 msgid "Kabyle" msgstr "" #: src/translate-rfc3066-private.h:217 msgid "Kachin" msgstr "" #: src/translate-rfc3066-private.h:218 msgid "Kalaallisut; Greenlandic" msgstr "" #: src/translate-rfc3066-private.h:219 msgid "Kamba" msgstr "" #: src/translate-rfc3066-private.h:220 msgid "Kannada" msgstr "" #: src/translate-rfc3066-private.h:221 msgid "Karen" msgstr "" #: src/translate-rfc3066-private.h:222 msgid "Kashmiri" msgstr "" #: src/translate-rfc3066-private.h:223 msgid "Kanuri" msgstr "" #: src/translate-rfc3066-private.h:224 msgid "Kawi" msgstr "" #: src/translate-rfc3066-private.h:225 msgid "Kazakh" msgstr "" #: src/translate-rfc3066-private.h:226 msgid "Kabardian" msgstr "" #: src/translate-rfc3066-private.h:227 msgid "Khasi" msgstr "" #: src/translate-rfc3066-private.h:228 msgid "Khoisan (Other)" msgstr "" #: src/translate-rfc3066-private.h:229 msgid "Khmer" msgstr "" #: src/translate-rfc3066-private.h:230 msgid "Khotanese" msgstr "" #: src/translate-rfc3066-private.h:231 msgid "Kikuyu; Gikuyu" msgstr "" #: src/translate-rfc3066-private.h:232 msgid "Kinyarwanda" msgstr "" #: src/translate-rfc3066-private.h:233 msgid "Kirghiz" msgstr "" #: src/translate-rfc3066-private.h:234 msgid "Kimbundu" msgstr "" #: src/translate-rfc3066-private.h:235 msgid "Konkani" msgstr "" #: src/translate-rfc3066-private.h:236 msgid "Komi" msgstr "" #: src/translate-rfc3066-private.h:237 msgid "Kongo" msgstr "" #: src/translate-rfc3066-private.h:238 msgid "Korean" msgstr "" #: src/translate-rfc3066-private.h:239 msgid "Kosraean" msgstr "" #: src/translate-rfc3066-private.h:240 msgid "Kpelle" msgstr "" #: src/translate-rfc3066-private.h:241 msgid "Karachay-Balkar" msgstr "" #: src/translate-rfc3066-private.h:242 msgid "Kru" msgstr "" #: src/translate-rfc3066-private.h:243 msgid "Kurukh" msgstr "" #: src/translate-rfc3066-private.h:244 msgid "Kuanyama; Kwanyama" msgstr "" #: src/translate-rfc3066-private.h:245 msgid "Kumyk" msgstr "" #: src/translate-rfc3066-private.h:246 msgid "Kurdish" msgstr "" #: src/translate-rfc3066-private.h:247 msgid "Kutenai" msgstr "" #: src/translate-rfc3066-private.h:248 msgid "Ladino" msgstr "" #: src/translate-rfc3066-private.h:249 msgid "Lahnda" msgstr "" #: src/translate-rfc3066-private.h:250 msgid "Lamba" msgstr "" #: src/translate-rfc3066-private.h:251 msgid "Lao" msgstr "" #: src/translate-rfc3066-private.h:252 msgid "Latin" msgstr "" #: src/translate-rfc3066-private.h:253 msgid "Latvian" msgstr "" #: src/translate-rfc3066-private.h:254 msgid "Lezghian" msgstr "" #: src/translate-rfc3066-private.h:255 msgid "Limburgan; Limburger; Limburgish" msgstr "" #: src/translate-rfc3066-private.h:256 msgid "Lingala" msgstr "" #: src/translate-rfc3066-private.h:257 msgid "Lithuanian" msgstr "" #: src/translate-rfc3066-private.h:258 msgid "Mongo" msgstr "" #: src/translate-rfc3066-private.h:259 msgid "Lozi" msgstr "" #: src/translate-rfc3066-private.h:260 msgid "Luxembourgish; Letzeburgesch" msgstr "" #: src/translate-rfc3066-private.h:261 msgid "Luba-Lulua" msgstr "" #: src/translate-rfc3066-private.h:262 msgid "Luba-Katanga" msgstr "" #: src/translate-rfc3066-private.h:263 msgid "Ganda" msgstr "" #: src/translate-rfc3066-private.h:264 msgid "Luiseno" msgstr "" #: src/translate-rfc3066-private.h:265 msgid "Lunda" msgstr "" #: src/translate-rfc3066-private.h:266 msgid "Luo (Kenya and Tanzania)" msgstr "" #: src/translate-rfc3066-private.h:267 msgid "lushai" msgstr "" #: src/translate-rfc3066-private.h:268 msgid "Macedonian" msgstr "" #: src/translate-rfc3066-private.h:269 msgid "Madurese" msgstr "" #: src/translate-rfc3066-private.h:270 msgid "Magahi" msgstr "" #: src/translate-rfc3066-private.h:271 msgid "Marshallese" msgstr "" #: src/translate-rfc3066-private.h:272 msgid "Maithili" msgstr "" #: src/translate-rfc3066-private.h:273 msgid "Makasar" msgstr "" #: src/translate-rfc3066-private.h:274 msgid "Malayalam" msgstr "" #: src/translate-rfc3066-private.h:275 msgid "Mandingo" msgstr "" #: src/translate-rfc3066-private.h:276 msgid "Maori" msgstr "" #: src/translate-rfc3066-private.h:277 msgid "Austronesian (Other)" msgstr "" #: src/translate-rfc3066-private.h:278 msgid "Marathi" msgstr "" #: src/translate-rfc3066-private.h:279 msgid "Masai" msgstr "" #: src/translate-rfc3066-private.h:280 msgid "Malay" msgstr "" #: src/translate-rfc3066-private.h:281 msgid "Moksha" msgstr "" #: src/translate-rfc3066-private.h:282 msgid "Mandar" msgstr "" #: src/translate-rfc3066-private.h:283 msgid "Mende" msgstr "" #: src/translate-rfc3066-private.h:284 msgid "Irish, Middle (900-1200)" msgstr "" #: src/translate-rfc3066-private.h:285 msgid "Mi'kmaq; Micmac" msgstr "" #: src/translate-rfc3066-private.h:286 msgid "Minangkabau" msgstr "" #: src/translate-rfc3066-private.h:287 msgid "Miscellaneous languages" msgstr "" #: src/translate-rfc3066-private.h:288 msgid "Mon-Khmer (Other)" msgstr "" #: src/translate-rfc3066-private.h:289 msgid "Malagasy" msgstr "" #: src/translate-rfc3066-private.h:290 msgid "Maltese" msgstr "" #: src/translate-rfc3066-private.h:291 msgid "Manchu" msgstr "" #: src/translate-rfc3066-private.h:292 msgid "Manipuri" msgstr "" #: src/translate-rfc3066-private.h:293 msgid "Manobo languages" msgstr "" #: src/translate-rfc3066-private.h:294 msgid "Mohawk" msgstr "" #: src/translate-rfc3066-private.h:295 msgid "Moldavian" msgstr "" #: src/translate-rfc3066-private.h:296 msgid "Mongolian" msgstr "" #: src/translate-rfc3066-private.h:297 msgid "Mossi" msgstr "" #: src/translate-rfc3066-private.h:298 msgid "Multiple languages" msgstr "" #: src/translate-rfc3066-private.h:299 msgid "Munda languages" msgstr "" #: src/translate-rfc3066-private.h:300 msgid "Creek" msgstr "" #: src/translate-rfc3066-private.h:301 msgid "Mirandese" msgstr "" #: src/translate-rfc3066-private.h:302 msgid "Marwari" msgstr "" #: src/translate-rfc3066-private.h:303 msgid "Mayan languages" msgstr "" #: src/translate-rfc3066-private.h:304 msgid "Erzya" msgstr "" #: src/translate-rfc3066-private.h:305 msgid "Nahuatl" msgstr "" #: src/translate-rfc3066-private.h:306 msgid "North American Indian" msgstr "" #: src/translate-rfc3066-private.h:307 msgid "Neapolitan" msgstr "" #: src/translate-rfc3066-private.h:308 msgid "Nauru" msgstr "" #: src/translate-rfc3066-private.h:309 msgid "Navajo; Navaho" msgstr "" #: src/translate-rfc3066-private.h:310 msgid "Ndebele, South; South Ndebele" msgstr "" #: src/translate-rfc3066-private.h:311 msgid "Ndebele, North; North Ndebele" msgstr "" #: src/translate-rfc3066-private.h:312 msgid "Ndonga" msgstr "" #: src/translate-rfc3066-private.h:313 msgid "Low German; Low Saxon; German, Low; Saxon, Low" msgstr "" #: src/translate-rfc3066-private.h:314 msgid "Nepali" msgstr "" #: src/translate-rfc3066-private.h:315 msgid "Nepal Bhasa; Newari" msgstr "" #: src/translate-rfc3066-private.h:316 msgid "Nias" msgstr "" #: src/translate-rfc3066-private.h:317 msgid "Niger-Kordofanian (Other)" msgstr "" #: src/translate-rfc3066-private.h:318 msgid "Niuean" msgstr "" #: src/translate-rfc3066-private.h:319 msgid "Norwegian Nynorsk" msgstr "" #: src/translate-rfc3066-private.h:320 msgid "Norwegian Bokmål" msgstr "" #: src/translate-rfc3066-private.h:321 msgid "Nogai" msgstr "" #: src/translate-rfc3066-private.h:322 msgid "Norse, Old" msgstr "" #: src/translate-rfc3066-private.h:323 msgid "Norwegian" msgstr "" #: src/translate-rfc3066-private.h:324 msgid "Northern Sotho; Pedi; Sepedi" msgstr "" #: src/translate-rfc3066-private.h:325 msgid "Nubian languages" msgstr "" #: src/translate-rfc3066-private.h:326 msgid "Classical Newari; Old Newari; Classical Nepal Bhasa" msgstr "" #: src/translate-rfc3066-private.h:327 msgid "Chichewa; Chewa; Nyanja" msgstr "" #: src/translate-rfc3066-private.h:328 msgid "Nyamwezi" msgstr "" #: src/translate-rfc3066-private.h:329 msgid "Nyankole" msgstr "" #: src/translate-rfc3066-private.h:330 msgid "Nyoro" msgstr "" #: src/translate-rfc3066-private.h:331 msgid "Nzima" msgstr "" #: src/translate-rfc3066-private.h:332 msgid "Occitan (post 1500); Provençal" msgstr "" #: src/translate-rfc3066-private.h:333 msgid "Ojibwa" msgstr "" #: src/translate-rfc3066-private.h:334 msgid "Oriya" msgstr "" #: src/translate-rfc3066-private.h:335 msgid "Oromo" msgstr "" #: src/translate-rfc3066-private.h:336 msgid "Osage" msgstr "" #: src/translate-rfc3066-private.h:337 msgid "Ossetian; Ossetic" msgstr "" #: src/translate-rfc3066-private.h:338 msgid "Turkish, Ottoman (1500-1928)" msgstr "" #: src/translate-rfc3066-private.h:339 msgid "Otomian languages" msgstr "" #: src/translate-rfc3066-private.h:340 msgid "Papuan (Other)" msgstr "" #: src/translate-rfc3066-private.h:341 msgid "Pangasinan" msgstr "" #: src/translate-rfc3066-private.h:342 msgid "Pahlavi" msgstr "" #: src/translate-rfc3066-private.h:343 msgid "Pampanga" msgstr "" #: src/translate-rfc3066-private.h:344 msgid "Panjabi; Punjabi" msgstr "" #: src/translate-rfc3066-private.h:345 msgid "Papiamento" msgstr "" #: src/translate-rfc3066-private.h:346 msgid "Palauan" msgstr "" #: src/translate-rfc3066-private.h:347 msgid "Persian, Old (ca.600-400 B.C.)" msgstr "" #: src/translate-rfc3066-private.h:348 msgid "Persian" msgstr "" #: src/translate-rfc3066-private.h:349 msgid "Philippine (Other)" msgstr "" #: src/translate-rfc3066-private.h:350 msgid "Phoenician" msgstr "" #: src/translate-rfc3066-private.h:351 msgid "Pali" msgstr "" #: src/translate-rfc3066-private.h:352 msgid "Polish" msgstr "" #: src/translate-rfc3066-private.h:353 msgid "Pohnpeian" msgstr "" #: src/translate-rfc3066-private.h:354 msgid "Portuguese" msgstr "" #: src/translate-rfc3066-private.h:355 msgid "Prakrit languages" msgstr "" #: src/translate-rfc3066-private.h:356 msgid "Provençal, Old (to 1500)" msgstr "" #: src/translate-rfc3066-private.h:357 msgid "Pushto" msgstr "" #: src/translate-rfc3066-private.h:358 msgid "Reserved for local use" msgstr "" #: src/translate-rfc3066-private.h:359 msgid "Quechua" msgstr "" #: src/translate-rfc3066-private.h:360 msgid "Rajasthani" msgstr "" #: src/translate-rfc3066-private.h:361 msgid "Rapanui" msgstr "" #: src/translate-rfc3066-private.h:362 msgid "Rarotongan" msgstr "" #: src/translate-rfc3066-private.h:363 msgid "Romance (Other)" msgstr "" #: src/translate-rfc3066-private.h:364 msgid "Raeto-Romance" msgstr "" #: src/translate-rfc3066-private.h:365 msgid "Romany" msgstr "" #: src/translate-rfc3066-private.h:366 msgid "Romanian" msgstr "" #: src/translate-rfc3066-private.h:367 msgid "Rundi" msgstr "" #: src/translate-rfc3066-private.h:368 msgid "Russian" msgstr "" #: src/translate-rfc3066-private.h:369 msgid "Sandawe" msgstr "" #: src/translate-rfc3066-private.h:370 msgid "Sango" msgstr "" #: src/translate-rfc3066-private.h:371 msgid "Yakut" msgstr "" #: src/translate-rfc3066-private.h:372 msgid "South American Indian (Other)" msgstr "" #: src/translate-rfc3066-private.h:373 msgid "Salishan languages" msgstr "" #: src/translate-rfc3066-private.h:374 msgid "Samaritan Aramaic" msgstr "" #: src/translate-rfc3066-private.h:375 msgid "Sanskrit" msgstr "" #: src/translate-rfc3066-private.h:376 msgid "Sasak" msgstr "" #: src/translate-rfc3066-private.h:377 msgid "Santali" msgstr "" #: src/translate-rfc3066-private.h:378 msgid "Serbian" msgstr "" #: src/translate-rfc3066-private.h:379 msgid "Sicilian" msgstr "" #: src/translate-rfc3066-private.h:380 msgid "Scots" msgstr "" #: src/translate-rfc3066-private.h:381 msgid "Croatian" msgstr "" #: src/translate-rfc3066-private.h:382 msgid "Selkup" msgstr "" #: src/translate-rfc3066-private.h:383 msgid "Semitic (Other)" msgstr "" #: src/translate-rfc3066-private.h:384 msgid "Irish, Old (to 900)" msgstr "" #: src/translate-rfc3066-private.h:385 msgid "Sign Languages" msgstr "" #: src/translate-rfc3066-private.h:386 msgid "Shan" msgstr "" #: src/translate-rfc3066-private.h:387 msgid "Sidamo" msgstr "" #: src/translate-rfc3066-private.h:388 msgid "Sinhala; Sinhalese" msgstr "" #: src/translate-rfc3066-private.h:389 msgid "Siouan languages" msgstr "" #: src/translate-rfc3066-private.h:390 msgid "Sino-Tibetan (Other)" msgstr "" #: src/translate-rfc3066-private.h:391 msgid "Slavic (Other)" msgstr "" #: src/translate-rfc3066-private.h:392 msgid "Slovak" msgstr "" #: src/translate-rfc3066-private.h:393 msgid "Slovenian" msgstr "" #: src/translate-rfc3066-private.h:394 msgid "Southern Sami" msgstr "" #: src/translate-rfc3066-private.h:395 msgid "Northern Sami" msgstr "" #: src/translate-rfc3066-private.h:396 msgid "Sami languages (Other)" msgstr "" #: src/translate-rfc3066-private.h:397 msgid "Lule Sami" msgstr "" #: src/translate-rfc3066-private.h:398 msgid "Inari Sami" msgstr "" #: src/translate-rfc3066-private.h:399 msgid "Samoan" msgstr "" #: src/translate-rfc3066-private.h:400 msgid "Skolt Sami" msgstr "" #: src/translate-rfc3066-private.h:401 msgid "Shona" msgstr "" #: src/translate-rfc3066-private.h:402 msgid "Sindhi" msgstr "" #: src/translate-rfc3066-private.h:403 msgid "Soninke" msgstr "" #: src/translate-rfc3066-private.h:404 msgid "Sogdian" msgstr "" #: src/translate-rfc3066-private.h:405 msgid "Somali" msgstr "" #: src/translate-rfc3066-private.h:406 msgid "Songhai" msgstr "" #: src/translate-rfc3066-private.h:407 msgid "Sotho, Southern" msgstr "" #: src/translate-rfc3066-private.h:408 msgid "Spanish; Castilian" msgstr "" #: src/translate-rfc3066-private.h:409 msgid "Sardinian" msgstr "" #: src/translate-rfc3066-private.h:410 msgid "Serer" msgstr "" #: src/translate-rfc3066-private.h:411 msgid "Nilo-Saharan (Other)" msgstr "" #: src/translate-rfc3066-private.h:412 msgid "Swati" msgstr "" #: src/translate-rfc3066-private.h:413 msgid "Sukuma" msgstr "" #: src/translate-rfc3066-private.h:414 msgid "Sundanese" msgstr "" #: src/translate-rfc3066-private.h:415 msgid "Susu" msgstr "" #: src/translate-rfc3066-private.h:416 msgid "Sumerian" msgstr "" #: src/translate-rfc3066-private.h:417 msgid "Swahili" msgstr "" #: src/translate-rfc3066-private.h:418 msgid "Swedish" msgstr "" #: src/translate-rfc3066-private.h:419 msgid "Syriac" msgstr "" #: src/translate-rfc3066-private.h:420 msgid "Tahitian" msgstr "" #: src/translate-rfc3066-private.h:421 msgid "Tai (Other)" msgstr "" #: src/translate-rfc3066-private.h:422 msgid "Tamil" msgstr "" #: src/translate-rfc3066-private.h:423 msgid "Tatar" msgstr "" #: src/translate-rfc3066-private.h:424 msgid "Telugu" msgstr "" #: src/translate-rfc3066-private.h:425 msgid "Timne" msgstr "" #: src/translate-rfc3066-private.h:426 msgid "Tereno" msgstr "" #: src/translate-rfc3066-private.h:427 msgid "Tetum" msgstr "" #: src/translate-rfc3066-private.h:428 msgid "Tajik" msgstr "" #: src/translate-rfc3066-private.h:429 msgid "Tagalog" msgstr "" #: src/translate-rfc3066-private.h:430 msgid "Thai" msgstr "" #: src/translate-rfc3066-private.h:431 msgid "Tibetan" msgstr "" #: src/translate-rfc3066-private.h:432 msgid "Tigre" msgstr "" #: src/translate-rfc3066-private.h:433 msgid "Tigrinya" msgstr "" #: src/translate-rfc3066-private.h:434 msgid "Tiv" msgstr "" #: src/translate-rfc3066-private.h:435 msgid "Tokelau" msgstr "" #: src/translate-rfc3066-private.h:436 msgid "Klingon; tlhIngan-Hol" msgstr "" #: src/translate-rfc3066-private.h:437 msgid "Tlingit" msgstr "" #: src/translate-rfc3066-private.h:438 msgid "Tamashek" msgstr "" #: src/translate-rfc3066-private.h:439 msgid "Tonga (Nyasa)" msgstr "" #: src/translate-rfc3066-private.h:440 msgid "Tonga (Tonga Islands)" msgstr "" #: src/translate-rfc3066-private.h:441 msgid "Tok Pisin" msgstr "" #: src/translate-rfc3066-private.h:442 msgid "Tsimshian" msgstr "" #: src/translate-rfc3066-private.h:443 msgid "Tswana" msgstr "" #: src/translate-rfc3066-private.h:444 msgid "Tsonga" msgstr "" #: src/translate-rfc3066-private.h:445 msgid "Turkmen" msgstr "" #: src/translate-rfc3066-private.h:446 msgid "Tumbuka" msgstr "" #: src/translate-rfc3066-private.h:447 msgid "Tupi languages" msgstr "" #: src/translate-rfc3066-private.h:448 msgid "Turkish" msgstr "" #: src/translate-rfc3066-private.h:449 msgid "Altaic (Other)" msgstr "" #: src/translate-rfc3066-private.h:450 msgid "Tuvalu" msgstr "" #: src/translate-rfc3066-private.h:451 msgid "Twi" msgstr "" #: src/translate-rfc3066-private.h:452 msgid "Tuvinian" msgstr "" #: src/translate-rfc3066-private.h:453 msgid "Udmurt" msgstr "" #: src/translate-rfc3066-private.h:454 msgid "Ugaritic" msgstr "" #: src/translate-rfc3066-private.h:455 msgid "Uighur; Uyghur" msgstr "" #: src/translate-rfc3066-private.h:456 msgid "Ukrainian" msgstr "" #: src/translate-rfc3066-private.h:457 msgid "Umbundu" msgstr "" #: src/translate-rfc3066-private.h:458 msgid "Undetermined" msgstr "" #: src/translate-rfc3066-private.h:459 msgid "Urdu" msgstr "" #: src/translate-rfc3066-private.h:460 msgid "Uzbek" msgstr "" #: src/translate-rfc3066-private.h:461 msgid "Vai" msgstr "" #: src/translate-rfc3066-private.h:462 msgid "Venda" msgstr "" #: src/translate-rfc3066-private.h:463 msgid "Vietnamese" msgstr "" #: src/translate-rfc3066-private.h:464 msgid "Volapük" msgstr "" #: src/translate-rfc3066-private.h:465 msgid "Votic" msgstr "" #: src/translate-rfc3066-private.h:466 msgid "Wakashan languages" msgstr "" #: src/translate-rfc3066-private.h:467 msgid "Walamo" msgstr "" #: src/translate-rfc3066-private.h:468 msgid "Waray" msgstr "" #: src/translate-rfc3066-private.h:469 msgid "Washo" msgstr "" #: src/translate-rfc3066-private.h:470 msgid "Welsh" msgstr "" #: src/translate-rfc3066-private.h:471 msgid "Sorbian languages" msgstr "" #: src/translate-rfc3066-private.h:472 msgid "Walloon" msgstr "" #: src/translate-rfc3066-private.h:473 msgid "Wolof" msgstr "" #: src/translate-rfc3066-private.h:474 msgid "Kalmyk" msgstr "" #: src/translate-rfc3066-private.h:475 msgid "Xhosa" msgstr "" #: src/translate-rfc3066-private.h:476 msgid "Yao" msgstr "" #: src/translate-rfc3066-private.h:477 msgid "Yapese" msgstr "" #: src/translate-rfc3066-private.h:478 msgid "Yiddish" msgstr "" #: src/translate-rfc3066-private.h:479 msgid "Yoruba" msgstr "" #: src/translate-rfc3066-private.h:480 msgid "Yupik languages" msgstr "" #: src/translate-rfc3066-private.h:481 msgid "Zapotec" msgstr "" #: src/translate-rfc3066-private.h:482 msgid "Zenaga" msgstr "" #: src/translate-rfc3066-private.h:483 msgid "Zhuang; Chuang" msgstr "" #: src/translate-rfc3066-private.h:484 msgid "Zande" msgstr "" #: src/translate-rfc3066-private.h:485 msgid "Zulu" msgstr "" #: src/translate-rfc3066-private.h:486 msgid "Zuni" msgstr "" libtranslate-0.99/po/fr.po000644 001750 001750 00000142623 10176431053 017272 0ustar00jylefortjylefort000000 000000 # French translations for libtranslate. # Copyright (C) 2004, 2005 Jean-Yves Lefort. # # This file is distributed under the same license as the libtranslate # package. # # Jean-Yves Lefort , 2005. # msgid "" msgstr "" "Project-Id-Version: libtranslate 0.99\n" "Report-Msgid-Bugs-To: \n" "POT-Creation-Date: 2005-01-28 13:38+0100\n" "PO-Revision-Date: 2005-01-17 17:49+0100\n" "Last-Translator: Jean-Yves Lefort \n" "Language-Team: Jean-Yves Lefort \n" "MIME-Version: 1.0\n" "Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" "Plural-Forms: nplurals=2; plural=n>1;\n" #: data/services.xml.in.h:1 msgid "Chinese (Taiwan)" msgstr "chinois (Taiwan)" #: src/modules/translate-generic-parser.c:128 #, c-format msgid "unable to open %s: %s" msgstr "impossible d'ouvrir %s: %s" #: src/modules/translate-generic-parser.c:135 #, c-format msgid "unable to read %s: %s" msgstr "impossible de lire %s: %s" #: src/modules/translate-generic-parser.c:160 #, c-format msgid "%s: service \"%s\" already exists, ignored" msgstr "%s: le service \"%s\" existe déjà, ignoré" #: src/modules/translate-generic-parser.c:167 #, c-format msgid "unable to parse %s: %s" msgstr "impossible d'interpréter %s: %s" #: src/modules/translate-generic-parser.c:226 #, c-format msgid "language \"%s\" already exists, ignored" msgstr "le langage \"%s\" existe déjà, ignoré" #: src/modules/translate-generic-parser.c:251 msgid "max-chunk-len is empty" msgstr "max-chunk-len est vide" #: src/modules/translate-generic-parser.c:253 #, c-format msgid "max-chunk-len \"%s\" is not an unsigned integer" msgstr "max-chunk-len \"%s\" n'est pas un entier non signé" #: src/modules/translate-generic-parser.c:324 msgid "element \"text-translation\" already specified" msgstr "élément \"text-translation\" déjà spécifié" #: src/modules/translate-generic-parser.c:363 msgid "element \"post-marker\" already specified" msgstr "élément \"post-marker\" déjà spécifié" #: src/modules/translate-generic-parser.c:388 msgid "element \"web-page-translation\" already specified" msgstr "élément \"web-page-translation\" déjà spécifié" #: src/modules/translate-generic-parser.c:403 #, c-format msgid "unknown element \"%s\", ignored" msgstr "élément \"%s\" inconnu, ignoré" #: src/modules/translate-generic-parser.c:475 #, c-format msgid "attribute \"%s\" already specified" msgstr "attribut \"%s\" déjà spécifié" #: src/modules/translate-generic-parser.c:487 #, c-format msgid "required attribute \"%s\" missing" msgstr "attribut requis \"%s\" manquant" #: src/modules/translate-generic-parser.c:500 #, c-format msgid "unknown attribute \"%s\", ignored" msgstr "attribut \"%s\" inconnu, ignoré" #: src/modules/translate-generic-parser.c:525 #, c-format msgid "%s: around line %i: %s" msgstr "%s: autour de la ligne %i: %s" #: src/modules/translate-generic-service.c:47 #, c-format msgid "in %s, group %i, \"%s\" attribute of \"%s\" element" msgstr "dans %s, groupe %i, attribut \"%s\" de l'élément \"%s\"" #: src/modules/translate-generic-service.c:413 #, c-format msgid "unable to parse URI \"%s\"" msgstr "impossible d'interpréter l'URI \"%s\"" #: src/modules/translate-generic-service.c:510 msgid "invalid UTF-8" msgstr "UTF-8 invalide" #: src/modules/translate-generic-service.c:564 #, c-format msgid "connecting to %s:%i" msgstr "connection à %s:%i en cours" #: src/modules/translate-generic-service.c:820 msgid "invalid redirect URL" msgstr "URL de redirection invalide" #: src/modules/translate-generic-service.c:916 msgid "server failure" msgstr "échec du serveur" #: src/modules/translate-generic-service.c:985 msgid "unable to parse server data" msgstr "impossible d'interpréter les données du serveur" #: src/modules/translate-generic-service.c:1150 #, c-format msgid "%s: unknown variable \"%s\"" msgstr "%s: variable \"%s\" inconnue" #: src/modules/translate-generic-service.c:1173 #, c-format msgid "%s: value specified for \"escape\" modifier" msgstr "%s: valeur spécifiée pour le modifieur \"escape\"" #: src/modules/translate-generic-service.c:1185 #, c-format msgid "%s: unable to convert to \"%s\": %s" msgstr "%s: impossible de convertir vers \"%s\": %s" #: src/modules/translate-generic-service.c:1190 #, c-format msgid "%s: value of \"charset\" modifier missing" msgstr "%s: valeur du modifieur \"charset\" manquante" #: src/modules/translate-generic-service.c:1193 #, c-format msgid "%s: unknown modifier \"%s\"" msgstr "%s: modifieur \"%s\" inconnu" #: src/modules/translate-generic-service.c:1309 #, c-format msgid "unable to parse proxy URI \"%s\"" msgstr "impossible d'interpréter l'URI de proxy \"%s\"" #: src/modules/translate-talkfilters.c:192 #, c-format msgid "English (%s)" msgstr "anglais (%s)" #: src/translate-cli.c:167 msgid "too many arguments" msgstr "trop d'arguments" #: src/translate-cli.c:179 #, c-format msgid "unable to initialize libtranslate: %s" msgstr "impossible d'initialiser libtranslate: %s" #: src/translate-cli.c:206 #, c-format msgid "unknown service \"%s\"" msgstr "service \"%s\" inconnu" #: src/translate-cli.c:261 msgid "Synopsis:" msgstr "Synopsis:" #: src/translate-cli.c:267 msgid "Options:" msgstr "Options:" #: src/translate-cli.c:268 msgid "Show this help" msgstr "Affiche cette aide" #: src/translate-cli.c:269 msgid "Show version information" msgstr "Affiche les informations de version" #: src/translate-cli.c:270 msgid "List the available services" msgstr "Liste les services disponibles" #: src/translate-cli.c:271 msgid "Specify the list of services to use" msgstr "Specifie la liste de services à utiliser" #: src/translate-cli.c:272 msgid "Specify the source language" msgstr "Specifie le language source" #: src/translate-cli.c:273 msgid "Specify the destination language" msgstr "Specifie le language de destination" #: src/translate-cli.c:274 msgid "List the available language pairs" msgstr "Liste les paires de langages disponibles" #: src/translate-cli.c:275 msgid "Specify the maximum number of threads to use" msgstr "Specifie le nombre maximum de threads à utiliser" #: src/translate-cli.c:276 msgid "Specify the maximum number of retries per chunk" msgstr "Specifie le nombre maximum d'essais par bloc" #: src/translate-cli.c:282 #, c-format msgid "%s version %s\n" msgstr "%s version %s\n" #: src/translate-cli.c:331 msgid "text, web page" msgstr "texte, page web" #: src/translate-cli.c:333 msgid "text" msgstr "texte" #: src/translate-cli.c:335 msgid "web page" msgstr "page web" #: src/translate-cli.c:400 #, c-format msgid "unable to open \"%s\": %s" msgstr "impossible d'ouvrir \"%s\": %s" #: src/translate-cli.c:413 #, c-format msgid "unable to read from standard input: %s" msgstr "impossible de lire depuis l'entrée standard: %s" #: src/translate-cli.c:415 #, c-format msgid "unable to read from \"%s\": %s" msgstr "impossible de lire depuis \"%s\": %s" #: src/translate-cli.c:429 #, c-format msgid "unable to convert input text to UTF-8: %s" msgstr "impossible de convertir l'entrée vers l'UTF-8: %s" #: src/translate-cli.c:453 #, c-format msgid "unable to translate: %s" msgstr "impossible de traduire: %s" #: src/translate-cli.c:491 #, c-format msgid "unable to get URL of translated web page: %s" msgstr "impossible d'obtenir l'URL de la traduction de la page web: %s" #: src/translate-pair.c:142 msgid "Flags" msgstr "Drapeaux" #: src/translate-pair.c:143 msgid "The pair flags" msgstr "Les drapeaux de la paire" #: src/translate-pair.c:150 msgid "From" msgstr "De" #: src/translate-pair.c:151 msgid "The source language RFC 3066 tag" msgstr "Le tag RFC 3066 du langage source" #: src/translate-pair.c:157 msgid "To" msgstr "Vers" #: src/translate-pair.c:158 msgid "The destination language RFC 3066 tag" msgstr "Le tag RFC 3066 du langage de destination" #: src/translate-service.c:123 msgid "Name" msgstr "Nom" #: src/translate-service.c:124 msgid "The service symbolic name, encoded in ASCII" msgstr "Le nom symbolique du service, encodé en ASCII" #: src/translate-service.c:130 msgid "Nick" msgstr "Pseudonyme" #: src/translate-service.c:131 msgid "The service human-readable name" msgstr "Le nom du service lisible par des humains" #: src/translate-service.c:137 msgid "Maximum chunk length" msgstr "Longueur de bloc maximum" #: src/translate-service.c:138 msgid "The maximum length of an input chunk, in characters (0 means unlimited)" msgstr "" "La longueur maximum d'un bloc d'entrée, en caractères (0 signifie non limité)" #: src/translate-service.c:146 src/translate-session.c:159 msgid "Pairs" msgstr "Paires" #: src/translate-service.c:147 msgid "The list of language pairs this service implements" msgstr "La liste des paires de langages que ce service propose" #: src/translate-service.c:247 #, c-format msgid "" "%s: the TRANSLATE_PAIR_TEXT flag is set for %s->%s, but the translate_text " "method is not implemented (this indicates a programming error in the service " "implementation): unsetting the flag" msgstr "" "%s: le drapeau TRANSLATE_PAIR_TEXT est activé pour %s->%s, mais la méthode " "translate_text est absente (ceci indique une erreur de programmation dans le " "service): drapeau désactivé" #: src/translate-service.c:256 #, c-format msgid "" "%s: the TRANSLATE_PAIR_WEB_PAGE flag is set for %s->%s, but the " "translate_web_page method is not implemented (this indicates a programming " "error in the service implementation): unsetting the flag" msgstr "" "%s: le drapeau TRANSLATE_PAIR_WEB_PAGE est activé pour %s->%s, mais la " "méthode translate_web_page est absente (ceci indique une erreur de " "programmation dans le service): drapeau désactivé" #: src/translate-service.c:268 #, c-format msgid "%s: unable to get language pairs: %s" msgstr "%s: impossible d'obtenir les paires de langages: %s" #: src/translate-service.c:273 #, c-format msgid "" "%s: the get_pairs method is not implemented (this indicates a programming " "error in the service implementation)" msgstr "" "%s: la méthode get_pairs est absente (ceci indique une erreur de " "programmation dans le service)" #: src/translate-session.c:153 msgid "Services" msgstr "Services" #: src/translate-session.c:154 msgid "The list of services used by this session" msgstr "La liste des services utilisés par cette session" #: src/translate-session.c:160 msgid "The list of pairs this session supports" msgstr "La liste des paires que cette session supporte" #: src/translate-session.c:165 msgid "Maximum number of threads" msgstr "Nombre maximum de threads" #: src/translate-session.c:166 msgid "The maximum number of translation threads to use" msgstr "Le nombre maximum de threads de traduction à utiliser" #: src/translate-session.c:174 msgid "Maximum number of retries" msgstr "Nombre maximum d'essais" #: src/translate-session.c:175 msgid "" "The maximum number of times to retry a translation of the same chunk (-1 for " "unlimited)" msgstr "" "Le nombre maximum d'essais de traduction pour le même bloc (-1 pour non " "limité)" #: src/translate-session.c:543 #, c-format msgid "no service provides %s to %s text translation" msgstr "aucun service ne propose une traduction de texte de %s vers %s" #: src/translate-session.c:633 msgid "cancelled by user" msgstr "annulé par l'utilisateur" #: src/translate-session.c:737 #, c-format msgid "unable to translate chunk using %s: %s" msgstr "impossible de traduire le bloc en utilisant %s: %s" #: src/translate-session.c:761 msgid "no service could translate chunk" msgstr "aucun service n'a pu traduire le bloc" #: src/translate-session.c:915 #, c-format msgid "no service provides %s to %s web page translation" msgstr "aucune service ne propose une traduction de page web de %s vers %s" #: src/translate-session.c:942 #, c-format msgid "unable to translate web page using %s: %s" msgstr "impossible de traduire la page web en utilisant %s: %s" #: src/translate-session.c:957 msgid "no service could translate web page" msgstr "aucun service n'a pu traduire la page web" #: src/translate-util.c:301 #, c-format msgid "cannot get current time: %s" msgstr "impossible d'obtenir l'heure courante: %s" #: src/translate.c:131 msgid "multi-threading is not supported" msgstr "le multi-threading n'est pas supporté" #: src/translate.c:156 #, c-format msgid "unable to scan modules directory \"%s\": %s" msgstr "impossible de parcourir le répertoire de modules \"%s\": %s" #: src/translate.c:173 #, c-format msgid "unable to load module \"%s\": %s" msgstr "impossible de charger le module \"%s\": %s" #: src/translate.c:210 msgid "unable to find translate_module_init() function" msgstr "impossible de trouver la fonction translate_module_init()" #: src/translate-rfc3066-private.h:15 msgid "Afar" msgstr "afar" #: src/translate-rfc3066-private.h:16 msgid "Abkhazian" msgstr "abkhaze" #: src/translate-rfc3066-private.h:17 msgid "Achinese" msgstr "aceh" #: src/translate-rfc3066-private.h:18 msgid "Acoli" msgstr "acoli" #: src/translate-rfc3066-private.h:19 msgid "Adangme" msgstr "adangme" #: src/translate-rfc3066-private.h:20 msgid "Adyghe; Adygei" msgstr "adyghe" #: src/translate-rfc3066-private.h:21 msgid "Afro-Asiatic (Other)" msgstr "afro-asiatiques, autres langues" #: src/translate-rfc3066-private.h:22 msgid "Afrihili" msgstr "afrihili" #: src/translate-rfc3066-private.h:23 msgid "Afrikaans" msgstr "afrikaans" #: src/translate-rfc3066-private.h:24 msgid "Akan" msgstr "akan" #: src/translate-rfc3066-private.h:25 msgid "Akkadian" msgstr "akkadien" #: src/translate-rfc3066-private.h:26 msgid "Albanian" msgstr "albanais" #: src/translate-rfc3066-private.h:27 msgid "Aleut" msgstr "aléoute" #: src/translate-rfc3066-private.h:28 msgid "Algonquian languages" msgstr "algonquines, langues" #: src/translate-rfc3066-private.h:29 msgid "Amharic" msgstr "amharique" #: src/translate-rfc3066-private.h:30 msgid "English, Old (ca.450-1100)" msgstr "anglo-saxon (ca.450-1100)" #: src/translate-rfc3066-private.h:31 msgid "Apache languages" msgstr "apache" #: src/translate-rfc3066-private.h:32 msgid "Arabic" msgstr "arabe" #: src/translate-rfc3066-private.h:33 msgid "Aramaic" msgstr "araméen" #: src/translate-rfc3066-private.h:34 msgid "Aragonese" msgstr "aragonais" #: src/translate-rfc3066-private.h:35 msgid "Armenian" msgstr "arménien" #: src/translate-rfc3066-private.h:36 msgid "Araucanian" msgstr "araucan" #: src/translate-rfc3066-private.h:37 msgid "Arapaho" msgstr "arapaho" #: src/translate-rfc3066-private.h:38 msgid "Artificial (Other)" msgstr "artificielles, autres langues" #: src/translate-rfc3066-private.h:39 msgid "Arawak" msgstr "arawak" #: src/translate-rfc3066-private.h:40 msgid "Assamese" msgstr "assamais" #: src/translate-rfc3066-private.h:41 msgid "Asturian; Bable" msgstr "asturien; bable" #: src/translate-rfc3066-private.h:42 msgid "Athapascan languages" msgstr "athapascanes, langues" #: src/translate-rfc3066-private.h:43 msgid "Australian languages" msgstr "australiennes, langues" #: src/translate-rfc3066-private.h:44 msgid "Avaric" msgstr "avar" #: src/translate-rfc3066-private.h:45 msgid "Avestan" msgstr "avestique" #: src/translate-rfc3066-private.h:46 msgid "Awadhi" msgstr "awadhi" #: src/translate-rfc3066-private.h:47 msgid "Aymara" msgstr "aymara" #: src/translate-rfc3066-private.h:48 msgid "Azerbaijani" msgstr "azéri" #: src/translate-rfc3066-private.h:49 msgid "Banda" msgstr "banda" #: src/translate-rfc3066-private.h:50 msgid "Bamileke languages" msgstr "bamilékés, langues" #: src/translate-rfc3066-private.h:51 msgid "Bashkir" msgstr "bachkir" #: src/translate-rfc3066-private.h:52 msgid "Baluchi" msgstr "baloutchi" #: src/translate-rfc3066-private.h:53 msgid "Bambara" msgstr "bambara" #: src/translate-rfc3066-private.h:54 msgid "Balinese" msgstr "balinais" #: src/translate-rfc3066-private.h:55 msgid "Basque" msgstr "basque" #: src/translate-rfc3066-private.h:56 msgid "Basa" msgstr "basa" #: src/translate-rfc3066-private.h:57 msgid "Baltic (Other)" msgstr "baltiques, autres langues" #: src/translate-rfc3066-private.h:58 msgid "Beja" msgstr "bedja" #: src/translate-rfc3066-private.h:59 msgid "Belarusian" msgstr "biélorusse" #: src/translate-rfc3066-private.h:60 msgid "Bemba" msgstr "bemba" #: src/translate-rfc3066-private.h:61 msgid "Bengali" msgstr "bengali" #: src/translate-rfc3066-private.h:62 msgid "Berber (Other)" msgstr "berbères, autres langues" #: src/translate-rfc3066-private.h:63 msgid "Bhojpuri" msgstr "bhojpuri" #: src/translate-rfc3066-private.h:64 msgid "Bihari" msgstr "bihari" #: src/translate-rfc3066-private.h:65 msgid "Bikol" msgstr "bikol" #: src/translate-rfc3066-private.h:66 msgid "Bini" msgstr "bini" #: src/translate-rfc3066-private.h:67 msgid "Bislama" msgstr "bichlamar" #: src/translate-rfc3066-private.h:68 msgid "Siksika" msgstr "blackfoot" #: src/translate-rfc3066-private.h:69 msgid "Bantu (Other)" msgstr "bantoues, autres langues" #: src/translate-rfc3066-private.h:70 msgid "Bosnian" msgstr "bosniaque" #: src/translate-rfc3066-private.h:71 msgid "Braj" msgstr "braj" #: src/translate-rfc3066-private.h:72 msgid "Breton" msgstr "breton" #: src/translate-rfc3066-private.h:73 msgid "Batak (Indonesia)" msgstr "batak (Indonésie)" #: src/translate-rfc3066-private.h:74 msgid "Buriat" msgstr "bouriate" #: src/translate-rfc3066-private.h:75 msgid "Buginese" msgstr "bugi" #: src/translate-rfc3066-private.h:76 msgid "Bulgarian" msgstr "bulgare" #: src/translate-rfc3066-private.h:77 msgid "Burmese" msgstr "birman" #: src/translate-rfc3066-private.h:78 msgid "Blin; Bilin" msgstr "blin; bilen" #: src/translate-rfc3066-private.h:79 msgid "Caddo" msgstr "caddo" #: src/translate-rfc3066-private.h:80 msgid "Central American Indian (Other)" msgstr "indiennes d'Amérique centrale, autres langues" #: src/translate-rfc3066-private.h:81 msgid "Carib" msgstr "caribe" #: src/translate-rfc3066-private.h:82 msgid "Catalan; Valencian" msgstr "catalan; valencien" #: src/translate-rfc3066-private.h:83 msgid "Caucasian (Other)" msgstr "caucasiennes, autres langues" #: src/translate-rfc3066-private.h:84 msgid "Cebuano" msgstr "cebuano" #: src/translate-rfc3066-private.h:85 msgid "Celtic (Other)" msgstr "celtiques, autres langues" #: src/translate-rfc3066-private.h:86 msgid "Chamorro" msgstr "chamorro" #: src/translate-rfc3066-private.h:87 msgid "Chibcha" msgstr "chibcha" #: src/translate-rfc3066-private.h:88 msgid "Chechen" msgstr "tchétchène" #: src/translate-rfc3066-private.h:89 msgid "Chagatai" msgstr "djaghataï" #: src/translate-rfc3066-private.h:90 msgid "Chinese" msgstr "chinois" #: src/translate-rfc3066-private.h:91 msgid "Chuukese" msgstr "chuuk" #: src/translate-rfc3066-private.h:92 msgid "Mari" msgstr "mari" #: src/translate-rfc3066-private.h:93 msgid "Chinook jargon" msgstr "chinook, jargon" #: src/translate-rfc3066-private.h:94 msgid "Choctaw" msgstr "choctaw" #: src/translate-rfc3066-private.h:95 msgid "Chipewyan" msgstr "chipewyan" #: src/translate-rfc3066-private.h:96 msgid "Cherokee" msgstr "cherokee" #: src/translate-rfc3066-private.h:97 msgid "" "Church Slavic; Old Slavonic; Church Slavonic; Old Bulgarian; Old Church " "Slavonic" msgstr "slavon d'église; vieux slave; slavon liturgique; vieux bulgare" #: src/translate-rfc3066-private.h:98 msgid "Chuvash" msgstr "tchouvache" #: src/translate-rfc3066-private.h:99 msgid "Cheyenne" msgstr "cheyenne" #: src/translate-rfc3066-private.h:100 msgid "Chamic languages" msgstr "chames, langues" #: src/translate-rfc3066-private.h:101 msgid "Coptic" msgstr "copte" #: src/translate-rfc3066-private.h:102 msgid "Cornish" msgstr "cornique" #: src/translate-rfc3066-private.h:103 msgid "Corsican" msgstr "corse" #: src/translate-rfc3066-private.h:104 msgid "Creoles and pidgins, English based (Other)" msgstr "créoles et pidgins anglais, autres" #: src/translate-rfc3066-private.h:105 msgid "Creoles and pidgins, French-based (Other)" msgstr "créoles et pidgins français, autres" #: src/translate-rfc3066-private.h:106 msgid "Creoles and pidgins, Portuguese-based (Other)" msgstr "créoles et pidgins portugais, autres" #: src/translate-rfc3066-private.h:107 msgid "Cree" msgstr "cree" #: src/translate-rfc3066-private.h:108 msgid "Crimean Tatar; Crimean Turkish" msgstr "tatar de Crimé" #: src/translate-rfc3066-private.h:109 msgid "Creoles and pidgins (Other)" msgstr "créoles et pidgins divers" #: src/translate-rfc3066-private.h:110 msgid "Kashubian" msgstr "kachoube" #: src/translate-rfc3066-private.h:111 msgid "Cushitic (Other)" msgstr "couchitiques, autres langues" #: src/translate-rfc3066-private.h:112 msgid "Czech" msgstr "tchèque" #: src/translate-rfc3066-private.h:113 msgid "Dakota" msgstr "dakota" #: src/translate-rfc3066-private.h:114 msgid "Danish" msgstr "danois" #: src/translate-rfc3066-private.h:115 msgid "Dargwa" msgstr "dargwa" #: src/translate-rfc3066-private.h:116 msgid "Dayak" msgstr "dayak" #: src/translate-rfc3066-private.h:117 msgid "Delaware" msgstr "delaware" #: src/translate-rfc3066-private.h:118 msgid "Slave (Athapascan)" msgstr "esclave (athapascan)" #: src/translate-rfc3066-private.h:119 msgid "Dogrib" msgstr "dogrib" #: src/translate-rfc3066-private.h:120 msgid "Dinka" msgstr "dinka" #: src/translate-rfc3066-private.h:121 msgid "Divehi" msgstr "maldivien" #: src/translate-rfc3066-private.h:122 msgid "Dogri" msgstr "dogri" #: src/translate-rfc3066-private.h:123 msgid "Dravidian (Other)" msgstr "dravidiennes, autres langues" #: src/translate-rfc3066-private.h:124 msgid "Lower Sorbian" msgstr "bas-sorabe" #: src/translate-rfc3066-private.h:125 msgid "Duala" msgstr "douala" #: src/translate-rfc3066-private.h:126 msgid "Dutch, Middle (ca.1050-1350)" msgstr "néerlandais moyen (ca. 1050-1350)" #: src/translate-rfc3066-private.h:127 msgid "Dutch; Flemish" msgstr "néerlandais; flamand" #: src/translate-rfc3066-private.h:128 msgid "Dyula" msgstr "dioula" #: src/translate-rfc3066-private.h:129 msgid "Dzongkha" msgstr "dzongkha" #: src/translate-rfc3066-private.h:130 msgid "Efik" msgstr "efik" #: src/translate-rfc3066-private.h:131 msgid "Egyptian (Ancient)" msgstr "égyptien" #: src/translate-rfc3066-private.h:132 msgid "Ekajuk" msgstr "ekajuk" #: src/translate-rfc3066-private.h:133 msgid "Elamite" msgstr "élamite" #: src/translate-rfc3066-private.h:134 msgid "English" msgstr "anglais" #: src/translate-rfc3066-private.h:135 msgid "English, Middle (1100-1500)" msgstr "anglais moyen (1100-1500)" #: src/translate-rfc3066-private.h:136 msgid "Esperanto" msgstr "espéranto" #: src/translate-rfc3066-private.h:137 msgid "Estonian" msgstr "estonien" #: src/translate-rfc3066-private.h:138 msgid "Ewe" msgstr "éwé" #: src/translate-rfc3066-private.h:139 msgid "Ewondo" msgstr "éwondo" #: src/translate-rfc3066-private.h:140 msgid "Fang" msgstr "fang" #: src/translate-rfc3066-private.h:141 msgid "Faroese" msgstr "féroïen" #: src/translate-rfc3066-private.h:142 msgid "Fanti" msgstr "fanti" #: src/translate-rfc3066-private.h:143 msgid "Fijian" msgstr "fidjien" #: src/translate-rfc3066-private.h:144 msgid "Filipino; Pilipino" msgstr "filipino; pilipino" #: src/translate-rfc3066-private.h:145 msgid "Finnish" msgstr "finnois" #: src/translate-rfc3066-private.h:146 msgid "Finno-Ugrian (Other)" msgstr "finno-ougriennes, autres langues" #: src/translate-rfc3066-private.h:147 msgid "Fon" msgstr "fon" #: src/translate-rfc3066-private.h:148 msgid "French" msgstr "français" #: src/translate-rfc3066-private.h:149 msgid "French, Middle (ca.1400-1800)" msgstr "français moyen (1400-1800)" #: src/translate-rfc3066-private.h:150 msgid "French, Old (842-ca.1400)" msgstr "français ancien (842-ca.1400)" #: src/translate-rfc3066-private.h:151 msgid "Frisian" msgstr "frison" #: src/translate-rfc3066-private.h:152 msgid "Fulah" msgstr "peul" #: src/translate-rfc3066-private.h:153 msgid "Friulian" msgstr "frioulan" #: src/translate-rfc3066-private.h:154 msgid "Ga" msgstr "ga" #: src/translate-rfc3066-private.h:155 msgid "Gayo" msgstr "gayo" #: src/translate-rfc3066-private.h:156 msgid "Gbaya" msgstr "gbaya" #: src/translate-rfc3066-private.h:157 msgid "Germanic (Other)" msgstr "germaniques, autres langues" #: src/translate-rfc3066-private.h:158 msgid "Georgian" msgstr "géorgien" #: src/translate-rfc3066-private.h:159 msgid "German" msgstr "allemand" #: src/translate-rfc3066-private.h:160 msgid "Geez" msgstr "guèze" #: src/translate-rfc3066-private.h:161 msgid "Gilbertese" msgstr "kiribati" #: src/translate-rfc3066-private.h:162 msgid "Gaelic; Scottish Gaelic" msgstr "gaélique; gaélique écossais" #: src/translate-rfc3066-private.h:163 msgid "Irish" msgstr "irlandais" #: src/translate-rfc3066-private.h:164 msgid "Gallegan" msgstr "galicien" #: src/translate-rfc3066-private.h:165 msgid "Manx" msgstr "manx; mannois" #: src/translate-rfc3066-private.h:166 msgid "German, Middle High (ca.1050-1500)" msgstr "allemand, moyen haut (ca. 1050-1500)" #: src/translate-rfc3066-private.h:167 msgid "German, Old High (ca.750-1050)" msgstr "allemand, vieux haut (ca. 750-1050)" #: src/translate-rfc3066-private.h:168 msgid "Gondi" msgstr "gond" #: src/translate-rfc3066-private.h:169 msgid "Gorontalo" msgstr "gorontalo" #: src/translate-rfc3066-private.h:170 msgid "Gothic" msgstr "gothique" #: src/translate-rfc3066-private.h:171 msgid "Grebo" msgstr "grebo" #: src/translate-rfc3066-private.h:172 msgid "Greek, Ancient (to 1453)" msgstr "grec ancien (jusqu'à 1453)" #: src/translate-rfc3066-private.h:173 msgid "Greek, Modern (1453-)" msgstr "grec moderne (après 1453)" #: src/translate-rfc3066-private.h:174 msgid "Guarani" msgstr "guarani" #: src/translate-rfc3066-private.h:175 msgid "Gujarati" msgstr "goudjrati" #: src/translate-rfc3066-private.h:176 msgid "Gwich´in" msgstr "gwich´in" #: src/translate-rfc3066-private.h:177 msgid "Haida" msgstr "haida" #: src/translate-rfc3066-private.h:178 msgid "Haitian; Haitian Creole" msgstr "haïtien; créole haïtien" #: src/translate-rfc3066-private.h:179 msgid "Hausa" msgstr "haoussa" #: src/translate-rfc3066-private.h:180 msgid "Hawaiian" msgstr "hawaïen" #: src/translate-rfc3066-private.h:181 msgid "Hebrew" msgstr "hébreu" #: src/translate-rfc3066-private.h:182 msgid "Herero" msgstr "herero" #: src/translate-rfc3066-private.h:183 msgid "Hiligaynon" msgstr "hiligaynon" #: src/translate-rfc3066-private.h:184 msgid "Himachali" msgstr "himachali" #: src/translate-rfc3066-private.h:185 msgid "Hindi" msgstr "hindi" #: src/translate-rfc3066-private.h:186 msgid "Hittite" msgstr "hittite" #: src/translate-rfc3066-private.h:187 msgid "Hmong" msgstr "hmong" #: src/translate-rfc3066-private.h:188 msgid "Hiri Motu" msgstr "hiri motu" #: src/translate-rfc3066-private.h:189 msgid "Upper Sorbian" msgstr "haut-sorabe" #: src/translate-rfc3066-private.h:190 msgid "Hungarian" msgstr "hongrois" #: src/translate-rfc3066-private.h:191 msgid "Hupa" msgstr "hupa" #: src/translate-rfc3066-private.h:192 msgid "Iban" msgstr "iban" #: src/translate-rfc3066-private.h:193 msgid "Igbo" msgstr "igbo" #: src/translate-rfc3066-private.h:194 msgid "Icelandic" msgstr "islandais" #: src/translate-rfc3066-private.h:195 msgid "Ido" msgstr "ido" #: src/translate-rfc3066-private.h:196 msgid "Sichuan Yi" msgstr "yi de Sichuan" #: src/translate-rfc3066-private.h:197 msgid "Ijo" msgstr "ijo" #: src/translate-rfc3066-private.h:198 msgid "Inuktitut" msgstr "inuktitut" #: src/translate-rfc3066-private.h:199 msgid "Interlingue" msgstr "interlingue" #: src/translate-rfc3066-private.h:200 msgid "Iloko" msgstr "ilocano" #: src/translate-rfc3066-private.h:201 msgid "Interlingua (International Auxiliary Language Association)" msgstr "interlingua (langue auxiliaire internationale)" #: src/translate-rfc3066-private.h:202 msgid "Indic (Other)" msgstr "indo-aryennes, autres langues" #: src/translate-rfc3066-private.h:203 msgid "Indonesian" msgstr "indonésien" #: src/translate-rfc3066-private.h:204 msgid "Indo-European (Other)" msgstr "indo-européennes, autres langues" #: src/translate-rfc3066-private.h:205 msgid "Ingush" msgstr "ingouche" #: src/translate-rfc3066-private.h:206 msgid "Inupiaq" msgstr "inupiaq" #: src/translate-rfc3066-private.h:207 msgid "Iranian (Other)" msgstr "iraniennes, autres langues" #: src/translate-rfc3066-private.h:208 msgid "Iroquoian languages" msgstr "iroquoises, langues (famille)" #: src/translate-rfc3066-private.h:209 msgid "Italian" msgstr "italien" #: src/translate-rfc3066-private.h:210 msgid "Javanese" msgstr "javanais" #: src/translate-rfc3066-private.h:211 msgid "Lojban" msgstr "lojban" #: src/translate-rfc3066-private.h:212 msgid "Japanese" msgstr "japonais" #: src/translate-rfc3066-private.h:213 msgid "Judeo-Persian" msgstr "judéo-persan" #: src/translate-rfc3066-private.h:214 msgid "Judeo-Arabic" msgstr "judéo-arabe" #: src/translate-rfc3066-private.h:215 msgid "Kara-Kalpak" msgstr "karakalpak" #: src/translate-rfc3066-private.h:216 msgid "Kabyle" msgstr "kabyle" #: src/translate-rfc3066-private.h:217 msgid "Kachin" msgstr "kachin" #: src/translate-rfc3066-private.h:218 msgid "Kalaallisut; Greenlandic" msgstr "groenlandais" #: src/translate-rfc3066-private.h:219 msgid "Kamba" msgstr "kamba" #: src/translate-rfc3066-private.h:220 msgid "Kannada" msgstr "kannada" #: src/translate-rfc3066-private.h:221 msgid "Karen" msgstr "karen" #: src/translate-rfc3066-private.h:222 msgid "Kashmiri" msgstr "kashmiri" #: src/translate-rfc3066-private.h:223 msgid "Kanuri" msgstr "kanouri" #: src/translate-rfc3066-private.h:224 msgid "Kawi" msgstr "kawi" #: src/translate-rfc3066-private.h:225 msgid "Kazakh" msgstr "kazakh" #: src/translate-rfc3066-private.h:226 msgid "Kabardian" msgstr "kabardien" #: src/translate-rfc3066-private.h:227 msgid "Khasi" msgstr "khasi" #: src/translate-rfc3066-private.h:228 msgid "Khoisan (Other)" msgstr "khoisan, autres langues" #: src/translate-rfc3066-private.h:229 msgid "Khmer" msgstr "khmer" #: src/translate-rfc3066-private.h:230 msgid "Khotanese" msgstr "khotanais" #: src/translate-rfc3066-private.h:231 msgid "Kikuyu; Gikuyu" msgstr "kikuyu" #: src/translate-rfc3066-private.h:232 msgid "Kinyarwanda" msgstr "rwanda" #: src/translate-rfc3066-private.h:233 msgid "Kirghiz" msgstr "kirghize" #: src/translate-rfc3066-private.h:234 msgid "Kimbundu" msgstr "kimbundu" #: src/translate-rfc3066-private.h:235 msgid "Konkani" msgstr "konkani" #: src/translate-rfc3066-private.h:236 msgid "Komi" msgstr "kom" #: src/translate-rfc3066-private.h:237 msgid "Kongo" msgstr "kongo" #: src/translate-rfc3066-private.h:238 msgid "Korean" msgstr "coréen" #: src/translate-rfc3066-private.h:239 msgid "Kosraean" msgstr "kosrae" #: src/translate-rfc3066-private.h:240 msgid "Kpelle" msgstr "kpellé" #: src/translate-rfc3066-private.h:241 msgid "Karachay-Balkar" msgstr "karatchai balkar" #: src/translate-rfc3066-private.h:242 msgid "Kru" msgstr "krou" #: src/translate-rfc3066-private.h:243 msgid "Kurukh" msgstr "kurukh" #: src/translate-rfc3066-private.h:244 msgid "Kuanyama; Kwanyama" msgstr "kuanyama; kwanyama" #: src/translate-rfc3066-private.h:245 msgid "Kumyk" msgstr "koumyk" #: src/translate-rfc3066-private.h:246 msgid "Kurdish" msgstr "kurde" #: src/translate-rfc3066-private.h:247 msgid "Kutenai" msgstr "kutenai" #: src/translate-rfc3066-private.h:248 msgid "Ladino" msgstr "judéo-espagnol" #: src/translate-rfc3066-private.h:249 msgid "Lahnda" msgstr "lahnda" #: src/translate-rfc3066-private.h:250 msgid "Lamba" msgstr "lamba" #: src/translate-rfc3066-private.h:251 msgid "Lao" msgstr "lao" #: src/translate-rfc3066-private.h:252 msgid "Latin" msgstr "latin" #: src/translate-rfc3066-private.h:253 msgid "Latvian" msgstr "letton" #: src/translate-rfc3066-private.h:254 msgid "Lezghian" msgstr "lezghien" #: src/translate-rfc3066-private.h:255 msgid "Limburgan; Limburger; Limburgish" msgstr "limbourgeois" #: src/translate-rfc3066-private.h:256 msgid "Lingala" msgstr "lingala" #: src/translate-rfc3066-private.h:257 msgid "Lithuanian" msgstr "lituanien" #: src/translate-rfc3066-private.h:258 msgid "Mongo" msgstr "mongo" #: src/translate-rfc3066-private.h:259 msgid "Lozi" msgstr "lozi" #: src/translate-rfc3066-private.h:260 msgid "Luxembourgish; Letzeburgesch" msgstr "luxembourgeois" #: src/translate-rfc3066-private.h:261 msgid "Luba-Lulua" msgstr "luba-lulua" #: src/translate-rfc3066-private.h:262 msgid "Luba-Katanga" msgstr "luba-katanga" #: src/translate-rfc3066-private.h:263 msgid "Ganda" msgstr "ganda" #: src/translate-rfc3066-private.h:264 msgid "Luiseno" msgstr "luiseno" #: src/translate-rfc3066-private.h:265 msgid "Lunda" msgstr "lunda" #: src/translate-rfc3066-private.h:266 msgid "Luo (Kenya and Tanzania)" msgstr "luo (Kenya et Tanzanie)" #: src/translate-rfc3066-private.h:267 msgid "lushai" msgstr "Lushai" #: src/translate-rfc3066-private.h:268 msgid "Macedonian" msgstr "macédonien" #: src/translate-rfc3066-private.h:269 msgid "Madurese" msgstr "madourais" #: src/translate-rfc3066-private.h:270 msgid "Magahi" msgstr "magahi" #: src/translate-rfc3066-private.h:271 msgid "Marshallese" msgstr "marshall" #: src/translate-rfc3066-private.h:272 msgid "Maithili" msgstr "maithili" #: src/translate-rfc3066-private.h:273 msgid "Makasar" msgstr "makassar" #: src/translate-rfc3066-private.h:274 msgid "Malayalam" msgstr "malayalam" #: src/translate-rfc3066-private.h:275 msgid "Mandingo" msgstr "mandingue" #: src/translate-rfc3066-private.h:276 msgid "Maori" msgstr "maori" #: src/translate-rfc3066-private.h:277 msgid "Austronesian (Other)" msgstr "malayo-polynésiennes, autres langues" #: src/translate-rfc3066-private.h:278 msgid "Marathi" msgstr "marathe" #: src/translate-rfc3066-private.h:279 msgid "Masai" msgstr "massaï" #: src/translate-rfc3066-private.h:280 msgid "Malay" msgstr "malais" #: src/translate-rfc3066-private.h:281 msgid "Moksha" msgstr "moksa" #: src/translate-rfc3066-private.h:282 msgid "Mandar" msgstr "mandar" #: src/translate-rfc3066-private.h:283 msgid "Mende" msgstr "mendé" #: src/translate-rfc3066-private.h:284 msgid "Irish, Middle (900-1200)" msgstr "irlandais moyen (900-1200)" #: src/translate-rfc3066-private.h:285 msgid "Mi'kmaq; Micmac" msgstr "mi'kmaq; micmac" #: src/translate-rfc3066-private.h:286 msgid "Minangkabau" msgstr "minangkabau" #: src/translate-rfc3066-private.h:287 msgid "Miscellaneous languages" msgstr "diverses, langues" #: src/translate-rfc3066-private.h:288 msgid "Mon-Khmer (Other)" msgstr "môn-khmer, autres langues" #: src/translate-rfc3066-private.h:289 msgid "Malagasy" msgstr "malgache" #: src/translate-rfc3066-private.h:290 msgid "Maltese" msgstr "maltais" #: src/translate-rfc3066-private.h:291 msgid "Manchu" msgstr "mandchou" #: src/translate-rfc3066-private.h:292 msgid "Manipuri" msgstr "manipuri" #: src/translate-rfc3066-private.h:293 msgid "Manobo languages" msgstr "manobo, langues" #: src/translate-rfc3066-private.h:294 msgid "Mohawk" msgstr "mohawk" #: src/translate-rfc3066-private.h:295 msgid "Moldavian" msgstr "moldave" #: src/translate-rfc3066-private.h:296 msgid "Mongolian" msgstr "mongol" #: src/translate-rfc3066-private.h:297 msgid "Mossi" msgstr "moré" #: src/translate-rfc3066-private.h:298 msgid "Multiple languages" msgstr "multilingue" #: src/translate-rfc3066-private.h:299 msgid "Munda languages" msgstr "mounda, langues" #: src/translate-rfc3066-private.h:300 msgid "Creek" msgstr "muskogee" #: src/translate-rfc3066-private.h:301 msgid "Mirandese" msgstr "mirandais" #: src/translate-rfc3066-private.h:302 msgid "Marwari" msgstr "marvari" #: src/translate-rfc3066-private.h:303 msgid "Mayan languages" msgstr "maya, langues" #: src/translate-rfc3066-private.h:304 msgid "Erzya" msgstr "erza" #: src/translate-rfc3066-private.h:305 msgid "Nahuatl" msgstr "nahuatl" #: src/translate-rfc3066-private.h:306 msgid "North American Indian" msgstr "indiennes d'Amérique du Nord, autres langues" #: src/translate-rfc3066-private.h:307 msgid "Neapolitan" msgstr "napolitain" #: src/translate-rfc3066-private.h:308 msgid "Nauru" msgstr "nauruan" #: src/translate-rfc3066-private.h:309 msgid "Navajo; Navaho" msgstr "navaho" #: src/translate-rfc3066-private.h:310 msgid "Ndebele, South; South Ndebele" msgstr "ndébélé du Sud" #: src/translate-rfc3066-private.h:311 msgid "Ndebele, North; North Ndebele" msgstr "ndébélé du Nord" #: src/translate-rfc3066-private.h:312 msgid "Ndonga" msgstr "ndonga" #: src/translate-rfc3066-private.h:313 msgid "Low German; Low Saxon; German, Low; Saxon, Low" msgstr "bas allemand; bas saxon; allemand, bas; saxon, bas" #: src/translate-rfc3066-private.h:314 msgid "Nepali" msgstr "népalais" #: src/translate-rfc3066-private.h:315 msgid "Nepal Bhasa; Newari" msgstr "nepal bhasa; newari" #: src/translate-rfc3066-private.h:316 msgid "Nias" msgstr "nias" #: src/translate-rfc3066-private.h:317 msgid "Niger-Kordofanian (Other)" msgstr "nigéro-congolaises, autres langues" #: src/translate-rfc3066-private.h:318 msgid "Niuean" msgstr "niué" #: src/translate-rfc3066-private.h:319 msgid "Norwegian Nynorsk" msgstr "norvégien nynorsk" #: src/translate-rfc3066-private.h:320 msgid "Norwegian Bokmål" msgstr "norvégien bokmål" #: src/translate-rfc3066-private.h:321 msgid "Nogai" msgstr "nogaï; nogay" #: src/translate-rfc3066-private.h:322 msgid "Norse, Old" msgstr "norrois, vieux" #: src/translate-rfc3066-private.h:323 msgid "Norwegian" msgstr "norvégien" #: src/translate-rfc3066-private.h:324 msgid "Northern Sotho; Pedi; Sepedi" msgstr "sotho du Nord; pedi; sepedi" #: src/translate-rfc3066-private.h:325 msgid "Nubian languages" msgstr "nubiennes, langues" #: src/translate-rfc3066-private.h:326 msgid "Classical Newari; Old Newari; Classical Nepal Bhasa" msgstr "newari classique" #: src/translate-rfc3066-private.h:327 msgid "Chichewa; Chewa; Nyanja" msgstr "chichewa; chewa; nyanja" #: src/translate-rfc3066-private.h:328 msgid "Nyamwezi" msgstr "nyamwezi" #: src/translate-rfc3066-private.h:329 msgid "Nyankole" msgstr "nyankolé" #: src/translate-rfc3066-private.h:330 msgid "Nyoro" msgstr "nyoro" #: src/translate-rfc3066-private.h:331 msgid "Nzima" msgstr "nzema" #: src/translate-rfc3066-private.h:332 msgid "Occitan (post 1500); Provençal" msgstr "occitan (après 1500); provençal" #: src/translate-rfc3066-private.h:333 msgid "Ojibwa" msgstr "ojibwa" #: src/translate-rfc3066-private.h:334 msgid "Oriya" msgstr "oriya" #: src/translate-rfc3066-private.h:335 msgid "Oromo" msgstr "galla" #: src/translate-rfc3066-private.h:336 msgid "Osage" msgstr "osage" #: src/translate-rfc3066-private.h:337 msgid "Ossetian; Ossetic" msgstr "ossète" #: src/translate-rfc3066-private.h:338 msgid "Turkish, Ottoman (1500-1928)" msgstr "turc ottoman (1500-1928)" #: src/translate-rfc3066-private.h:339 msgid "Otomian languages" msgstr "otomangue, langues" #: src/translate-rfc3066-private.h:340 msgid "Papuan (Other)" msgstr "papoues, autres langues" #: src/translate-rfc3066-private.h:341 msgid "Pangasinan" msgstr "pangasinan" #: src/translate-rfc3066-private.h:342 msgid "Pahlavi" msgstr "pahlavi" #: src/translate-rfc3066-private.h:343 msgid "Pampanga" msgstr "pampangan" #: src/translate-rfc3066-private.h:344 msgid "Panjabi; Punjabi" msgstr "pendjabi" #: src/translate-rfc3066-private.h:345 msgid "Papiamento" msgstr "papiamento" #: src/translate-rfc3066-private.h:346 msgid "Palauan" msgstr "palau" #: src/translate-rfc3066-private.h:347 msgid "Persian, Old (ca.600-400 B.C.)" msgstr "perse, vieux (ca. 600-400 av. J.-C.)" #: src/translate-rfc3066-private.h:348 msgid "Persian" msgstr "persan" #: src/translate-rfc3066-private.h:349 msgid "Philippine (Other)" msgstr "philippines, autres langues" #: src/translate-rfc3066-private.h:350 msgid "Phoenician" msgstr "phénicien" #: src/translate-rfc3066-private.h:351 msgid "Pali" msgstr "pali" #: src/translate-rfc3066-private.h:352 msgid "Polish" msgstr "polonais" #: src/translate-rfc3066-private.h:353 msgid "Pohnpeian" msgstr "pohnpei" #: src/translate-rfc3066-private.h:354 msgid "Portuguese" msgstr "portugais" #: src/translate-rfc3066-private.h:355 msgid "Prakrit languages" msgstr "prâkrit" #: src/translate-rfc3066-private.h:356 msgid "Provençal, Old (to 1500)" msgstr "provençal ancien (jusqu'à 1500)" #: src/translate-rfc3066-private.h:357 msgid "Pushto" msgstr "pachto" #: src/translate-rfc3066-private.h:358 msgid "Reserved for local use" msgstr "réservée à l'usage local" #: src/translate-rfc3066-private.h:359 msgid "Quechua" msgstr "quechua" #: src/translate-rfc3066-private.h:360 msgid "Rajasthani" msgstr "rajasthani" #: src/translate-rfc3066-private.h:361 msgid "Rapanui" msgstr "rapanui" #: src/translate-rfc3066-private.h:362 msgid "Rarotongan" msgstr "rarotonga" #: src/translate-rfc3066-private.h:363 msgid "Romance (Other)" msgstr "romanes, autres langues" #: src/translate-rfc3066-private.h:364 msgid "Raeto-Romance" msgstr "rhéto-roman" #: src/translate-rfc3066-private.h:365 msgid "Romany" msgstr "tsigane" #: src/translate-rfc3066-private.h:366 msgid "Romanian" msgstr "roumain" #: src/translate-rfc3066-private.h:367 msgid "Rundi" msgstr "rundi" #: src/translate-rfc3066-private.h:368 msgid "Russian" msgstr "russe" #: src/translate-rfc3066-private.h:369 msgid "Sandawe" msgstr "sandawe" #: src/translate-rfc3066-private.h:370 msgid "Sango" msgstr "sango" #: src/translate-rfc3066-private.h:371 msgid "Yakut" msgstr "iakoute" #: src/translate-rfc3066-private.h:372 msgid "South American Indian (Other)" msgstr "indiennes d'Amérique du Sud, autres langues" #: src/translate-rfc3066-private.h:373 msgid "Salishan languages" msgstr "salish, langues" #: src/translate-rfc3066-private.h:374 msgid "Samaritan Aramaic" msgstr "samaritain" #: src/translate-rfc3066-private.h:375 msgid "Sanskrit" msgstr "sanskrit" #: src/translate-rfc3066-private.h:376 msgid "Sasak" msgstr "sasak" #: src/translate-rfc3066-private.h:377 msgid "Santali" msgstr "santal" #: src/translate-rfc3066-private.h:378 msgid "Serbian" msgstr "serbe" #: src/translate-rfc3066-private.h:379 msgid "Sicilian" msgstr "sicilien" #: src/translate-rfc3066-private.h:380 msgid "Scots" msgstr "écossais" #: src/translate-rfc3066-private.h:381 msgid "Croatian" msgstr "croate" #: src/translate-rfc3066-private.h:382 msgid "Selkup" msgstr "selkoupe" #: src/translate-rfc3066-private.h:383 msgid "Semitic (Other)" msgstr "sémitiques, autres langues" #: src/translate-rfc3066-private.h:384 msgid "Irish, Old (to 900)" msgstr "irlandais ancien (jusqu'à 900)" #: src/translate-rfc3066-private.h:385 msgid "Sign Languages" msgstr "langues des signes" #: src/translate-rfc3066-private.h:386 msgid "Shan" msgstr "chan" #: src/translate-rfc3066-private.h:387 msgid "Sidamo" msgstr "sidamo" #: src/translate-rfc3066-private.h:388 msgid "Sinhala; Sinhalese" msgstr "singhalais" #: src/translate-rfc3066-private.h:389 msgid "Siouan languages" msgstr "sioux, langues" #: src/translate-rfc3066-private.h:390 msgid "Sino-Tibetan (Other)" msgstr "sino-tibétaines, autres langues" #: src/translate-rfc3066-private.h:391 msgid "Slavic (Other)" msgstr "slaves, autres langues" #: src/translate-rfc3066-private.h:392 msgid "Slovak" msgstr "slovaque" #: src/translate-rfc3066-private.h:393 msgid "Slovenian" msgstr "slovène" #: src/translate-rfc3066-private.h:394 msgid "Southern Sami" msgstr "sami du Sud" #: src/translate-rfc3066-private.h:395 msgid "Northern Sami" msgstr "sami du Nord" #: src/translate-rfc3066-private.h:396 msgid "Sami languages (Other)" msgstr "sami, autres langues" #: src/translate-rfc3066-private.h:397 msgid "Lule Sami" msgstr "sami de Lule" #: src/translate-rfc3066-private.h:398 msgid "Inari Sami" msgstr "sami d'Inari" #: src/translate-rfc3066-private.h:399 msgid "Samoan" msgstr "samoan" #: src/translate-rfc3066-private.h:400 msgid "Skolt Sami" msgstr "sami skolt" #: src/translate-rfc3066-private.h:401 msgid "Shona" msgstr "shona" #: src/translate-rfc3066-private.h:402 msgid "Sindhi" msgstr "sindhi" #: src/translate-rfc3066-private.h:403 msgid "Soninke" msgstr "soninké" #: src/translate-rfc3066-private.h:404 msgid "Sogdian" msgstr "sogdien" #: src/translate-rfc3066-private.h:405 msgid "Somali" msgstr "somali" #: src/translate-rfc3066-private.h:406 msgid "Songhai" msgstr "songhai" #: src/translate-rfc3066-private.h:407 msgid "Sotho, Southern" msgstr "sotho du Sud" #: src/translate-rfc3066-private.h:408 msgid "Spanish; Castilian" msgstr "espagnol; castillan" #: src/translate-rfc3066-private.h:409 msgid "Sardinian" msgstr "sarde" #: src/translate-rfc3066-private.h:410 msgid "Serer" msgstr "sérère" #: src/translate-rfc3066-private.h:411 msgid "Nilo-Saharan (Other)" msgstr "nilo-sahariennes, autres langues" #: src/translate-rfc3066-private.h:412 msgid "Swati" msgstr "swati" #: src/translate-rfc3066-private.h:413 msgid "Sukuma" msgstr "sukuma" #: src/translate-rfc3066-private.h:414 msgid "Sundanese" msgstr "soundanais" #: src/translate-rfc3066-private.h:415 msgid "Susu" msgstr "soussou" #: src/translate-rfc3066-private.h:416 msgid "Sumerian" msgstr "sumérien" #: src/translate-rfc3066-private.h:417 msgid "Swahili" msgstr "swahili" #: src/translate-rfc3066-private.h:418 msgid "Swedish" msgstr "suédois" #: src/translate-rfc3066-private.h:419 msgid "Syriac" msgstr "syriaque" #: src/translate-rfc3066-private.h:420 msgid "Tahitian" msgstr "tahitien" #: src/translate-rfc3066-private.h:421 msgid "Tai (Other)" msgstr "thaïes, autres langues" #: src/translate-rfc3066-private.h:422 msgid "Tamil" msgstr "tamoul" #: src/translate-rfc3066-private.h:423 msgid "Tatar" msgstr "tatar" #: src/translate-rfc3066-private.h:424 msgid "Telugu" msgstr "télougou" #: src/translate-rfc3066-private.h:425 msgid "Timne" msgstr "temne" #: src/translate-rfc3066-private.h:426 msgid "Tereno" msgstr "tereno" #: src/translate-rfc3066-private.h:427 msgid "Tetum" msgstr "tetum" #: src/translate-rfc3066-private.h:428 msgid "Tajik" msgstr "tadjik" #: src/translate-rfc3066-private.h:429 msgid "Tagalog" msgstr "tagalog" #: src/translate-rfc3066-private.h:430 msgid "Thai" msgstr "thaï" #: src/translate-rfc3066-private.h:431 msgid "Tibetan" msgstr "tibétain" #: src/translate-rfc3066-private.h:432 msgid "Tigre" msgstr "tigré" #: src/translate-rfc3066-private.h:433 msgid "Tigrinya" msgstr "tigrigna" #: src/translate-rfc3066-private.h:434 msgid "Tiv" msgstr "tiv" #: src/translate-rfc3066-private.h:435 msgid "Tokelau" msgstr "tokelau" #: src/translate-rfc3066-private.h:436 msgid "Klingon; tlhIngan-Hol" msgstr "klingon" #: src/translate-rfc3066-private.h:437 msgid "Tlingit" msgstr "tlingit" #: src/translate-rfc3066-private.h:438 msgid "Tamashek" msgstr "tamacheq" #: src/translate-rfc3066-private.h:439 msgid "Tonga (Nyasa)" msgstr "tonga (Nyasa)" #: src/translate-rfc3066-private.h:440 msgid "Tonga (Tonga Islands)" msgstr "tongan (Îles Tonga)" #: src/translate-rfc3066-private.h:441 msgid "Tok Pisin" msgstr "tok pisin" #: src/translate-rfc3066-private.h:442 msgid "Tsimshian" msgstr "tsimshian" #: src/translate-rfc3066-private.h:443 msgid "Tswana" msgstr "tswana" #: src/translate-rfc3066-private.h:444 msgid "Tsonga" msgstr "tsonga" #: src/translate-rfc3066-private.h:445 msgid "Turkmen" msgstr "turkmène" #: src/translate-rfc3066-private.h:446 msgid "Tumbuka" msgstr "tumbuka" #: src/translate-rfc3066-private.h:447 msgid "Tupi languages" msgstr "tupi, langues" #: src/translate-rfc3066-private.h:448 msgid "Turkish" msgstr "turc" #: src/translate-rfc3066-private.h:449 msgid "Altaic (Other)" msgstr "altaïques, autres langues" #: src/translate-rfc3066-private.h:450 msgid "Tuvalu" msgstr "tuvalu" #: src/translate-rfc3066-private.h:451 msgid "Twi" msgstr "twi" #: src/translate-rfc3066-private.h:452 msgid "Tuvinian" msgstr "touva" #: src/translate-rfc3066-private.h:453 msgid "Udmurt" msgstr "oudmourte" #: src/translate-rfc3066-private.h:454 msgid "Ugaritic" msgstr "ougaritique" #: src/translate-rfc3066-private.h:455 msgid "Uighur; Uyghur" msgstr "ouïgour" #: src/translate-rfc3066-private.h:456 msgid "Ukrainian" msgstr "ukrainien" #: src/translate-rfc3066-private.h:457 msgid "Umbundu" msgstr "umbundu" #: src/translate-rfc3066-private.h:458 msgid "Undetermined" msgstr "indéterminée" #: src/translate-rfc3066-private.h:459 msgid "Urdu" msgstr "ourdou" #: src/translate-rfc3066-private.h:460 msgid "Uzbek" msgstr "ouszbek" #: src/translate-rfc3066-private.h:461 msgid "Vai" msgstr "vaï" #: src/translate-rfc3066-private.h:462 msgid "Venda" msgstr "venda" #: src/translate-rfc3066-private.h:463 msgid "Vietnamese" msgstr "vietnamien" #: src/translate-rfc3066-private.h:464 msgid "Volapük" msgstr "volapük" #: src/translate-rfc3066-private.h:465 msgid "Votic" msgstr "vote" #: src/translate-rfc3066-private.h:466 msgid "Wakashan languages" msgstr "wakashennes, langues" #: src/translate-rfc3066-private.h:467 msgid "Walamo" msgstr "walamo" #: src/translate-rfc3066-private.h:468 msgid "Waray" msgstr "waray" #: src/translate-rfc3066-private.h:469 msgid "Washo" msgstr "washo" #: src/translate-rfc3066-private.h:470 msgid "Welsh" msgstr "gallois" #: src/translate-rfc3066-private.h:471 msgid "Sorbian languages" msgstr "sorabes, langues" #: src/translate-rfc3066-private.h:472 msgid "Walloon" msgstr "wallon" #: src/translate-rfc3066-private.h:473 msgid "Wolof" msgstr "wolof" #: src/translate-rfc3066-private.h:474 msgid "Kalmyk" msgstr "kalmouk" #: src/translate-rfc3066-private.h:475 msgid "Xhosa" msgstr "xhosa" #: src/translate-rfc3066-private.h:476 msgid "Yao" msgstr "yao" #: src/translate-rfc3066-private.h:477 msgid "Yapese" msgstr "yapois" #: src/translate-rfc3066-private.h:478 msgid "Yiddish" msgstr "yiddish" #: src/translate-rfc3066-private.h:479 msgid "Yoruba" msgstr "yoruba" #: src/translate-rfc3066-private.h:480 msgid "Yupik languages" msgstr "yupik, langues" #: src/translate-rfc3066-private.h:481 msgid "Zapotec" msgstr "zapotèque" #: src/translate-rfc3066-private.h:482 msgid "Zenaga" msgstr "zenaga" #: src/translate-rfc3066-private.h:483 msgid "Zhuang; Chuang" msgstr "zhuang; chuang" #: src/translate-rfc3066-private.h:484 msgid "Zande" msgstr "zandé" #: src/translate-rfc3066-private.h:485 msgid "Zulu" msgstr "zoulou" #: src/translate-rfc3066-private.h:486 msgid "Zuni" msgstr "zuni" libtranslate-0.99/po/fr.gmo000644 001750 001750 00000072647 10176431053 017446 0ustar00jylefortjylefort000000 000000 4\#0/1/@/(W//<0n1!o1$111'1)2 <2F2O2U2]2l2q2 z22222222222 23 3 33&3/3B3K3[3p333333 3333333 4444&484 =4H4N4V4e4n4u4{44 44444 444444445525;5L5U5]5f5o5w5555 55P56#63+6_6f6n6w6|66*6)6-6!7@7I7Z7`7g7n7u7{7777777777777 888 8-8I8d8 j8t8}888888888888899#9,91979:9R9[9a9f9l9q9z9"999 99 9999:+:3: <:F:L:d:j:s:z: : :: ::: ::: ::::: : :: ;;:&; a; m;w;;;;;;;;; ; ; <<<#<<<C<I<Q< X<d<t<z< <<<<<< <<< <<<== ===$=+=/=B=H=P=W=_=f=m=s=w=}== ==!== =>.> 6>D> I> V>a> i>s>y>> >>>>>>> >>>? ???-?2?8?@? E?Q?Y?_?t????? ? ???@ @@&@ ,@6@<@O@_@g@l@r@@@@ @@@@@@A#A*A 0A;A QA_A |AAAAAAAAAAB BBBB-B?BGBMBUBZB cBnB BBBBB B BB BB C&C-C 5C CCNC VCaCxCCCCCCCCCCCCD DDDD%D5D=DCDLDQDWDfD DDDDDDDDD DDEE %E/E7E>EFENE`EpE EE E#E/E,$FQFmFtF }FFFFF FFFF FFFFFFFFF%G2*G']G)GGGWG0OHHH+H HHI IIII%I (I2I :IHI ^IhIoIvI~IIIIIIIIII II I JJJ%J)J /J:JCJIJ\JcJkJqJwJ}JJJJJJJJJJJJJJ JKK6K'JK,rK0K/K LL%#LIL-PL~L L L#L-L1)M[M{MMMM)M/M, N%8N^N}NNNNNNO,O&IO)pO&O)OOP#PAPVP|_PQQ* R4RR`S) T37TkTT+T1TTU UUU!U&U /U9UYU^UgUpUyUU UUU UUUUU UUVV+VAV%XV~V VVVVVV VVVVV WWWW2W 8WDWJWRWlWuW|WW W W WWWWWWWWWWW XX./X ^XiXyX XXXXXXXX XX?X`G`N`W`_`c`i`q`y``````````````` `a(a1a PaZa2aa aa a aa aaaa a bbb$b-b6b =bGbObXb _bibrb bbbbbbbbbb ccc ,c 8cBcTc[cacicccc ccccccccc cd d#d (d#3d Wdxd ~dd-d dd dde#e6e ?eIeOe!Uewe~eeeeeeeeee e ee eef$f;f Wfbfjf sf}f!fff f ff fffgg%g+g1g AgLgaghgpgvgggg ggggggggg#g h)h2h9h LhVh ]h hhh hhhhhhhhhi i,i LiXi#li)i,i1ij5j nCn InTn]nbnwn~nnnnnnnnnnnnn nnnno o*o)Dono)o.o2o5pMp\p&xpp1pp&p%q)fqBqqrrr.r2?r9rr>r)r(s>s[s vs$s-s1st"6t0Yt:t2t6t/uJuiuuu0 R%*ye\3x14V^ n +&0D~e&a:PF#\#fo6a!5bOOMh*"tbY3d$gRJ4U `++k }'`$l|?U,Sm7d)]&EEhNWi; /W0 v(| >X/ *2!js 6L8."[G5p ]r4 gp)[PX@~^Amu{:K>zs wc-9{ J=o<GtQC_,flH -ku7B% ?DxBTCM8-A/(jS;QiYc}@)'TIw '212L q=<VNH.n$3.9FZ,"r%yK#1_qv!z(ZI%s version %s %s: around line %i: %s%s: service "%s" already exists, ignored%s: the TRANSLATE_PAIR_TEXT flag is set for %s->%s, but the translate_text method is not implemented (this indicates a programming error in the service implementation): unsetting the flag%s: the TRANSLATE_PAIR_WEB_PAGE flag is set for %s->%s, but the translate_web_page method is not implemented (this indicates a programming error in the service implementation): unsetting the flag%s: the get_pairs method is not implemented (this indicates a programming error in the service implementation)%s: unable to convert to "%s": %s%s: unable to get language pairs: %s%s: unknown modifier "%s"%s: unknown variable "%s"%s: value of "charset" modifier missing%s: value specified for "escape" modifierAbkhazianAchineseAcoliAdangmeAdyghe; AdygeiAfarAfrihiliAfrikaansAfro-Asiatic (Other)AkanAkkadianAlbanianAleutAlgonquian languagesAltaic (Other)AmharicApache languagesArabicAragoneseAramaicArapahoAraucanianArawakArmenianArtificial (Other)AssameseAsturian; BableAthapascan languagesAustralian languagesAustronesian (Other)AvaricAvestanAwadhiAymaraAzerbaijaniBalineseBaltic (Other)BaluchiBambaraBamileke languagesBandaBantu (Other)BasaBashkirBasqueBatak (Indonesia)BejaBelarusianBembaBengaliBerber (Other)BhojpuriBihariBikolBiniBislamaBlin; BilinBosnianBrajBretonBugineseBulgarianBuriatBurmeseCaddoCaribCatalan; ValencianCaucasian (Other)CebuanoCeltic (Other)Central American Indian (Other)ChagataiChamic languagesChamorroChechenCherokeeCheyenneChibchaChichewa; Chewa; NyanjaChineseChinese (Taiwan)Chinook jargonChipewyanChoctawChurch Slavic; Old Slavonic; Church Slavonic; Old Bulgarian; Old Church SlavonicChuukeseChuvashClassical Newari; Old Newari; Classical Nepal BhasaCopticCornishCorsicanCreeCreekCreoles and pidgins (Other)Creoles and pidgins, English based (Other)Creoles and pidgins, French-based (Other)Creoles and pidgins, Portuguese-based (Other)Crimean Tatar; Crimean TurkishCroatianCushitic (Other)CzechDakotaDanishDargwaDayakDelawareDinkaDivehiDogriDogribDravidian (Other)DualaDutch, Middle (ca.1050-1350)Dutch; FlemishDyulaDzongkhaEfikEgyptian (Ancient)EkajukElamiteEnglishEnglish (%s)English, Middle (1100-1500)English, Old (ca.450-1100)ErzyaEsperantoEstonianEweEwondoFangFantiFaroeseFijianFilipino; PilipinoFinnishFinno-Ugrian (Other)FlagsFonFrenchFrench, Middle (ca.1400-1800)French, Old (842-ca.1400)FrisianFriulianFromFulahGaGaelic; Scottish GaelicGalleganGandaGayoGbayaGeezGeorgianGermanGerman, Middle High (ca.1050-1500)German, Old High (ca.750-1050)Germanic (Other)GilberteseGondiGorontaloGothicGreboGreek, Ancient (to 1453)Greek, Modern (1453-)GuaraniGujaratiGwich´inHaidaHaitian; Haitian CreoleHausaHawaiianHebrewHereroHiligaynonHimachaliHindiHiri MotuHittiteHmongHungarianHupaIbanIcelandicIdoIgboIjoIlokoInari SamiIndic (Other)Indo-European (Other)IndonesianIngushInterlingua (International Auxiliary Language Association)InterlingueInuktitutInupiaqIranian (Other)IrishIrish, Middle (900-1200)Irish, Old (to 900)Iroquoian languagesItalianJapaneseJavaneseJudeo-ArabicJudeo-PersianKabardianKabyleKachinKalaallisut; GreenlandicKalmykKambaKannadaKanuriKara-KalpakKarachay-BalkarKarenKashmiriKashubianKawiKazakhKhasiKhmerKhoisan (Other)KhotaneseKikuyu; GikuyuKimbunduKinyarwandaKirghizKlingon; tlhIngan-HolKomiKongoKonkaniKoreanKosraeanKpelleKruKuanyama; KwanyamaKumykKurdishKurukhKutenaiLadinoLahndaLambaLaoLatinLatvianLezghianLimburgan; Limburger; LimburgishLingalaList the available language pairsList the available servicesLithuanianLojbanLow German; Low Saxon; German, Low; Saxon, LowLower SorbianLoziLuba-KatangaLuba-LuluaLuisenoLule SamiLundaLuo (Kenya and Tanzania)Luxembourgish; LetzeburgeschMacedonianMadureseMagahiMaithiliMakasarMalagasyMalayMalayalamMalteseManchuMandarMandingoManipuriManobo languagesManxMaoriMarathiMariMarshalleseMarwariMasaiMaximum chunk lengthMaximum number of retriesMaximum number of threadsMayan languagesMendeMi'kmaq; MicmacMinangkabauMirandeseMiscellaneous languagesMohawkMokshaMoldavianMon-Khmer (Other)MongoMongolianMossiMultiple languagesMunda languagesNahuatlNameNauruNavajo; NavahoNdebele, North; North NdebeleNdebele, South; South NdebeleNdongaNeapolitanNepal Bhasa; NewariNepaliNiasNickNiger-Kordofanian (Other)Nilo-Saharan (Other)NiueanNogaiNorse, OldNorth American IndianNorthern SamiNorthern Sotho; Pedi; SepediNorwegianNorwegian BokmålNorwegian NynorskNubian languagesNyamweziNyankoleNyoroNzimaOccitan (post 1500); ProvençalOjibwaOptions:OriyaOromoOsageOssetian; OsseticOtomian languagesPahlaviPairsPalauanPaliPampangaPangasinanPanjabi; PunjabiPapiamentoPapuan (Other)PersianPersian, Old (ca.600-400 B.C.)Philippine (Other)PhoenicianPohnpeianPolishPortuguesePrakrit languagesProvençal, Old (to 1500)PushtoQuechuaRaeto-RomanceRajasthaniRapanuiRarotonganReserved for local useRomance (Other)RomanianRomanyRundiRussianSalishan languagesSamaritan AramaicSami languages (Other)SamoanSandaweSangoSanskritSantaliSardinianSasakScotsSelkupSemitic (Other)SerbianSererServicesShanShonaShow this helpShow version informationSichuan YiSicilianSidamoSign LanguagesSiksikaSindhiSinhala; SinhaleseSino-Tibetan (Other)Siouan languagesSkolt SamiSlave (Athapascan)Slavic (Other)SlovakSlovenianSogdianSomaliSonghaiSoninkeSorbian languagesSotho, SouthernSouth American Indian (Other)Southern SamiSpanish; CastilianSpecify the destination languageSpecify the list of services to useSpecify the maximum number of retries per chunkSpecify the maximum number of threads to useSpecify the source languageSukumaSumerianSundaneseSusuSwahiliSwatiSwedishSynopsis:SyriacTagalogTahitianTai (Other)TajikTamashekTamilTatarTeluguTerenoTetumThaiThe destination language RFC 3066 tagThe list of language pairs this service implementsThe list of pairs this session supportsThe list of services used by this sessionThe maximum length of an input chunk, in characters (0 means unlimited)The maximum number of times to retry a translation of the same chunk (-1 for unlimited)The maximum number of translation threads to useThe pair flagsThe service human-readable nameThe service symbolic name, encoded in ASCIIThe source language RFC 3066 tagTibetanTigreTigrinyaTimneTivTlingitToTok PisinTokelauTonga (Nyasa)Tonga (Tonga Islands)TsimshianTsongaTswanaTumbukaTupi languagesTurkishTurkish, Ottoman (1500-1928)TurkmenTuvaluTuvinianTwiUdmurtUgariticUighur; UyghurUkrainianUmbunduUndeterminedUpper SorbianUrduUzbekVaiVendaVietnameseVolapükVoticWakashan languagesWalamoWalloonWarayWashoWelshWolofXhosaYakutYaoYapeseYiddishYorubaYupik languagesZandeZapotecZenagaZhuang; ChuangZuluZuniattribute "%s" already specifiedcancelled by usercannot get current time: %sconnecting to %s:%ielement "post-marker" already specifiedelement "text-translation" already specifiedelement "web-page-translation" already specifiedin %s, group %i, "%s" attribute of "%s" elementinvalid UTF-8invalid redirect URLlanguage "%s" already exists, ignoredlushaimax-chunk-len "%s" is not an unsigned integermax-chunk-len is emptymulti-threading is not supportedno service could translate chunkno service could translate web pageno service provides %s to %s text translationno service provides %s to %s web page translationrequired attribute "%s" missingserver failuretexttext, web pagetoo many argumentsunable to convert input text to UTF-8: %sunable to find translate_module_init() functionunable to get URL of translated web page: %sunable to initialize libtranslate: %sunable to load module "%s": %sunable to open "%s": %sunable to open %s: %sunable to parse %s: %sunable to parse URI "%s"unable to parse proxy URI "%s"unable to parse server dataunable to read %s: %sunable to read from "%s": %sunable to read from standard input: %sunable to scan modules directory "%s": %sunable to translate chunk using %s: %sunable to translate web page using %s: %sunable to translate: %sunknown attribute "%s", ignoredunknown element "%s", ignoredunknown service "%s"web pageProject-Id-Version: libtranslate 0.99 Report-Msgid-Bugs-To: POT-Creation-Date: 2005-01-28 13:38+0100 PO-Revision-Date: 2005-01-17 17:49+0100 Last-Translator: Jean-Yves Lefort Language-Team: Jean-Yves Lefort MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit Plural-Forms: nplurals=2; plural=n>1; %s version %s %s: autour de la ligne %i: %s%s: le service "%s" existe déjà, ignoré%s: le drapeau TRANSLATE_PAIR_TEXT est activé pour %s->%s, mais la méthode translate_text est absente (ceci indique une erreur de programmation dans le service): drapeau désactivé%s: le drapeau TRANSLATE_PAIR_WEB_PAGE est activé pour %s->%s, mais la méthode translate_web_page est absente (ceci indique une erreur de programmation dans le service): drapeau désactivé%s: la méthode get_pairs est absente (ceci indique une erreur de programmation dans le service)%s: impossible de convertir vers "%s": %s%s: impossible d'obtenir les paires de langages: %s%s: modifieur "%s" inconnu%s: variable "%s" inconnue%s: valeur du modifieur "charset" manquante%s: valeur spécifiée pour le modifieur "escape"abkhazeacehacoliadangmeadygheafarafrihiliafrikaansafro-asiatiques, autres languesakanakkadienalbanaisaléoutealgonquines, languesaltaïques, autres languesamhariqueapachearabearagonaisaraméenarapahoaraucanarawakarménienartificielles, autres languesassamaisasturien; bableathapascanes, languesaustraliennes, languesmalayo-polynésiennes, autres languesavaravestiqueawadhiaymaraazéribalinaisbaltiques, autres languesbaloutchibambarabamilékés, languesbandabantoues, autres languesbasabachkirbasquebatak (Indonésie)bedjabiélorussebembabengaliberbères, autres languesbhojpuribiharibikolbinibichlamarblin; bilenbosniaquebrajbretonbugibulgarebouriatebirmancaddocaribecatalan; valenciencaucasiennes, autres languescebuanoceltiques, autres languesindiennes d'Amérique centrale, autres languesdjaghataïchames, langueschamorrotchétchènecherokeecheyennechibchachichewa; chewa; nyanjachinoischinois (Taiwan)chinook, jargonchipewyanchoctawslavon d'église; vieux slave; slavon liturgique; vieux bulgarechuuktchouvachenewari classiquecoptecorniquecorsecreemuskogeecréoles et pidgins diverscréoles et pidgins anglais, autrescréoles et pidgins français, autrescréoles et pidgins portugais, autrestatar de Crimécroatecouchitiques, autres languestchèquedakotadanoisdargwadayakdelawaredinkamaldiviendogridogribdravidiennes, autres languesdoualanéerlandais moyen (ca. 1050-1350)néerlandais; flamanddiouladzongkhaefikégyptienekajukélamiteanglaisanglais (%s)anglais moyen (1100-1500)anglo-saxon (ca.450-1100)erzaespérantoestonienéwééwondofangfantiféroïenfidjienfilipino; pilipinofinnoisfinno-ougriennes, autres languesDrapeauxfonfrançaisfrançais moyen (1400-1800)français ancien (842-ca.1400)frisonfrioulanDepeulgagaélique; gaélique écossaisgaliciengandagayogbayaguèzegéorgienallemandallemand, moyen haut (ca. 1050-1500)allemand, vieux haut (ca. 750-1050)germaniques, autres langueskiribatigondgorontalogothiquegrebogrec ancien (jusqu'à 1453)grec moderne (après 1453)guaranigoudjratigwich´inhaidahaïtien; créole haïtienhaoussahawaïenhébreuhererohiligaynonhimachalihindihiri motuhittitehmonghongroishupaibanislandaisidoigboijoilocanosami d'Inariindo-aryennes, autres languesindo-européennes, autres languesindonésieningoucheinterlingua (langue auxiliaire internationale)interlingueinuktitutinupiaqiraniennes, autres languesirlandaisirlandais moyen (900-1200)irlandais ancien (jusqu'à 900)iroquoises, langues (famille)italienjaponaisjavanaisjudéo-arabejudéo-persankabardienkabylekachingroenlandaiskalmoukkambakannadakanourikarakalpakkaratchai balkarkarenkashmirikachoubekawikazakhkhasikhmerkhoisan, autres langueskhotanaiskikuyukimbundurwandakirghizeklingonkomkongokonkanicoréenkosraekpellékroukuanyama; kwanyamakoumykkurdekurukhkutenaijudéo-espagnollahndalambalaolatinlettonlezghienlimbourgeoislingalaListe les paires de langages disponiblesListe les services disponibleslituanienlojbanbas allemand; bas saxon; allemand, bas; saxon, basbas-sorabeloziluba-katangaluba-lulualuisenosami de Lulelundaluo (Kenya et Tanzanie)luxembourgeoismacédonienmadouraismagahimaithilimakassarmalgachemalaismalayalammaltaismandchoumandarmandinguemanipurimanobo, languesmanx; mannoismaorimarathemarimarshallmarvarimassaïLongueur de bloc maximumNombre maximum d'essaisNombre maximum de threadsmaya, languesmendémi'kmaq; micmacminangkabaumirandaisdiverses, languesmohawkmoksamoldavemôn-khmer, autres languesmongomongolmorémultilinguemounda, languesnahuatlNomnauruannavahondébélé du Nordndébélé du Sudndonganapolitainnepal bhasa; newarinépalaisniasPseudonymenigéro-congolaises, autres languesnilo-sahariennes, autres languesniuénogaï; nogaynorrois, vieuxindiennes d'Amérique du Nord, autres languessami du Nordsotho du Nord; pedi; sepedinorvégiennorvégien bokmålnorvégien nynorsknubiennes, languesnyamwezinyankolényoronzemaoccitan (après 1500); provençalojibwaOptions:oriyagallaosageossèteotomangue, languespahlaviPairespalaupalipampanganpangasinanpendjabipapiamentopapoues, autres languespersanperse, vieux (ca. 600-400 av. J.-C.)philippines, autres languesphénicienpohnpeipolonaisportugaisprâkritprovençal ancien (jusqu'à 1500)pachtoquechuarhéto-romanrajasthanirapanuirarotongaréservée à l'usage localromanes, autres languesroumaintsiganerundirussesalish, languessamaritainsami, autres languessamoansandawesangosanskritsantalsardesasakécossaisselkoupesémitiques, autres languesserbesérèreServiceschanshonaAffiche cette aideAffiche les informations de versionyi de Sichuansiciliensidamolangues des signesblackfootsindhisinghalaissino-tibétaines, autres languessioux, languessami skoltesclave (athapascan)slaves, autres languesslovaqueslovènesogdiensomalisonghaisoninkésorabes, languessotho du Sudindiennes d'Amérique du Sud, autres languessami du Sudespagnol; castillanSpecifie le language de destinationSpecifie la liste de services à utiliserSpecifie le nombre maximum d'essais par blocSpecifie le nombre maximum de threads à utiliserSpecifie le language sourcesukumasumériensoundanaissoussouswahiliswatisuédoisSynopsis:syriaquetagalogtahitienthaïes, autres languestadjiktamacheqtamoultatartélougouterenotetumthaïLe tag RFC 3066 du langage de destinationLa liste des paires de langages que ce service proposeLa liste des paires que cette session supporteLa liste des services utilisés par cette sessionLa longueur maximum d'un bloc d'entrée, en caractères (0 signifie non limité)Le nombre maximum d'essais de traduction pour le même bloc (-1 pour non limité)Le nombre maximum de threads de traduction à utiliserLes drapeaux de la paireLe nom du service lisible par des humainsLe nom symbolique du service, encodé en ASCIILe tag RFC 3066 du langage sourcetibétaintigrétigrignatemnetivtlingitVerstok pisintokelautonga (Nyasa)tongan (Îles Tonga)tsimshiantsongatswanatumbukatupi, languesturcturc ottoman (1500-1928)turkmènetuvalutouvatwioudmourteougaritiqueouïgourukrainienumbunduindéterminéehaut-sorabeourdououszbekvaïvendavietnamienvolapükvotewakashennes, langueswalamowallonwaraywashogalloiswolofxhosaiakouteyaoyapoisyiddishyorubayupik, langueszandézapotèquezenagazhuang; chuangzoulouzuniattribut "%s" déjà spécifiéannulé par l'utilisateurimpossible d'obtenir l'heure courante: %sconnection à %s:%i en coursélément "post-marker" déjà spécifiéélément "text-translation" déjà spécifiéélément "web-page-translation" déjà spécifiédans %s, groupe %i, attribut "%s" de l'élément "%s"UTF-8 invalideURL de redirection invalidele langage "%s" existe déjà, ignoréLushaimax-chunk-len "%s" n'est pas un entier non signémax-chunk-len est videle multi-threading n'est pas supportéaucun service n'a pu traduire le blocaucun service n'a pu traduire la page webaucun service ne propose une traduction de texte de %s vers %saucune service ne propose une traduction de page web de %s vers %sattribut requis "%s" manquantéchec du serveurtextetexte, page webtrop d'argumentsimpossible de convertir l'entrée vers l'UTF-8: %simpossible de trouver la fonction translate_module_init()impossible d'obtenir l'URL de la traduction de la page web: %simpossible d'initialiser libtranslate: %simpossible de charger le module "%s": %simpossible d'ouvrir "%s": %simpossible d'ouvrir %s: %simpossible d'interpréter %s: %simpossible d'interpréter l'URI "%s"impossible d'interpréter l'URI de proxy "%s"impossible d'interpréter les données du serveurimpossible de lire %s: %simpossible de lire depuis "%s": %simpossible de lire depuis l'entrée standard: %simpossible de parcourir le répertoire de modules "%s": %simpossible de traduire le bloc en utilisant %s: %simpossible de traduire la page web en utilisant %s: %simpossible de traduire: %sattribut "%s" inconnu, ignoréélément "%s" inconnu, ignoréservice "%s" inconnupage weblibtranslate-0.99/README000644 001750 001750 00000002213 10172766273 016566 0ustar00jylefortjylefort000000 000000 =============================================================================== libtranslate overview =============================================================================== Index 0. About this document 1. About libtranslate 2. Installation instructions 0. About this document $Id: README,v 1.2 2005/01/17 16:50:03 jylefort Exp $ Copyright (C) 2005 Jean-Yves Lefort. This document is part of libtranslate. It may be distributed under the same terms as libtranslate. 1. About libtranslate libtranslate is a library for translating text and web pages between natural languages. Its modular infrastructure allows to implement new translation services separately from the core library. libtranslate is shipped with a generic module supporting web-based translation services such as Babel Fish, Google Language Tools and SYSTRAN. Moreover, the generic module allows to add new services simply by adding a few lines to a XML file (see the services.xml(5) manual page). The libtranslate distribution includes a powerful command line interface (see the translate(1) manual page). 2. Installation instructions See the INSTALL file. libtranslate-0.99/acinclude.m4000644 001750 001750 00000007077 10172766040 020104 0ustar00jylefortjylefort000000 000000 # Copyright (C) 2004 Jean-Yves Lefort. # # This file is part of libtranslate. # It may be distributed under the same terms as libtranslate. ### feature handling ########################################################## dnl TRANSLATE_FEATURE_VAR_NAME(FEATURE) dnl AC_DEFUN([TRANSLATE_FEATURE_VAR_NAME], [enable_[]translit([$1], -, _)]) dnl TRANSLATE_FEATURE_DISABLE_REASON_VAR_NAME(FEATURE) dnl AC_DEFUN([TRANSLATE_FEATURE_DISABLE_REASON_VAR_NAME], [disable_[]translit([$1], -, _)_reason]) dnl TRANSLATE_FEATURE_SYMBOL_NAME(FEATURE) dnl AC_DEFUN([TRANSLATE_FEATURE_SYMBOL_NAME], [WITH_[]translit([$1], -a-z, _A-Z)]) dnl TRANSLATE_FEATURE_ENABLED(FEATURE) dnl AC_DEFUN([TRANSLATE_FEATURE_ENABLED], [test $TRANSLATE_FEATURE_VAR_NAME([$1]) = yes]) dnl TRANSLATE_FEATURE_DISABLED(FEATURE) dnl AC_DEFUN([TRANSLATE_FEATURE_DISABLED], [test $TRANSLATE_FEATURE_VAR_NAME([$1]) = no]) dnl TRANSLATE_FEATURE_DISABLE(FEATURE, REASON) dnl AC_DEFUN([TRANSLATE_FEATURE_DISABLE], [AC_MSG_NOTICE([[$2]: forcing --disable-[$1]]) TRANSLATE_FEATURE_VAR_NAME([$1])=no TRANSLATE_FEATURE_DISABLE_REASON_VAR_NAME([$1])="([$2])"]) dnl TRANSLATE_FEATURE_DEFINE(FEATURE) dnl AC_DEFUN([TRANSLATE_FEATURE_DEFINE], [if TRANSLATE_FEATURE_ENABLED([$1]); then AC_DEFINE(TRANSLATE_FEATURE_SYMBOL_NAME([$1]), 1, [Define to 1 if [$1] is enabled]) fi ]) dnl TRANSLATE_FEATURES_DEFINE(FEATURES) dnl AC_DEFUN([TRANSLATE_FEATURES_DEFINE], [m4_foreach(feature, [$1], [TRANSLATE_FEATURE_DEFINE(feature)])]) ### command line arguments #################################################### dnl TRANSLATE_ARG_ENABLE(FEATURE, DESCRIPTION, [DEFAULT]) dnl AC_DEFUN([TRANSLATE_ARG_ENABLE], [AC_ARG_ENABLE([$1], AS_HELP_STRING(--ifelse([$3], no, enable, disable)-[$1], $2), [case "$enableval" in yes|no) TRANSLATE_FEATURE_VAR_NAME([$1])=$enableval ;; *) AC_MSG_ERROR([bad value $enableval for --enable-[$1]]) ;; esac], [TRANSLATE_FEATURE_VAR_NAME([$1])=ifelse([$3],, yes, [$3])])]) dnl TRANSLATE_ARG_COMPILE_WARNINGS dnl AC_DEFUN([TRANSLATE_ARG_COMPILE_WARNINGS], [AC_ARG_ENABLE(compile-warnings, AS_HELP_STRING([--enable-compile-warnings=no|yes|error], [enable compiler warnings [[no]]]), [case "$enableval" in yes|no|error) enable_compile_warnings=$enableval ;; *) AC_MSG_ERROR([bad value $enableval for --enable-compile-warnings]) ;; esac], [enable_compile_warnings=no]) if test $enable_compile_warnings = no; then WARN_CFLAGS= else # some flags are specific to GCC WARN_CFLAGS="-Wall \ -Wformat-y2k \ -Wformat-security \ -Wno-unused-parameter \ -Wfloat-equal \ -Wdeclaration-after-statement \ -Wendif-labels \ -Wpointer-arith \ -Wcast-align \ -Waggregate-return \ -Wmissing-noreturn \ -Wmissing-format-attribute \ -Wpacked \ -Wredundant-decls \ -Wnested-externs \ -Winline" test $enable_compile_warnings = error && WARN_CFLAGS="$WARN_CFLAGS -Werror" fi AC_SUBST(WARN_CFLAGS)]) ### report #################################################################### dnl TRANSLATE_REPORT(NAME, VALUE) dnl AC_DEFUN([TRANSLATE_REPORT], [ m4_format([%-25s %s], [$1], [$2])]) dnl TRANSLATE_REPORT_ARG(NAME) dnl AC_DEFUN([TRANSLATE_REPORT_ARG], [TRANSLATE_REPORT([--[$1]], [$translit([$1], -, _)])]) dnl TRANSLATE_REPORT_ARGS(NAMES) dnl AC_DEFUN([TRANSLATE_REPORT_ARGS], [m4_foreach(name, [$1], [TRANSLATE_REPORT_ARG(name) ])]) dnl TRANSLATE_REPORT_FEATURE(FEATURE) dnl AC_DEFUN([TRANSLATE_REPORT_FEATURE], [TRANSLATE_REPORT([--enable-[$1]], [$TRANSLATE_FEATURE_VAR_NAME([$1]) $TRANSLATE_FEATURE_DISABLE_REASON_VAR_NAME([$1])])]) dnl TRANSLATE_REPORT_FEATURES(FEATURES) dnl AC_DEFUN([TRANSLATE_REPORT_FEATURES], [m4_foreach(feature, [$1], [TRANSLATE_REPORT_FEATURE(feature) ])]) libtranslate-0.99/configure.ac000644 001750 001750 00000004702 10172241654 020170 0ustar00jylefortjylefort000000 000000 AC_INIT(libtranslate, 0.99, jylefort@brutele.be) AC_CONFIG_SRCDIR(src/translate.h) AC_PREREQ(2.59) ### command line arguments TRANSLATE_ARG_ENABLE(generic, [do not build the generic module]) TRANSLATE_ARG_ENABLE(talkfilters, [do not build the talkfilters module]) TRANSLATE_ARG_COMPILE_WARNINGS TRANSLATE_ARG_ENABLE(regression-tests, [build and run regression tests], no) ### initialization AM_INIT_AUTOMAKE(foreign) AM_MAINTAINER_MODE AM_CONFIG_HEADER(config.h) AC_PROG_LIBTOOL ### i18n GETTEXT_PACKAGE=AC_PACKAGE_NAME AC_DEFINE_UNQUOTED(GETTEXT_PACKAGE, "$GETTEXT_PACKAGE", [Define to the gettext package name]) AC_SUBST(GETTEXT_PACKAGE) ALL_LINGUAS="fr" AM_GLIB_GNU_GETTEXT AM_GLIB_DEFINE_LOCALEDIR(LOCALEDIR) AC_PROG_INTLTOOL ### system features AC_SYS_LARGEFILE # check for ANSI C headers AC_HEADER_STDC if test $ac_cv_header_stdc != yes; then AC_MSG_ERROR([ANSI C headers not present]) fi ### mandatory libraries and programs PKG_CHECK_MODULES(GLIB, [gobject-2.0 >= 2.4.0 gmodule-2.0 >= 2.4.0 gthread-2.0 >= 2.4.0],, [AC_MSG_ERROR([unable to find the GLib libraries])]) # not needed by end users GTK_DOC_CHECK([1.0]) ### optional libraries if TRANSLATE_FEATURE_ENABLED(generic); then PKG_CHECK_MODULES(SOUP, [libsoup-2.2],, [TRANSLATE_FEATURE_DISABLE(generic, [libsoup not found])]) fi if TRANSLATE_FEATURE_ENABLED(generic); then PKG_CHECK_MODULES(LIBXML, [libxml-2.0],, [TRANSLATE_FEATURE_DISABLE(generic, [libxml not found])]) fi if TRANSLATE_FEATURE_ENABLED(talkfilters); then AM_PATH_TALKFILTERS(, [TRANSLATE_FEATURE_DISABLE(talkfilters, [GNU Talk Filters not found])]) fi ### Automake conditionals AM_CONDITIONAL(WITH_GENERIC, [TRANSLATE_FEATURE_ENABLED(generic)]) AM_CONDITIONAL(WITH_TALKFILTERS, [TRANSLATE_FEATURE_ENABLED(talkfilters)]) AM_CONDITIONAL(WITH_REGRESSION_TESTS, [TRANSLATE_FEATURE_ENABLED(regression-tests)]) ### output AC_CONFIG_FILES(Makefile data/Makefile data/libtranslate.pc docs/Makefile docs/man/Makefile docs/man/version.xml docs/reference/Makefile docs/reference/version.xml m4/Makefile po/Makefile.in src/Makefile src/modules/Makefile) AC_OUTPUT ### report cat <, 1995, 1996 # # Modified to never use included libintl. # Owen Taylor , 12/15/1998 # # Major rework to remove unused code # Owen Taylor , 12/11/2002 # # Added better handling of ALL_LINGUAS from GNU gettext version # written by Bruno Haible, Owen Taylor 5/30/3002 # # We need this here as well, since someone might use autoconf-2.5x # to configure GLib then an older version to configure a package # using AM_GLIB_GNU_GETTEXT AC_PREREQ(2.53) dnl dnl We go to great lengths to make sure that aclocal won't dnl try to pull in the installed version of these macros dnl when running aclocal in the glib directory. dnl m4_copy([AC_DEFUN],[glib_DEFUN]) m4_copy([AC_REQUIRE],[glib_REQUIRE]) dnl dnl At the end, if we're not within glib, we'll define the public dnl definitions in terms of our private definitions. dnl # GLIB_LC_MESSAGES #-------------------- glib_DEFUN([GLIB_LC_MESSAGES], [AC_CHECK_HEADERS([locale.h]) if test $ac_cv_header_locale_h = yes; then AC_CACHE_CHECK([for LC_MESSAGES], am_cv_val_LC_MESSAGES, [AC_TRY_LINK([#include ], [return LC_MESSAGES], am_cv_val_LC_MESSAGES=yes, am_cv_val_LC_MESSAGES=no)]) if test $am_cv_val_LC_MESSAGES = yes; then AC_DEFINE(HAVE_LC_MESSAGES, 1, [Define if your file defines LC_MESSAGES.]) fi fi]) # GLIB_PATH_PROG_WITH_TEST #---------------------------- dnl GLIB_PATH_PROG_WITH_TEST(VARIABLE, PROG-TO-CHECK-FOR, dnl TEST-PERFORMED-ON-FOUND_PROGRAM [, VALUE-IF-NOT-FOUND [, PATH]]) glib_DEFUN([GLIB_PATH_PROG_WITH_TEST], [# Extract the first word of "$2", so it can be a program name with args. set dummy $2; ac_word=[$]2 AC_MSG_CHECKING([for $ac_word]) AC_CACHE_VAL(ac_cv_path_$1, [case "[$]$1" in /*) ac_cv_path_$1="[$]$1" # Let the user override the test with a path. ;; *) IFS="${IFS= }"; ac_save_ifs="$IFS"; IFS="${IFS}:" for ac_dir in ifelse([$5], , $PATH, [$5]); do test -z "$ac_dir" && ac_dir=. if test -f $ac_dir/$ac_word; then if [$3]; then ac_cv_path_$1="$ac_dir/$ac_word" break fi fi done IFS="$ac_save_ifs" dnl If no 4th arg is given, leave the cache variable unset, dnl so AC_PATH_PROGS will keep looking. ifelse([$4], , , [ test -z "[$]ac_cv_path_$1" && ac_cv_path_$1="$4" ])dnl ;; esac])dnl $1="$ac_cv_path_$1" if test ifelse([$4], , [-n "[$]$1"], ["[$]$1" != "$4"]); then AC_MSG_RESULT([$]$1) else AC_MSG_RESULT(no) fi AC_SUBST($1)dnl ]) # GLIB_WITH_NLS #----------------- glib_DEFUN([GLIB_WITH_NLS], dnl NLS is obligatory [USE_NLS=yes AC_SUBST(USE_NLS) gt_cv_have_gettext=no CATOBJEXT=NONE XGETTEXT=: INTLLIBS= AC_CHECK_HEADER(libintl.h, [gt_cv_func_dgettext_libintl="no" libintl_extra_libs="" # # First check in libc # AC_CACHE_CHECK([for dgettext in libc], gt_cv_func_dgettext_libc, [AC_TRY_LINK([ #include ], [return (int) dgettext ("","")], gt_cv_func_dgettext_libc=yes, gt_cv_func_dgettext_libc=no) ]) if test "$gt_cv_func_dgettext_libc" = "yes" ; then AC_CHECK_FUNCS(bind_textdomain_codeset) fi # # If we don't have everything we want, check in libintl # if test "$gt_cv_func_dgettext_libc" != "yes" \ || test "$ac_cv_func_bind_textdomain_codeset" != "yes" ; then AC_CHECK_LIB(intl, bindtextdomain, [AC_CHECK_LIB(intl, dgettext, gt_cv_func_dgettext_libintl=yes)]) if test "$gt_cv_func_dgettext_libintl" != "yes" ; then AC_MSG_CHECKING([if -liconv is needed to use gettext]) AC_MSG_RESULT([]) AC_CHECK_LIB(intl, dcgettext, [gt_cv_func_dgettext_libintl=yes libintl_extra_libs=-liconv], :,-liconv) fi # # If we found libintl, then check in it for bind_textdomain_codeset(); # we'll prefer libc if neither have bind_textdomain_codeset(), # and both have dgettext # if test "$gt_cv_func_dgettext_libintl" = "yes" ; then glib_save_LIBS="$LIBS" LIBS="$LIBS -lintl $libintl_extra_libs" unset ac_cv_func_bind_textdomain_codeset AC_CHECK_FUNCS(bind_textdomain_codeset) LIBS="$glib_save_LIBS" if test "$ac_cv_func_bind_textdomain_codeset" = "yes" ; then gt_cv_func_dgettext_libc=no else if test "$gt_cv_func_dgettext_libc" = "yes"; then gt_cv_func_dgettext_libintl=no fi fi fi fi if test "$gt_cv_func_dgettext_libc" = "yes" \ || test "$gt_cv_func_dgettext_libintl" = "yes"; then gt_cv_have_gettext=yes fi if test "$gt_cv_func_dgettext_libintl" = "yes"; then INTLLIBS="-lintl $libintl_extra_libs" fi if test "$gt_cv_have_gettext" = "yes"; then AC_DEFINE(HAVE_GETTEXT,1, [Define if the GNU gettext() function is already present or preinstalled.]) GLIB_PATH_PROG_WITH_TEST(MSGFMT, msgfmt, [test -z "`$ac_dir/$ac_word -h 2>&1 | grep 'dv '`"], no)dnl if test "$MSGFMT" != "no"; then glib_save_LIBS="$LIBS" LIBS="$LIBS $INTLLIBS" AC_CHECK_FUNCS(dcgettext) AC_PATH_PROG(GMSGFMT, gmsgfmt, $MSGFMT) GLIB_PATH_PROG_WITH_TEST(XGETTEXT, xgettext, [test -z "`$ac_dir/$ac_word -h 2>&1 | grep '(HELP)'`"], :) AC_TRY_LINK(, [extern int _nl_msg_cat_cntr; return _nl_msg_cat_cntr], [CATOBJEXT=.gmo DATADIRNAME=share], [case $host in *-*-solaris*) dnl On Solaris, if bind_textdomain_codeset is in libc, dnl GNU format message catalog is always supported, dnl since both are added to the libc all together. dnl Hence, we'd like to go with DATADIRNAME=share and dnl and CATOBJEXT=.gmo in this case. AC_CHECK_FUNC(bind_textdomain_codeset, [CATOBJEXT=.gmo DATADIRNAME=share], [CATOBJEXT=.mo DATADIRNAME=lib]) ;; *) CATOBJEXT=.mo DATADIRNAME=lib ;; esac]) LIBS="$glib_save_LIBS" INSTOBJEXT=.mo else gt_cv_have_gettext=no fi fi ]) if test "$gt_cv_have_gettext" = "yes" ; then AC_DEFINE(ENABLE_NLS, 1, [always defined to indicate that i18n is enabled]) fi dnl Test whether we really found GNU xgettext. if test "$XGETTEXT" != ":"; then dnl If it is not GNU xgettext we define it as : so that the dnl Makefiles still can work. if $XGETTEXT --omit-header /dev/null 2> /dev/null; then : ; else AC_MSG_RESULT( [found xgettext program is not GNU xgettext; ignore it]) XGETTEXT=":" fi fi # We need to process the po/ directory. POSUB=po AC_OUTPUT_COMMANDS( [case "$CONFIG_FILES" in *po/Makefile.in*) sed -e "/POTFILES =/r po/POTFILES" po/Makefile.in > po/Makefile esac]) dnl These rules are solely for the distribution goal. While doing this dnl we only have to keep exactly one list of the available catalogs dnl in configure.in. for lang in $ALL_LINGUAS; do GMOFILES="$GMOFILES $lang.gmo" POFILES="$POFILES $lang.po" done dnl Make all variables we use known to autoconf. AC_SUBST(CATALOGS) AC_SUBST(CATOBJEXT) AC_SUBST(DATADIRNAME) AC_SUBST(GMOFILES) AC_SUBST(INSTOBJEXT) AC_SUBST(INTLLIBS) AC_SUBST(PO_IN_DATADIR_TRUE) AC_SUBST(PO_IN_DATADIR_FALSE) AC_SUBST(POFILES) AC_SUBST(POSUB) ]) # AM_GLIB_GNU_GETTEXT # ------------------- # Do checks necessary for use of gettext. If a suitable implementation # of gettext is found in either in libintl or in the C library, # it will set INTLLIBS to the libraries needed for use of gettext # and AC_DEFINE() HAVE_GETTEXT and ENABLE_NLS. (The shell variable # gt_cv_have_gettext will be set to "yes".) It will also call AC_SUBST() # on various variables needed by the Makefile.in.in installed by # glib-gettextize. dnl glib_DEFUN([GLIB_GNU_GETTEXT], [AC_REQUIRE([AC_PROG_CC])dnl AC_REQUIRE([AC_HEADER_STDC])dnl GLIB_LC_MESSAGES GLIB_WITH_NLS if test "$gt_cv_have_gettext" = "yes"; then if test "x$ALL_LINGUAS" = "x"; then LINGUAS= else AC_MSG_CHECKING(for catalogs to be installed) NEW_LINGUAS= for presentlang in $ALL_LINGUAS; do useit=no if test "%UNSET%" != "${LINGUAS-%UNSET%}"; then desiredlanguages="$LINGUAS" else desiredlanguages="$ALL_LINGUAS" fi for desiredlang in $desiredlanguages; do # Use the presentlang catalog if desiredlang is # a. equal to presentlang, or # b. a variant of presentlang (because in this case, # presentlang can be used as a fallback for messages # which are not translated in the desiredlang catalog). case "$desiredlang" in "$presentlang"*) useit=yes;; esac done if test $useit = yes; then NEW_LINGUAS="$NEW_LINGUAS $presentlang" fi done LINGUAS=$NEW_LINGUAS AC_MSG_RESULT($LINGUAS) fi dnl Construct list of names of catalog files to be constructed. if test -n "$LINGUAS"; then for lang in $LINGUAS; do CATALOGS="$CATALOGS $lang$CATOBJEXT"; done fi fi dnl If the AC_CONFIG_AUX_DIR macro for autoconf is used we possibly dnl find the mkinstalldirs script in another subdir but ($top_srcdir). dnl Try to locate is. MKINSTALLDIRS= if test -n "$ac_aux_dir"; then MKINSTALLDIRS="$ac_aux_dir/mkinstalldirs" fi if test -z "$MKINSTALLDIRS"; then MKINSTALLDIRS="\$(top_srcdir)/mkinstalldirs" fi AC_SUBST(MKINSTALLDIRS) dnl Generate list of files to be processed by xgettext which will dnl be included in po/Makefile. test -d po || mkdir po if test "x$srcdir" != "x."; then if test "x`echo $srcdir | sed 's@/.*@@'`" = "x"; then posrcprefix="$srcdir/" else posrcprefix="../$srcdir/" fi else posrcprefix="../" fi rm -f po/POTFILES sed -e "/^#/d" -e "/^\$/d" -e "s,.*, $posrcprefix& \\\\," -e "\$s/\(.*\) \\\\/\1/" \ < $srcdir/po/POTFILES.in > po/POTFILES ]) # AM_GLIB_DEFINE_LOCALEDIR(VARIABLE) # ------------------------------- # Define VARIABLE to the location where catalog files will # be installed by po/Makefile. glib_DEFUN([GLIB_DEFINE_LOCALEDIR], [glib_REQUIRE([GLIB_GNU_GETTEXT])dnl glib_save_prefix="$prefix" glib_save_exec_prefix="$exec_prefix" test "x$prefix" = xNONE && prefix=$ac_default_prefix test "x$exec_prefix" = xNONE && exec_prefix=$prefix if test "x$CATOBJEXT" = "x.mo" ; then localedir=`eval echo "${libdir}/locale"` else localedir=`eval echo "${datadir}/locale"` fi prefix="$glib_save_prefix" exec_prefix="$glib_save_exec_prefix" AC_DEFINE_UNQUOTED($1, "$localedir", [Define the location where the catalogs will be installed]) ]) dnl dnl Now the definitions that aclocal will find dnl ifdef(glib_configure_in,[],[ AC_DEFUN([AM_GLIB_GNU_GETTEXT],[GLIB_GNU_GETTEXT($@)]) AC_DEFUN([AM_GLIB_DEFINE_LOCALEDIR],[GLIB_DEFINE_LOCALEDIR($@)]) ])dnl dnl -*- mode: autoconf -*- # serial 1 dnl Usage: dnl GTK_DOC_CHECK([minimum-gtk-doc-version]) AC_DEFUN([GTK_DOC_CHECK], [ AC_BEFORE([AC_PROG_LIBTOOL],[$0])dnl setup libtool first AC_BEFORE([AM_PROG_LIBTOOL],[$0])dnl setup libtool first dnl for overriding the documentation installation directory AC_ARG_WITH(html-dir, AC_HELP_STRING([--with-html-dir=PATH], [path to installed docs]),, [with_html_dir='${datadir}/gtk-doc/html']) HTML_DIR="$with_html_dir" AC_SUBST(HTML_DIR) dnl enable/disable documentation building AC_ARG_ENABLE(gtk-doc, AC_HELP_STRING([--enable-gtk-doc], [use gtk-doc to build documentation [default=no]]),, enable_gtk_doc=no) have_gtk_doc=no if test x$enable_gtk_doc = xyes; then if test -z "$PKG_CONFIG"; then AC_PATH_PROG(PKG_CONFIG, pkg-config, no) fi if test "$PKG_CONFIG" != "no" && $PKG_CONFIG --exists gtk-doc; then have_gtk_doc=yes fi dnl do we want to do a version check? ifelse([$1],[],, [gtk_doc_min_version=$1 if test "$have_gtk_doc" = yes; then AC_MSG_CHECKING([gtk-doc version >= $gtk_doc_min_version]) if $PKG_CONFIG --atleast-version $gtk_doc_min_version gtk-doc; then AC_MSG_RESULT(yes) else AC_MSG_RESULT(no) have_gtk_doc=no fi fi ]) if test "$have_gtk_doc" != yes; then enable_gtk_doc=no fi fi AM_CONDITIONAL(ENABLE_GTK_DOC, test x$enable_gtk_doc = xyes) AM_CONDITIONAL(GTK_DOC_USE_LIBTOOL, test -n "$LIBTOOL") ]) dnl IT_PROG_INTLTOOL([MINIMUM-VERSION], [no-xml]) # serial 1 IT_PROG_INTLTOOL AC_DEFUN([IT_PROG_INTLTOOL], [ if test -n "$1"; then AC_MSG_CHECKING(for intltool >= $1) INTLTOOL_REQUIRED_VERSION_AS_INT=`echo $1 | awk -F. '{ printf "%d", $[1] * 100 + $[2]; }'` INTLTOOL_APPLIED_VERSION=`awk -F\" '/\\$VERSION / { printf $[2]; }' < ${ac_aux_dir}/intltool-update.in` changequote({{,}}) INTLTOOL_APPLIED_VERSION_AS_INT=`awk -F\" '/\\$VERSION / { split(${{2}}, VERSION, "."); printf "%d\n", VERSION[1] * 100 + VERSION[2];}' < ${ac_aux_dir}/intltool-update.in` changequote([,]) if test "$INTLTOOL_APPLIED_VERSION_AS_INT" -ge "$INTLTOOL_REQUIRED_VERSION_AS_INT"; then AC_MSG_RESULT([$INTLTOOL_APPLIED_VERSION found]) else AC_MSG_RESULT([$INTLTOOL_APPLIED_VERSION found. Your intltool is too old. You need intltool $1 or later.]) exit 1 fi fi INTLTOOL_DESKTOP_RULE='%.desktop: %.desktop.in $(INTLTOOL_MERGE) $(wildcard $(top_srcdir)/po/*.po) ; LC_ALL=C $(INTLTOOL_MERGE) -d -u -c $(top_builddir)/po/.intltool-merge-cache $(top_srcdir)/po $< [$]@' INTLTOOL_DIRECTORY_RULE='%.directory: %.directory.in $(INTLTOOL_MERGE) $(wildcard $(top_srcdir)/po/*.po) ; LC_ALL=C $(INTLTOOL_MERGE) -d -u -c $(top_builddir)/po/.intltool-merge-cache $(top_srcdir)/po $< [$]@' INTLTOOL_KEYS_RULE='%.keys: %.keys.in $(INTLTOOL_MERGE) $(wildcard $(top_srcdir)/po/*.po) ; LC_ALL=C $(INTLTOOL_MERGE) -k -u -c $(top_builddir)/po/.intltool-merge-cache $(top_srcdir)/po $< [$]@' INTLTOOL_PROP_RULE='%.prop: %.prop.in $(INTLTOOL_MERGE) $(wildcard $(top_srcdir)/po/*.po) ; LC_ALL=C $(INTLTOOL_MERGE) -d -u -c $(top_builddir)/po/.intltool-merge-cache $(top_srcdir)/po $< [$]@' INTLTOOL_OAF_RULE='%.oaf: %.oaf.in $(INTLTOOL_MERGE) $(wildcard $(top_srcdir)/po/*.po) ; LC_ALL=C $(INTLTOOL_MERGE) -o -p $(top_srcdir)/po $< [$]@' INTLTOOL_PONG_RULE='%.pong: %.pong.in $(INTLTOOL_MERGE) $(wildcard $(top_srcdir)/po/*.po) ; LC_ALL=C $(INTLTOOL_MERGE) -x -u -c $(top_builddir)/po/.intltool-merge-cache $(top_srcdir)/po $< [$]@' INTLTOOL_SERVER_RULE='%.server: %.server.in $(INTLTOOL_MERGE) $(wildcard $(top_srcdir)/po/*.po) ; LC_ALL=C $(INTLTOOL_MERGE) -o -u -c $(top_builddir)/po/.intltool-merge-cache $(top_srcdir)/po $< [$]@' INTLTOOL_SHEET_RULE='%.sheet: %.sheet.in $(INTLTOOL_MERGE) $(wildcard $(top_srcdir)/po/*.po) ; LC_ALL=C $(INTLTOOL_MERGE) -x -u -c $(top_builddir)/po/.intltool-merge-cache $(top_srcdir)/po $< [$]@' INTLTOOL_SOUNDLIST_RULE='%.soundlist: %.soundlist.in $(INTLTOOL_MERGE) $(wildcard $(top_srcdir)/po/*.po) ; LC_ALL=C $(INTLTOOL_MERGE) -d -u -c $(top_builddir)/po/.intltool-merge-cache $(top_srcdir)/po $< [$]@' INTLTOOL_UI_RULE='%.ui: %.ui.in $(INTLTOOL_MERGE) $(wildcard $(top_srcdir)/po/*.po) ; LC_ALL=C $(INTLTOOL_MERGE) -x -u -c $(top_builddir)/po/.intltool-merge-cache $(top_srcdir)/po $< [$]@' INTLTOOL_XML_RULE='%.xml: %.xml.in $(INTLTOOL_MERGE) $(wildcard $(top_srcdir)/po/*.po) ; LC_ALL=C $(INTLTOOL_MERGE) -x -u -c $(top_builddir)/po/.intltool-merge-cache $(top_srcdir)/po $< [$]@' INTLTOOL_XML_NOMERGE_RULE='%.xml: %.xml.in $(INTLTOOL_MERGE) ; LC_ALL=C $(INTLTOOL_MERGE) -x -u /tmp $< [$]@' INTLTOOL_XAM_RULE='%.xam: %.xml.in $(INTLTOOL_MERGE) $(wildcard $(top_srcdir)/po/*.po) ; LC_ALL=C $(INTLTOOL_MERGE) -x -u -c $(top_builddir)/po/.intltool-merge-cache $(top_srcdir)/po $< [$]@' INTLTOOL_KBD_RULE='%.kbd: %.kbd.in $(INTLTOOL_MERGE) $(wildcard $(top_srcdir)/po/*.po) ; LC_ALL=C $(INTLTOOL_MERGE) -x -u -m -c $(top_builddir)/po/.intltool-merge-cache $(top_srcdir)/po $< [$]@' INTLTOOL_CAVES_RULE='%.caves: %.caves.in $(INTLTOOL_MERGE) $(wildcard $(top_srcdir)/po/*.po) ; LC_ALL=C $(INTLTOOL_MERGE) -d -u -c $(top_builddir)/po/.intltool-merge-cache $(top_srcdir)/po $< [$]@' INTLTOOL_SCHEMAS_RULE='%.schemas: %.schemas.in $(INTLTOOL_MERGE) $(wildcard $(top_srcdir)/po/*.po) ; LC_ALL=C $(INTLTOOL_MERGE) -s -u -c $(top_builddir)/po/.intltool-merge-cache $(top_srcdir)/po $< [$]@' INTLTOOL_THEME_RULE='%.theme: %.theme.in $(INTLTOOL_MERGE) $(wildcard $(top_srcdir)/po/*.po) ; LC_ALL=C $(INTLTOOL_MERGE) -d -u -c $(top_builddir)/po/.intltool-merge-cache $(top_srcdir)/po $< [$]@' AC_SUBST(INTLTOOL_DESKTOP_RULE) AC_SUBST(INTLTOOL_DIRECTORY_RULE) AC_SUBST(INTLTOOL_KEYS_RULE) AC_SUBST(INTLTOOL_PROP_RULE) AC_SUBST(INTLTOOL_OAF_RULE) AC_SUBST(INTLTOOL_PONG_RULE) AC_SUBST(INTLTOOL_SERVER_RULE) AC_SUBST(INTLTOOL_SHEET_RULE) AC_SUBST(INTLTOOL_SOUNDLIST_RULE) AC_SUBST(INTLTOOL_UI_RULE) AC_SUBST(INTLTOOL_XAM_RULE) AC_SUBST(INTLTOOL_KBD_RULE) AC_SUBST(INTLTOOL_XML_RULE) AC_SUBST(INTLTOOL_XML_NOMERGE_RULE) AC_SUBST(INTLTOOL_CAVES_RULE) AC_SUBST(INTLTOOL_SCHEMAS_RULE) AC_SUBST(INTLTOOL_THEME_RULE) # Use the tools built into the package, not the ones that are installed. INTLTOOL_EXTRACT='$(top_builddir)/intltool-extract' INTLTOOL_MERGE='$(top_builddir)/intltool-merge' INTLTOOL_UPDATE='$(top_builddir)/intltool-update' AC_SUBST(INTLTOOL_EXTRACT) AC_SUBST(INTLTOOL_MERGE) AC_SUBST(INTLTOOL_UPDATE) AC_PATH_PROG(INTLTOOL_PERL, perl) if test -z "$INTLTOOL_PERL"; then AC_MSG_ERROR([perl not found; required for intltool]) fi if test -z "`$INTLTOOL_PERL -v | fgrep '5.' 2> /dev/null`"; then AC_MSG_ERROR([perl 5.x required for intltool]) fi if test "x$2" != "xno-xml"; then AC_MSG_CHECKING([for XML::Parser]) if `$INTLTOOL_PERL -e "require XML::Parser" 2>/dev/null`; then AC_MSG_RESULT([ok]) else AC_MSG_ERROR([XML::Parser perl module is required for intltool]) fi fi AC_PATH_PROG(ICONV, iconv, iconv) AC_PATH_PROG(MSGFMT, msgfmt, msgfmt) AC_PATH_PROG(MSGMERGE, msgmerge, msgmerge) AC_PATH_PROG(XGETTEXT, xgettext, xgettext) # Remove file type tags (using []) from po/POTFILES. ifdef([AC_DIVERSION_ICMDS],[ AC_DIVERT_PUSH(AC_DIVERSION_ICMDS) changequote(,) mv -f po/POTFILES po/POTFILES.tmp sed -e '/\[encoding.*\]/d' -e 's/\[.*\] *//' < po/POTFILES.tmp > po/POTFILES rm -f po/POTFILES.tmp changequote([,]) AC_DIVERT_POP() ],[ ifdef([AC_CONFIG_COMMANDS_PRE],[ AC_CONFIG_COMMANDS_PRE([ changequote(,) mv -f po/POTFILES po/POTFILES.tmp sed -e '/\[encoding.*\]/d' -e 's/\[.*\] *//' < po/POTFILES.tmp > po/POTFILES rm -f po/POTFILES.tmp changequote([,]) ]) ]) if mkdir -p --version . >/dev/null 2>&1 && test ! -d ./--version; then # Keeping the `.' argument allows $(mkdir_p) to be used without # argument. Indeed, we sometimes output rules like # $(mkdir_p) $(somedir) # where $(somedir) is conditionally defined. # (`test -n '$(somedir)' && $(mkdir_p) $(somedir)' is a more # expensive solution, as it forces Make to start a sub-shell.) mkdir_p='mkdir -p -- .' else # On NextStep and OpenStep, the `mkdir' command does not # recognize any option. It will interpret all options as # directories to create, and then abort because `.' already # exists. for d in ./-p ./--version; do test -d $d && rmdir $d done # $(mkinstalldirs) is defined by Automake if mkinstalldirs exists. if test -f "$ac_aux_dir/mkinstalldirs"; then mkdir_p='$(mkinstalldirs)' else mkdir_p='$(install_sh) -d' fi fi AC_SUBST([mkdir_p]) ]) # Manually sed perl in so people don't have to put the intltool scripts in AC_OUTPUT. AC_CONFIG_COMMANDS([intltool], [ intltool_edit="-e 's:@INTLTOOL_EXTRACT@:`pwd`/intltool-extract:g' \ -e 's:@INTLTOOL_ICONV@:${ICONV}:g' \ -e 's:@INTLTOOL_MSGFMT@:${MSGFMT}:g' \ -e 's:@INTLTOOL_MSGMERGE@:${MSGMERGE}:g' \ -e 's:@INTLTOOL_XGETTEXT@:${XGETTEXT}:g' \ -e 's:@INTLTOOL_PERL@:${INTLTOOL_PERL}:g'" eval sed ${intltool_edit} < ${ac_aux_dir}/intltool-extract.in \ > intltool-extract.out if cmp -s intltool-extract intltool-extract.out 2>/dev/null; then rm -f intltool-extract.out else mv -f intltool-extract.out intltool-extract fi chmod ugo+x intltool-extract chmod u+w intltool-extract eval sed ${intltool_edit} < ${ac_aux_dir}/intltool-merge.in \ > intltool-merge.out if cmp -s intltool-merge intltool-merge.out 2>/dev/null; then rm -f intltool-merge.out else mv -f intltool-merge.out intltool-merge fi chmod ugo+x intltool-merge chmod u+w intltool-merge eval sed ${intltool_edit} < ${ac_aux_dir}/intltool-update.in \ > intltool-update.out if cmp -s intltool-update intltool-update.out 2>/dev/null; then rm -f intltool-update.out else mv -f intltool-update.out intltool-update fi chmod ugo+x intltool-update chmod u+w intltool-update ], INTLTOOL_PERL='${INTLTOOL_PERL}' ac_aux_dir=${ac_aux_dir} INTLTOOL_EXTRACT='${INTLTOOL_EXTRACT}' ICONV='${ICONV}' MSGFMT='${MSGFMT}' MSGMERGE='${MSGMERGE}' XGETTEXT='${XGETTEXT}') ]) # deprecated macros AC_DEFUN([AC_PROG_INTLTOOL], [IT_PROG_INTLTOOL($@)]) # libtool.m4 - Configure libtool for the host system. -*-Autoconf-*- # serial 47 AC_PROG_LIBTOOL # AC_PROVIDE_IFELSE(MACRO-NAME, IF-PROVIDED, IF-NOT-PROVIDED) # ----------------------------------------------------------- # If this macro is not defined by Autoconf, define it here. m4_ifdef([AC_PROVIDE_IFELSE], [], [m4_define([AC_PROVIDE_IFELSE], [m4_ifdef([AC_PROVIDE_$1], [$2], [$3])])]) # AC_PROG_LIBTOOL # --------------- AC_DEFUN([AC_PROG_LIBTOOL], [AC_REQUIRE([_AC_PROG_LIBTOOL])dnl dnl If AC_PROG_CXX has already been expanded, run AC_LIBTOOL_CXX dnl immediately, otherwise, hook it in at the end of AC_PROG_CXX. AC_PROVIDE_IFELSE([AC_PROG_CXX], [AC_LIBTOOL_CXX], [define([AC_PROG_CXX], defn([AC_PROG_CXX])[AC_LIBTOOL_CXX ])]) dnl And a similar setup for Fortran 77 support AC_PROVIDE_IFELSE([AC_PROG_F77], [AC_LIBTOOL_F77], [define([AC_PROG_F77], defn([AC_PROG_F77])[AC_LIBTOOL_F77 ])]) dnl Quote A][M_PROG_GCJ so that aclocal doesn't bring it in needlessly. dnl If either AC_PROG_GCJ or A][M_PROG_GCJ have already been expanded, run dnl AC_LIBTOOL_GCJ immediately, otherwise, hook it in at the end of both. AC_PROVIDE_IFELSE([AC_PROG_GCJ], [AC_LIBTOOL_GCJ], [AC_PROVIDE_IFELSE([A][M_PROG_GCJ], [AC_LIBTOOL_GCJ], [AC_PROVIDE_IFELSE([LT_AC_PROG_GCJ], [AC_LIBTOOL_GCJ], [ifdef([AC_PROG_GCJ], [define([AC_PROG_GCJ], defn([AC_PROG_GCJ])[AC_LIBTOOL_GCJ])]) ifdef([A][M_PROG_GCJ], [define([A][M_PROG_GCJ], defn([A][M_PROG_GCJ])[AC_LIBTOOL_GCJ])]) ifdef([LT_AC_PROG_GCJ], [define([LT_AC_PROG_GCJ], defn([LT_AC_PROG_GCJ])[AC_LIBTOOL_GCJ])])])]) ])])# AC_PROG_LIBTOOL # _AC_PROG_LIBTOOL # ---------------- AC_DEFUN([_AC_PROG_LIBTOOL], [AC_REQUIRE([AC_LIBTOOL_SETUP])dnl AC_BEFORE([$0],[AC_LIBTOOL_CXX])dnl AC_BEFORE([$0],[AC_LIBTOOL_F77])dnl AC_BEFORE([$0],[AC_LIBTOOL_GCJ])dnl # This can be used to rebuild libtool when needed LIBTOOL_DEPS="$ac_aux_dir/ltmain.sh" # Always use our own libtool. LIBTOOL='$(SHELL) $(top_builddir)/libtool' AC_SUBST(LIBTOOL)dnl # Prevent multiple expansion define([AC_PROG_LIBTOOL], []) ])# _AC_PROG_LIBTOOL # AC_LIBTOOL_SETUP # ---------------- AC_DEFUN([AC_LIBTOOL_SETUP], [AC_PREREQ(2.50)dnl AC_REQUIRE([AC_ENABLE_SHARED])dnl AC_REQUIRE([AC_ENABLE_STATIC])dnl AC_REQUIRE([AC_ENABLE_FAST_INSTALL])dnl AC_REQUIRE([AC_CANONICAL_HOST])dnl AC_REQUIRE([AC_CANONICAL_BUILD])dnl AC_REQUIRE([AC_PROG_CC])dnl AC_REQUIRE([AC_PROG_LD])dnl AC_REQUIRE([AC_PROG_LD_RELOAD_FLAG])dnl AC_REQUIRE([AC_PROG_NM])dnl AC_REQUIRE([AC_PROG_LN_S])dnl AC_REQUIRE([AC_DEPLIBS_CHECK_METHOD])dnl # Autoconf 2.13's AC_OBJEXT and AC_EXEEXT macros only works for C compilers! AC_REQUIRE([AC_OBJEXT])dnl AC_REQUIRE([AC_EXEEXT])dnl dnl AC_LIBTOOL_SYS_MAX_CMD_LEN AC_LIBTOOL_SYS_GLOBAL_SYMBOL_PIPE AC_LIBTOOL_OBJDIR AC_REQUIRE([_LT_AC_SYS_COMPILER])dnl _LT_AC_PROG_ECHO_BACKSLASH case $host_os in aix3*) # AIX sometimes has problems with the GCC collect2 program. For some # reason, if we set the COLLECT_NAMES environment variable, the problems # vanish in a puff of smoke. if test "X${COLLECT_NAMES+set}" != Xset; then COLLECT_NAMES= export COLLECT_NAMES fi ;; esac # Sed substitution that helps us do robust quoting. It backslashifies # metacharacters that are still active within double-quoted strings. Xsed='sed -e s/^X//' [sed_quote_subst='s/\([\\"\\`$\\\\]\)/\\\1/g'] # Same as above, but do not quote variable references. [double_quote_subst='s/\([\\"\\`\\\\]\)/\\\1/g'] # Sed substitution to delay expansion of an escaped shell variable in a # double_quote_subst'ed string. delay_variable_subst='s/\\\\\\\\\\\$/\\\\\\$/g' # Sed substitution to avoid accidental globbing in evaled expressions no_glob_subst='s/\*/\\\*/g' # Constants: rm="rm -f" # Global variables: default_ofile=libtool can_build_shared=yes # All known linkers require a `.a' archive for static linking (except M$VC, # which needs '.lib'). libext=a ltmain="$ac_aux_dir/ltmain.sh" ofile="$default_ofile" with_gnu_ld="$lt_cv_prog_gnu_ld" AC_CHECK_TOOL(AR, ar, false) AC_CHECK_TOOL(RANLIB, ranlib, :) AC_CHECK_TOOL(STRIP, strip, :) old_CC="$CC" old_CFLAGS="$CFLAGS" # Set sane defaults for various variables test -z "$AR" && AR=ar test -z "$AR_FLAGS" && AR_FLAGS=cru test -z "$AS" && AS=as test -z "$CC" && CC=cc test -z "$LTCC" && LTCC=$CC test -z "$DLLTOOL" && DLLTOOL=dlltool test -z "$LD" && LD=ld test -z "$LN_S" && LN_S="ln -s" test -z "$MAGIC_CMD" && MAGIC_CMD=file test -z "$NM" && NM=nm test -z "$SED" && SED=sed test -z "$OBJDUMP" && OBJDUMP=objdump test -z "$RANLIB" && RANLIB=: test -z "$STRIP" && STRIP=: test -z "$ac_objext" && ac_objext=o # Determine commands to create old-style static archives. old_archive_cmds='$AR $AR_FLAGS $oldlib$oldobjs$old_deplibs' old_postinstall_cmds='chmod 644 $oldlib' old_postuninstall_cmds= if test -n "$RANLIB"; then case $host_os in openbsd*) old_postinstall_cmds="\$RANLIB -t \$oldlib~$old_postinstall_cmds" ;; *) old_postinstall_cmds="\$RANLIB \$oldlib~$old_postinstall_cmds" ;; esac old_archive_cmds="$old_archive_cmds~\$RANLIB \$oldlib" fi cc_basename=`$echo X"$compiler" | $Xsed -e 's%^.*/%%'` # Only perform the check for file, if the check method requires it case $deplibs_check_method in file_magic*) if test "$file_magic_cmd" = '$MAGIC_CMD'; then AC_PATH_MAGIC fi ;; esac AC_PROVIDE_IFELSE([AC_LIBTOOL_DLOPEN], enable_dlopen=yes, enable_dlopen=no) AC_PROVIDE_IFELSE([AC_LIBTOOL_WIN32_DLL], enable_win32_dll=yes, enable_win32_dll=no) AC_ARG_ENABLE([libtool-lock], [AC_HELP_STRING([--disable-libtool-lock], [avoid locking (might break parallel builds)])]) test "x$enable_libtool_lock" != xno && enable_libtool_lock=yes AC_ARG_WITH([pic], [AC_HELP_STRING([--with-pic], [try to use only PIC/non-PIC objects @<:@default=use both@:>@])], [pic_mode="$withval"], [pic_mode=default]) test -z "$pic_mode" && pic_mode=default # Use C for the default configuration in the libtool script tagname= AC_LIBTOOL_LANG_C_CONFIG _LT_AC_TAGCONFIG ])# AC_LIBTOOL_SETUP # _LT_AC_SYS_COMPILER # ------------------- AC_DEFUN([_LT_AC_SYS_COMPILER], [AC_REQUIRE([AC_PROG_CC])dnl # If no C compiler was specified, use CC. LTCC=${LTCC-"$CC"} # Allow CC to be a program name with arguments. compiler=$CC ])# _LT_AC_SYS_COMPILER # _LT_AC_SYS_LIBPATH_AIX # ---------------------- # Links a minimal program and checks the executable # for the system default hardcoded library path. In most cases, # this is /usr/lib:/lib, but when the MPI compilers are used # the location of the communication and MPI libs are included too. # If we don't find anything, use the default library path according # to the aix ld manual. AC_DEFUN([_LT_AC_SYS_LIBPATH_AIX], [AC_LINK_IFELSE(AC_LANG_PROGRAM,[ aix_libpath=`dump -H conftest$ac_exeext 2>/dev/null | $SED -n -e '/Import File Strings/,/^$/ { /^0/ { s/^0 *\(.*\)$/\1/; p; } }'` # Check for a 64-bit object if we didn't find anything. if test -z "$aix_libpath"; then aix_libpath=`dump -HX64 conftest$ac_exeext 2>/dev/null | $SED -n -e '/Import File Strings/,/^$/ { /^0/ { s/^0 *\(.*\)$/\1/; p; } }'`; fi],[]) if test -z "$aix_libpath"; then aix_libpath="/usr/lib:/lib"; fi ])# _LT_AC_SYS_LIBPATH_AIX # _LT_AC_SHELL_INIT(ARG) # ---------------------- AC_DEFUN([_LT_AC_SHELL_INIT], [ifdef([AC_DIVERSION_NOTICE], [AC_DIVERT_PUSH(AC_DIVERSION_NOTICE)], [AC_DIVERT_PUSH(NOTICE)]) $1 AC_DIVERT_POP ])# _LT_AC_SHELL_INIT # _LT_AC_PROG_ECHO_BACKSLASH # -------------------------- # Add some code to the start of the generated configure script which # will find an echo command which doesn't interpret backslashes. AC_DEFUN([_LT_AC_PROG_ECHO_BACKSLASH], [_LT_AC_SHELL_INIT([ # Check that we are running under the correct shell. SHELL=${CONFIG_SHELL-/bin/sh} case X$ECHO in X*--fallback-echo) # Remove one level of quotation (which was required for Make). ECHO=`echo "$ECHO" | sed 's,\\\\\[$]\\[$]0,'[$]0','` ;; esac echo=${ECHO-echo} if test "X[$]1" = X--no-reexec; then # Discard the --no-reexec flag, and continue. shift elif test "X[$]1" = X--fallback-echo; then # Avoid inline document here, it may be left over : elif test "X`($echo '\t') 2>/dev/null`" = 'X\t' ; then # Yippee, $echo works! : else # Restart under the correct shell. exec $SHELL "[$]0" --no-reexec ${1+"[$]@"} fi if test "X[$]1" = X--fallback-echo; then # used as fallback echo shift cat </dev/null 2>&1 && unset CDPATH if test -z "$ECHO"; then if test "X${echo_test_string+set}" != Xset; then # find a string as large as possible, as long as the shell can cope with it for cmd in 'sed 50q "[$]0"' 'sed 20q "[$]0"' 'sed 10q "[$]0"' 'sed 2q "[$]0"' 'echo test'; do # expected sizes: less than 2Kb, 1Kb, 512 bytes, 16 bytes, ... if (echo_test_string="`eval $cmd`") 2>/dev/null && echo_test_string="`eval $cmd`" && (test "X$echo_test_string" = "X$echo_test_string") 2>/dev/null then break fi done fi if test "X`($echo '\t') 2>/dev/null`" = 'X\t' && echo_testing_string=`($echo "$echo_test_string") 2>/dev/null` && test "X$echo_testing_string" = "X$echo_test_string"; then : else # The Solaris, AIX, and Digital Unix default echo programs unquote # backslashes. This makes it impossible to quote backslashes using # echo "$something" | sed 's/\\/\\\\/g' # # So, first we look for a working echo in the user's PATH. lt_save_ifs="$IFS"; IFS=$PATH_SEPARATOR for dir in $PATH /usr/ucb; do IFS="$lt_save_ifs" if (test -f $dir/echo || test -f $dir/echo$ac_exeext) && test "X`($dir/echo '\t') 2>/dev/null`" = 'X\t' && echo_testing_string=`($dir/echo "$echo_test_string") 2>/dev/null` && test "X$echo_testing_string" = "X$echo_test_string"; then echo="$dir/echo" break fi done IFS="$lt_save_ifs" if test "X$echo" = Xecho; then # We didn't find a better echo, so look for alternatives. if test "X`(print -r '\t') 2>/dev/null`" = 'X\t' && echo_testing_string=`(print -r "$echo_test_string") 2>/dev/null` && test "X$echo_testing_string" = "X$echo_test_string"; then # This shell has a builtin print -r that does the trick. echo='print -r' elif (test -f /bin/ksh || test -f /bin/ksh$ac_exeext) && test "X$CONFIG_SHELL" != X/bin/ksh; then # If we have ksh, try running configure again with it. ORIGINAL_CONFIG_SHELL=${CONFIG_SHELL-/bin/sh} export ORIGINAL_CONFIG_SHELL CONFIG_SHELL=/bin/ksh export CONFIG_SHELL exec $CONFIG_SHELL "[$]0" --no-reexec ${1+"[$]@"} else # Try using printf. echo='printf %s\n' if test "X`($echo '\t') 2>/dev/null`" = 'X\t' && echo_testing_string=`($echo "$echo_test_string") 2>/dev/null` && test "X$echo_testing_string" = "X$echo_test_string"; then # Cool, printf works : elif echo_testing_string=`($ORIGINAL_CONFIG_SHELL "[$]0" --fallback-echo '\t') 2>/dev/null` && test "X$echo_testing_string" = 'X\t' && echo_testing_string=`($ORIGINAL_CONFIG_SHELL "[$]0" --fallback-echo "$echo_test_string") 2>/dev/null` && test "X$echo_testing_string" = "X$echo_test_string"; then CONFIG_SHELL=$ORIGINAL_CONFIG_SHELL export CONFIG_SHELL SHELL="$CONFIG_SHELL" export SHELL echo="$CONFIG_SHELL [$]0 --fallback-echo" elif echo_testing_string=`($CONFIG_SHELL "[$]0" --fallback-echo '\t') 2>/dev/null` && test "X$echo_testing_string" = 'X\t' && echo_testing_string=`($CONFIG_SHELL "[$]0" --fallback-echo "$echo_test_string") 2>/dev/null` && test "X$echo_testing_string" = "X$echo_test_string"; then echo="$CONFIG_SHELL [$]0 --fallback-echo" else # maybe with a smaller string... prev=: for cmd in 'echo test' 'sed 2q "[$]0"' 'sed 10q "[$]0"' 'sed 20q "[$]0"' 'sed 50q "[$]0"'; do if (test "X$echo_test_string" = "X`eval $cmd`") 2>/dev/null then break fi prev="$cmd" done if test "$prev" != 'sed 50q "[$]0"'; then echo_test_string=`eval $prev` export echo_test_string exec ${ORIGINAL_CONFIG_SHELL-${CONFIG_SHELL-/bin/sh}} "[$]0" ${1+"[$]@"} else # Oops. We lost completely, so just stick with echo. echo=echo fi fi fi fi fi fi # Copy echo and quote the copy suitably for passing to libtool from # the Makefile, instead of quoting the original, which is used later. ECHO=$echo if test "X$ECHO" = "X$CONFIG_SHELL [$]0 --fallback-echo"; then ECHO="$CONFIG_SHELL \\\$\[$]0 --fallback-echo" fi AC_SUBST(ECHO) ])])# _LT_AC_PROG_ECHO_BACKSLASH # _LT_AC_LOCK # ----------- AC_DEFUN([_LT_AC_LOCK], [AC_ARG_ENABLE([libtool-lock], [AC_HELP_STRING([--disable-libtool-lock], [avoid locking (might break parallel builds)])]) test "x$enable_libtool_lock" != xno && enable_libtool_lock=yes # Some flags need to be propagated to the compiler or linker for good # libtool support. case $host in ia64-*-hpux*) # Find out which ABI we are using. echo 'int i;' > conftest.$ac_ext if AC_TRY_EVAL(ac_compile); then case `/usr/bin/file conftest.$ac_objext` in *ELF-32*) HPUX_IA64_MODE="32" ;; *ELF-64*) HPUX_IA64_MODE="64" ;; esac fi rm -rf conftest* ;; *-*-irix6*) # Find out which ABI we are using. echo '[#]line __oline__ "configure"' > conftest.$ac_ext if AC_TRY_EVAL(ac_compile); then if test "$lt_cv_prog_gnu_ld" = yes; then case `/usr/bin/file conftest.$ac_objext` in *32-bit*) LD="${LD-ld} -melf32bsmip" ;; *N32*) LD="${LD-ld} -melf32bmipn32" ;; *64-bit*) LD="${LD-ld} -melf64bmip" ;; esac else case `/usr/bin/file conftest.$ac_objext` in *32-bit*) LD="${LD-ld} -32" ;; *N32*) LD="${LD-ld} -n32" ;; *64-bit*) LD="${LD-ld} -64" ;; esac fi fi rm -rf conftest* ;; x86_64-*linux*|ppc*-*linux*|powerpc*-*linux*|s390*-*linux*|sparc*-*linux*) # Find out which ABI we are using. echo 'int i;' > conftest.$ac_ext if AC_TRY_EVAL(ac_compile); then case "`/usr/bin/file conftest.o`" in *32-bit*) case $host in x86_64-*linux*) LD="${LD-ld} -m elf_i386" ;; ppc64-*linux*|powerpc64-*linux*) LD="${LD-ld} -m elf32ppclinux" ;; s390x-*linux*) LD="${LD-ld} -m elf_s390" ;; sparc64-*linux*) LD="${LD-ld} -m elf32_sparc" ;; esac ;; *64-bit*) case $host in x86_64-*linux*) LD="${LD-ld} -m elf_x86_64" ;; ppc*-*linux*|powerpc*-*linux*) LD="${LD-ld} -m elf64ppc" ;; s390*-*linux*) LD="${LD-ld} -m elf64_s390" ;; sparc*-*linux*) LD="${LD-ld} -m elf64_sparc" ;; esac ;; esac fi rm -rf conftest* ;; *-*-sco3.2v5*) # On SCO OpenServer 5, we need -belf to get full-featured binaries. SAVE_CFLAGS="$CFLAGS" CFLAGS="$CFLAGS -belf" AC_CACHE_CHECK([whether the C compiler needs -belf], lt_cv_cc_needs_belf, [AC_LANG_PUSH(C) AC_TRY_LINK([],[],[lt_cv_cc_needs_belf=yes],[lt_cv_cc_needs_belf=no]) AC_LANG_POP]) if test x"$lt_cv_cc_needs_belf" != x"yes"; then # this is probably gcc 2.8.0, egcs 1.0 or newer; no need for -belf CFLAGS="$SAVE_CFLAGS" fi ;; AC_PROVIDE_IFELSE([AC_LIBTOOL_WIN32_DLL], [*-*-cygwin* | *-*-mingw* | *-*-pw32*) AC_CHECK_TOOL(DLLTOOL, dlltool, false) AC_CHECK_TOOL(AS, as, false) AC_CHECK_TOOL(OBJDUMP, objdump, false) ;; ]) esac need_locks="$enable_libtool_lock" ])# _LT_AC_LOCK # AC_LIBTOOL_COMPILER_OPTION(MESSAGE, VARIABLE-NAME, FLAGS, # [OUTPUT-FILE], [ACTION-SUCCESS], [ACTION-FAILURE]) # ---------------------------------------------------------------- # Check whether the given compiler option works AC_DEFUN([AC_LIBTOOL_COMPILER_OPTION], [AC_REQUIRE([LT_AC_PROG_SED]) AC_CACHE_CHECK([$1], [$2], [$2=no ifelse([$4], , [ac_outfile=conftest.$ac_objext], [ac_outfile=$4]) printf "$lt_simple_compile_test_code" > conftest.$ac_ext lt_compiler_flag="$3" # Insert the option either (1) after the last *FLAGS variable, or # (2) before a word containing "conftest.", or (3) at the end. # Note that $ac_compile itself does not contain backslashes and begins # with a dollar sign (not a hyphen), so the echo should work correctly. # The option is referenced via a variable to avoid confusing sed. lt_compile=`echo "$ac_compile" | $SED \ -e 's:.*FLAGS}? :&$lt_compiler_flag :; t' \ -e 's: [[^ ]]*conftest\.: $lt_compiler_flag&:; t' \ -e 's:$: $lt_compiler_flag:'` (eval echo "\"\$as_me:__oline__: $lt_compile\"" >&AS_MESSAGE_LOG_FD) (eval "$lt_compile" 2>conftest.err) ac_status=$? cat conftest.err >&AS_MESSAGE_LOG_FD echo "$as_me:__oline__: \$? = $ac_status" >&AS_MESSAGE_LOG_FD if (exit $ac_status) && test -s "$ac_outfile"; then # The compiler can only warn and ignore the option if not recognized # So say no if there are warnings if test ! -s conftest.err; then $2=yes fi fi $rm conftest* ]) if test x"[$]$2" = xyes; then ifelse([$5], , :, [$5]) else ifelse([$6], , :, [$6]) fi ])# AC_LIBTOOL_COMPILER_OPTION # AC_LIBTOOL_LINKER_OPTION(MESSAGE, VARIABLE-NAME, FLAGS, # [ACTION-SUCCESS], [ACTION-FAILURE]) # ------------------------------------------------------------ # Check whether the given compiler option works AC_DEFUN([AC_LIBTOOL_LINKER_OPTION], [AC_CACHE_CHECK([$1], [$2], [$2=no save_LDFLAGS="$LDFLAGS" LDFLAGS="$LDFLAGS $3" printf "$lt_simple_link_test_code" > conftest.$ac_ext if (eval $ac_link 2>conftest.err) && test -s conftest$ac_exeext; then # The compiler can only warn and ignore the option if not recognized # So say no if there are warnings if test -s conftest.err; then # Append any errors to the config.log. cat conftest.err 1>&AS_MESSAGE_LOG_FD else $2=yes fi fi $rm conftest* LDFLAGS="$save_LDFLAGS" ]) if test x"[$]$2" = xyes; then ifelse([$4], , :, [$4]) else ifelse([$5], , :, [$5]) fi ])# AC_LIBTOOL_LINKER_OPTION # AC_LIBTOOL_SYS_MAX_CMD_LEN # -------------------------- AC_DEFUN([AC_LIBTOOL_SYS_MAX_CMD_LEN], [# find the maximum length of command line arguments AC_MSG_CHECKING([the maximum length of command line arguments]) AC_CACHE_VAL([lt_cv_sys_max_cmd_len], [dnl i=0 teststring="ABCD" case $build_os in msdosdjgpp*) # On DJGPP, this test can blow up pretty badly due to problems in libc # (any single argument exceeding 2000 bytes causes a buffer overrun # during glob expansion). Even if it were fixed, the result of this # check would be larger than it should be. lt_cv_sys_max_cmd_len=12288; # 12K is about right ;; gnu*) # Under GNU Hurd, this test is not required because there is # no limit to the length of command line arguments. # Libtool will interpret -1 as no limit whatsoever lt_cv_sys_max_cmd_len=-1; ;; cygwin* | mingw*) # On Win9x/ME, this test blows up -- it succeeds, but takes # about 5 minutes as the teststring grows exponentially. # Worse, since 9x/ME are not pre-emptively multitasking, # you end up with a "frozen" computer, even though with patience # the test eventually succeeds (with a max line length of 256k). # Instead, let's just punt: use the minimum linelength reported by # all of the supported platforms: 8192 (on NT/2K/XP). lt_cv_sys_max_cmd_len=8192; ;; amigaos*) # On AmigaOS with pdksh, this test takes hours, literally. # So we just punt and use a minimum line length of 8192. lt_cv_sys_max_cmd_len=8192; ;; netbsd* | freebsd* | openbsd* | darwin* ) # This has been around since 386BSD, at least. Likely further. if test -x /sbin/sysctl; then lt_cv_sys_max_cmd_len=`/sbin/sysctl -n kern.argmax` elif test -x /usr/sbin/sysctl; then lt_cv_sys_max_cmd_len=`/usr/sbin/sysctl -n kern.argmax` else lt_cv_sys_max_cmd_len=65536 # usable default for *BSD fi # And add a safety zone lt_cv_sys_max_cmd_len=`expr $lt_cv_sys_max_cmd_len \/ 4` ;; *) # If test is not a shell built-in, we'll probably end up computing a # maximum length that is only half of the actual maximum length, but # we can't tell. SHELL=${SHELL-${CONFIG_SHELL-/bin/sh}} while (test "X"`$SHELL [$]0 --fallback-echo "X$teststring" 2>/dev/null` \ = "XX$teststring") >/dev/null 2>&1 && new_result=`expr "X$teststring" : ".*" 2>&1` && lt_cv_sys_max_cmd_len=$new_result && test $i != 17 # 1/2 MB should be enough do i=`expr $i + 1` teststring=$teststring$teststring done teststring= # Add a significant safety factor because C++ compilers can tack on massive # amounts of additional arguments before passing them to the linker. # It appears as though 1/2 is a usable value. lt_cv_sys_max_cmd_len=`expr $lt_cv_sys_max_cmd_len \/ 2` ;; esac ]) if test -n $lt_cv_sys_max_cmd_len ; then AC_MSG_RESULT($lt_cv_sys_max_cmd_len) else AC_MSG_RESULT(none) fi ])# AC_LIBTOOL_SYS_MAX_CMD_LEN # _LT_AC_CHECK_DLFCN # -------------------- AC_DEFUN([_LT_AC_CHECK_DLFCN], [AC_CHECK_HEADERS(dlfcn.h)dnl ])# _LT_AC_CHECK_DLFCN # _LT_AC_TRY_DLOPEN_SELF (ACTION-IF-TRUE, ACTION-IF-TRUE-W-USCORE, # ACTION-IF-FALSE, ACTION-IF-CROSS-COMPILING) # ------------------------------------------------------------------ AC_DEFUN([_LT_AC_TRY_DLOPEN_SELF], [AC_REQUIRE([_LT_AC_CHECK_DLFCN])dnl if test "$cross_compiling" = yes; then : [$4] else lt_dlunknown=0; lt_dlno_uscore=1; lt_dlneed_uscore=2 lt_status=$lt_dlunknown cat > conftest.$ac_ext < #endif #include #ifdef RTLD_GLOBAL # define LT_DLGLOBAL RTLD_GLOBAL #else # ifdef DL_GLOBAL # define LT_DLGLOBAL DL_GLOBAL # else # define LT_DLGLOBAL 0 # endif #endif /* We may have to define LT_DLLAZY_OR_NOW in the command line if we find out it does not work in some platform. */ #ifndef LT_DLLAZY_OR_NOW # ifdef RTLD_LAZY # define LT_DLLAZY_OR_NOW RTLD_LAZY # else # ifdef DL_LAZY # define LT_DLLAZY_OR_NOW DL_LAZY # else # ifdef RTLD_NOW # define LT_DLLAZY_OR_NOW RTLD_NOW # else # ifdef DL_NOW # define LT_DLLAZY_OR_NOW DL_NOW # else # define LT_DLLAZY_OR_NOW 0 # endif # endif # endif # endif #endif #ifdef __cplusplus extern "C" void exit (int); #endif void fnord() { int i=42;} int main () { void *self = dlopen (0, LT_DLGLOBAL|LT_DLLAZY_OR_NOW); int status = $lt_dlunknown; if (self) { if (dlsym (self,"fnord")) status = $lt_dlno_uscore; else if (dlsym( self,"_fnord")) status = $lt_dlneed_uscore; /* dlclose (self); */ } exit (status); }] EOF if AC_TRY_EVAL(ac_link) && test -s conftest${ac_exeext} 2>/dev/null; then (./conftest; exit; ) 2>/dev/null lt_status=$? case x$lt_status in x$lt_dlno_uscore) $1 ;; x$lt_dlneed_uscore) $2 ;; x$lt_unknown|x*) $3 ;; esac else : # compilation failed $3 fi fi rm -fr conftest* ])# _LT_AC_TRY_DLOPEN_SELF # AC_LIBTOOL_DLOPEN_SELF # ------------------- AC_DEFUN([AC_LIBTOOL_DLOPEN_SELF], [AC_REQUIRE([_LT_AC_CHECK_DLFCN])dnl if test "x$enable_dlopen" != xyes; then enable_dlopen=unknown enable_dlopen_self=unknown enable_dlopen_self_static=unknown else lt_cv_dlopen=no lt_cv_dlopen_libs= case $host_os in beos*) lt_cv_dlopen="load_add_on" lt_cv_dlopen_libs= lt_cv_dlopen_self=yes ;; mingw* | pw32*) lt_cv_dlopen="LoadLibrary" lt_cv_dlopen_libs= ;; cygwin*) lt_cv_dlopen="dlopen" lt_cv_dlopen_libs= ;; darwin*) # if libdl is installed we need to link against it AC_CHECK_LIB([dl], [dlopen], [lt_cv_dlopen="dlopen" lt_cv_dlopen_libs="-ldl"],[ lt_cv_dlopen="dyld" lt_cv_dlopen_libs= lt_cv_dlopen_self=yes ]) ;; *) AC_CHECK_FUNC([shl_load], [lt_cv_dlopen="shl_load"], [AC_CHECK_LIB([dld], [shl_load], [lt_cv_dlopen="shl_load" lt_cv_dlopen_libs="-dld"], [AC_CHECK_FUNC([dlopen], [lt_cv_dlopen="dlopen"], [AC_CHECK_LIB([dl], [dlopen], [lt_cv_dlopen="dlopen" lt_cv_dlopen_libs="-ldl"], [AC_CHECK_LIB([svld], [dlopen], [lt_cv_dlopen="dlopen" lt_cv_dlopen_libs="-lsvld"], [AC_CHECK_LIB([dld], [dld_link], [lt_cv_dlopen="dld_link" lt_cv_dlopen_libs="-dld"]) ]) ]) ]) ]) ]) ;; esac if test "x$lt_cv_dlopen" != xno; then enable_dlopen=yes else enable_dlopen=no fi case $lt_cv_dlopen in dlopen) save_CPPFLAGS="$CPPFLAGS" test "x$ac_cv_header_dlfcn_h" = xyes && CPPFLAGS="$CPPFLAGS -DHAVE_DLFCN_H" save_LDFLAGS="$LDFLAGS" eval LDFLAGS=\"\$LDFLAGS $export_dynamic_flag_spec\" save_LIBS="$LIBS" LIBS="$lt_cv_dlopen_libs $LIBS" AC_CACHE_CHECK([whether a program can dlopen itself], lt_cv_dlopen_self, [dnl _LT_AC_TRY_DLOPEN_SELF( lt_cv_dlopen_self=yes, lt_cv_dlopen_self=yes, lt_cv_dlopen_self=no, lt_cv_dlopen_self=cross) ]) if test "x$lt_cv_dlopen_self" = xyes; then LDFLAGS="$LDFLAGS $link_static_flag" AC_CACHE_CHECK([whether a statically linked program can dlopen itself], lt_cv_dlopen_self_static, [dnl _LT_AC_TRY_DLOPEN_SELF( lt_cv_dlopen_self_static=yes, lt_cv_dlopen_self_static=yes, lt_cv_dlopen_self_static=no, lt_cv_dlopen_self_static=cross) ]) fi CPPFLAGS="$save_CPPFLAGS" LDFLAGS="$save_LDFLAGS" LIBS="$save_LIBS" ;; esac case $lt_cv_dlopen_self in yes|no) enable_dlopen_self=$lt_cv_dlopen_self ;; *) enable_dlopen_self=unknown ;; esac case $lt_cv_dlopen_self_static in yes|no) enable_dlopen_self_static=$lt_cv_dlopen_self_static ;; *) enable_dlopen_self_static=unknown ;; esac fi ])# AC_LIBTOOL_DLOPEN_SELF # AC_LIBTOOL_PROG_CC_C_O([TAGNAME]) # --------------------------------- # Check to see if options -c and -o are simultaneously supported by compiler AC_DEFUN([AC_LIBTOOL_PROG_CC_C_O], [AC_REQUIRE([_LT_AC_SYS_COMPILER])dnl AC_CACHE_CHECK([if $compiler supports -c -o file.$ac_objext], [_LT_AC_TAGVAR(lt_cv_prog_compiler_c_o, $1)], [_LT_AC_TAGVAR(lt_cv_prog_compiler_c_o, $1)=no $rm -r conftest 2>/dev/null mkdir conftest cd conftest mkdir out printf "$lt_simple_compile_test_code" > conftest.$ac_ext lt_compiler_flag="-o out/conftest2.$ac_objext" # Insert the option either (1) after the last *FLAGS variable, or # (2) before a word containing "conftest.", or (3) at the end. # Note that $ac_compile itself does not contain backslashes and begins # with a dollar sign (not a hyphen), so the echo should work correctly. lt_compile=`echo "$ac_compile" | $SED \ -e 's:.*FLAGS}? :&$lt_compiler_flag :; t' \ -e 's: [[^ ]]*conftest\.: $lt_compiler_flag&:; t' \ -e 's:$: $lt_compiler_flag:'` (eval echo "\"\$as_me:__oline__: $lt_compile\"" >&AS_MESSAGE_LOG_FD) (eval "$lt_compile" 2>out/conftest.err) ac_status=$? cat out/conftest.err >&AS_MESSAGE_LOG_FD echo "$as_me:__oline__: \$? = $ac_status" >&AS_MESSAGE_LOG_FD if (exit $ac_status) && test -s out/conftest2.$ac_objext then # The compiler can only warn and ignore the option if not recognized # So say no if there are warnings if test ! -s out/conftest.err; then _LT_AC_TAGVAR(lt_cv_prog_compiler_c_o, $1)=yes fi fi chmod u+w . $rm conftest* # SGI C++ compiler will create directory out/ii_files/ for # template instantiation test -d out/ii_files && $rm out/ii_files/* && rmdir out/ii_files $rm out/* && rmdir out cd .. rmdir conftest $rm conftest* ]) ])# AC_LIBTOOL_PROG_CC_C_O # AC_LIBTOOL_SYS_HARD_LINK_LOCKS([TAGNAME]) # ----------------------------------------- # Check to see if we can do hard links to lock some files if needed AC_DEFUN([AC_LIBTOOL_SYS_HARD_LINK_LOCKS], [AC_REQUIRE([_LT_AC_LOCK])dnl hard_links="nottested" if test "$_LT_AC_TAGVAR(lt_cv_prog_compiler_c_o, $1)" = no && test "$need_locks" != no; then # do not overwrite the value of need_locks provided by the user AC_MSG_CHECKING([if we can lock with hard links]) hard_links=yes $rm conftest* ln conftest.a conftest.b 2>/dev/null && hard_links=no touch conftest.a ln conftest.a conftest.b 2>&5 || hard_links=no ln conftest.a conftest.b 2>/dev/null && hard_links=no AC_MSG_RESULT([$hard_links]) if test "$hard_links" = no; then AC_MSG_WARN([`$CC' does not support `-c -o', so `make -j' may be unsafe]) need_locks=warn fi else need_locks=no fi ])# AC_LIBTOOL_SYS_HARD_LINK_LOCKS # AC_LIBTOOL_OBJDIR # ----------------- AC_DEFUN([AC_LIBTOOL_OBJDIR], [AC_CACHE_CHECK([for objdir], [lt_cv_objdir], [rm -f .libs 2>/dev/null mkdir .libs 2>/dev/null if test -d .libs; then lt_cv_objdir=.libs else # MS-DOS does not allow filenames that begin with a dot. lt_cv_objdir=_libs fi rmdir .libs 2>/dev/null]) objdir=$lt_cv_objdir ])# AC_LIBTOOL_OBJDIR # AC_LIBTOOL_PROG_LD_HARDCODE_LIBPATH([TAGNAME]) # ---------------------------------------------- # Check hardcoding attributes. AC_DEFUN([AC_LIBTOOL_PROG_LD_HARDCODE_LIBPATH], [AC_MSG_CHECKING([how to hardcode library paths into programs]) _LT_AC_TAGVAR(hardcode_action, $1)= if test -n "$_LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)" || \ test -n "$_LT_AC_TAGVAR(runpath_var, $1)" || \ test "X$_LT_AC_TAGVAR(hardcode_automatic, $1)" = "Xyes" ; then # We can hardcode non-existant directories. if test "$_LT_AC_TAGVAR(hardcode_direct, $1)" != no && # If the only mechanism to avoid hardcoding is shlibpath_var, we # have to relink, otherwise we might link with an installed library # when we should be linking with a yet-to-be-installed one ## test "$_LT_AC_TAGVAR(hardcode_shlibpath_var, $1)" != no && test "$_LT_AC_TAGVAR(hardcode_minus_L, $1)" != no; then # Linking always hardcodes the temporary library directory. _LT_AC_TAGVAR(hardcode_action, $1)=relink else # We can link without hardcoding, and we can hardcode nonexisting dirs. _LT_AC_TAGVAR(hardcode_action, $1)=immediate fi else # We cannot hardcode anything, or else we can only hardcode existing # directories. _LT_AC_TAGVAR(hardcode_action, $1)=unsupported fi AC_MSG_RESULT([$_LT_AC_TAGVAR(hardcode_action, $1)]) if test "$_LT_AC_TAGVAR(hardcode_action, $1)" = relink; then # Fast installation is not supported enable_fast_install=no elif test "$shlibpath_overrides_runpath" = yes || test "$enable_shared" = no; then # Fast installation is not necessary enable_fast_install=needless fi ])# AC_LIBTOOL_PROG_LD_HARDCODE_LIBPATH # AC_LIBTOOL_SYS_LIB_STRIP # ------------------------ AC_DEFUN([AC_LIBTOOL_SYS_LIB_STRIP], [striplib= old_striplib= AC_MSG_CHECKING([whether stripping libraries is possible]) if test -n "$STRIP" && $STRIP -V 2>&1 | grep "GNU strip" >/dev/null; then test -z "$old_striplib" && old_striplib="$STRIP --strip-debug" test -z "$striplib" && striplib="$STRIP --strip-unneeded" AC_MSG_RESULT([yes]) else # FIXME - insert some real tests, host_os isn't really good enough case $host_os in darwin*) if test -n "$STRIP" ; then striplib="$STRIP -x" AC_MSG_RESULT([yes]) else AC_MSG_RESULT([no]) fi ;; *) AC_MSG_RESULT([no]) ;; esac fi ])# AC_LIBTOOL_SYS_LIB_STRIP # AC_LIBTOOL_SYS_DYNAMIC_LINKER # ----------------------------- # PORTME Fill in your ld.so characteristics AC_DEFUN([AC_LIBTOOL_SYS_DYNAMIC_LINKER], [AC_MSG_CHECKING([dynamic linker characteristics]) library_names_spec= libname_spec='lib$name' soname_spec= shrext_cmds=".so" postinstall_cmds= postuninstall_cmds= finish_cmds= finish_eval= shlibpath_var= shlibpath_overrides_runpath=unknown version_type=none dynamic_linker="$host_os ld.so" sys_lib_dlsearch_path_spec="/lib /usr/lib" if test "$GCC" = yes; then sys_lib_search_path_spec=`$CC -print-search-dirs | grep "^libraries:" | $SED -e "s/^libraries://" -e "s,=/,/,g"` if echo "$sys_lib_search_path_spec" | grep ';' >/dev/null ; then # if the path contains ";" then we assume it to be the separator # otherwise default to the standard path separator (i.e. ":") - it is # assumed that no part of a normal pathname contains ";" but that should # okay in the real world where ";" in dirpaths is itself problematic. sys_lib_search_path_spec=`echo "$sys_lib_search_path_spec" | $SED -e 's/;/ /g'` else sys_lib_search_path_spec=`echo "$sys_lib_search_path_spec" | $SED -e "s/$PATH_SEPARATOR/ /g"` fi else sys_lib_search_path_spec="/lib /usr/lib /usr/local/lib" fi need_lib_prefix=unknown hardcode_into_libs=no # when you set need_version to no, make sure it does not cause -set_version # flags to be left without arguments need_version=unknown case $host_os in aix3*) version_type=linux library_names_spec='${libname}${release}${shared_ext}$versuffix $libname.a' shlibpath_var=LIBPATH # AIX 3 has no versioning support, so we append a major version to the name. soname_spec='${libname}${release}${shared_ext}$major' ;; aix4* | aix5*) version_type=linux need_lib_prefix=no need_version=no hardcode_into_libs=yes if test "$host_cpu" = ia64; then # AIX 5 supports IA64 library_names_spec='${libname}${release}${shared_ext}$major ${libname}${release}${shared_ext}$versuffix $libname${shared_ext}' shlibpath_var=LD_LIBRARY_PATH else # With GCC up to 2.95.x, collect2 would create an import file # for dependence libraries. The import file would start with # the line `#! .'. This would cause the generated library to # depend on `.', always an invalid library. This was fixed in # development snapshots of GCC prior to 3.0. case $host_os in aix4 | aix4.[[01]] | aix4.[[01]].*) if { echo '#if __GNUC__ > 2 || (__GNUC__ == 2 && __GNUC_MINOR__ >= 97)' echo ' yes ' echo '#endif'; } | ${CC} -E - | grep yes > /dev/null; then : else can_build_shared=no fi ;; esac # AIX (on Power*) has no versioning support, so currently we can not hardcode correct # soname into executable. Probably we can add versioning support to # collect2, so additional links can be useful in future. if test "$aix_use_runtimelinking" = yes; then # If using run time linking (on AIX 4.2 or later) use lib.so # instead of lib.a to let people know that these are not # typical AIX shared libraries. library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' else # We preserve .a as extension for shared libraries through AIX4.2 # and later when we are not doing run time linking. library_names_spec='${libname}${release}.a $libname.a' soname_spec='${libname}${release}${shared_ext}$major' fi shlibpath_var=LIBPATH fi ;; amigaos*) library_names_spec='$libname.ixlibrary $libname.a' # Create ${libname}_ixlibrary.a entries in /sys/libs. finish_eval='for lib in `ls $libdir/*.ixlibrary 2>/dev/null`; do libname=`$echo "X$lib" | $Xsed -e '\''s%^.*/\([[^/]]*\)\.ixlibrary$%\1%'\''`; test $rm /sys/libs/${libname}_ixlibrary.a; $show "cd /sys/libs && $LN_S $lib ${libname}_ixlibrary.a"; cd /sys/libs && $LN_S $lib ${libname}_ixlibrary.a || exit 1; done' ;; beos*) library_names_spec='${libname}${shared_ext}' dynamic_linker="$host_os ld.so" shlibpath_var=LIBRARY_PATH ;; bsdi[[45]]*) version_type=linux need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' finish_cmds='PATH="\$PATH:/sbin" ldconfig $libdir' shlibpath_var=LD_LIBRARY_PATH sys_lib_search_path_spec="/shlib /usr/lib /usr/X11/lib /usr/contrib/lib /lib /usr/local/lib" sys_lib_dlsearch_path_spec="/shlib /usr/lib /usr/local/lib" # the default ld.so.conf also contains /usr/contrib/lib and # /usr/X11R6/lib (/usr/X11 is a link to /usr/X11R6), but let us allow # libtool to hard-code these into programs ;; cygwin* | mingw* | pw32*) version_type=windows shrext_cmds=".dll" need_version=no need_lib_prefix=no case $GCC,$host_os in yes,cygwin* | yes,mingw* | yes,pw32*) library_names_spec='$libname.dll.a' # DLL is installed to $(libdir)/../bin by postinstall_cmds postinstall_cmds='base_file=`basename \${file}`~ dlpath=`$SHELL 2>&1 -c '\''. $dir/'\''\${base_file}'\''i;echo \$dlname'\''`~ dldir=$destdir/`dirname \$dlpath`~ test -d \$dldir || mkdir -p \$dldir~ $install_prog $dir/$dlname \$dldir/$dlname' postuninstall_cmds='dldll=`$SHELL 2>&1 -c '\''. $file; echo \$dlname'\''`~ dlpath=$dir/\$dldll~ $rm \$dlpath' shlibpath_overrides_runpath=yes case $host_os in cygwin*) # Cygwin DLLs use 'cyg' prefix rather than 'lib' soname_spec='`echo ${libname} | sed -e 's/^lib/cyg/'``echo ${release} | $SED -e 's/[[.]]/-/g'`${versuffix}${shared_ext}' sys_lib_search_path_spec="/usr/lib /lib/w32api /lib /usr/local/lib" ;; mingw*) # MinGW DLLs use traditional 'lib' prefix soname_spec='${libname}`echo ${release} | $SED -e 's/[[.]]/-/g'`${versuffix}${shared_ext}' sys_lib_search_path_spec=`$CC -print-search-dirs | grep "^libraries:" | $SED -e "s/^libraries://" -e "s,=/,/,g"` if echo "$sys_lib_search_path_spec" | [grep ';[c-zC-Z]:/' >/dev/null]; then # It is most probably a Windows format PATH printed by # mingw gcc, but we are running on Cygwin. Gcc prints its search # path with ; separators, and with drive letters. We can handle the # drive letters (cygwin fileutils understands them), so leave them, # especially as we might pass files found there to a mingw objdump, # which wouldn't understand a cygwinified path. Ahh. sys_lib_search_path_spec=`echo "$sys_lib_search_path_spec" | $SED -e 's/;/ /g'` else sys_lib_search_path_spec=`echo "$sys_lib_search_path_spec" | $SED -e "s/$PATH_SEPARATOR/ /g"` fi ;; pw32*) # pw32 DLLs use 'pw' prefix rather than 'lib' library_names_spec='`echo ${libname} | sed -e 's/^lib/pw/'``echo ${release} | $SED -e 's/[.]/-/g'`${versuffix}${shared_ext}' ;; esac ;; *) library_names_spec='${libname}`echo ${release} | $SED -e 's/[[.]]/-/g'`${versuffix}${shared_ext} $libname.lib' ;; esac dynamic_linker='Win32 ld.exe' # FIXME: first we should search . and the directory the executable is in shlibpath_var=PATH ;; darwin* | rhapsody*) dynamic_linker="$host_os dyld" version_type=darwin need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${versuffix}$shared_ext ${libname}${release}${major}$shared_ext ${libname}$shared_ext' soname_spec='${libname}${release}${major}$shared_ext' shlibpath_overrides_runpath=yes shlibpath_var=DYLD_LIBRARY_PATH shrext_cmds='$(test .$module = .yes && echo .so || echo .dylib)' # Apple's gcc prints 'gcc -print-search-dirs' doesn't operate the same. if test "$GCC" = yes; then sys_lib_search_path_spec=`$CC -print-search-dirs | tr "\n" "$PATH_SEPARATOR" | sed -e 's/libraries:/@libraries:/' | tr "@" "\n" | grep "^libraries:" | sed -e "s/^libraries://" -e "s,=/,/,g" -e "s,$PATH_SEPARATOR, ,g" -e "s,.*,& /lib /usr/lib /usr/local/lib,g"` else sys_lib_search_path_spec='/lib /usr/lib /usr/local/lib' fi sys_lib_dlsearch_path_spec='/usr/local/lib /lib /usr/lib' ;; dgux*) version_type=linux need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname$shared_ext' soname_spec='${libname}${release}${shared_ext}$major' shlibpath_var=LD_LIBRARY_PATH ;; freebsd1*) dynamic_linker=no ;; kfreebsd*-gnu) version_type=linux need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major ${libname}${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=no hardcode_into_libs=yes dynamic_linker='GNU ld.so' ;; freebsd*) objformat=`test -x /usr/bin/objformat && /usr/bin/objformat || echo aout` version_type=freebsd-$objformat case $version_type in freebsd-elf*) library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext} $libname${shared_ext}' need_version=no need_lib_prefix=no ;; freebsd-*) library_names_spec='${libname}${release}${shared_ext}$versuffix $libname${shared_ext}$versuffix' need_version=yes ;; esac shlibpath_var=LD_LIBRARY_PATH case $host_os in freebsd2*) shlibpath_overrides_runpath=yes ;; freebsd3.[01]* | freebsdelf3.[01]*) shlibpath_overrides_runpath=yes hardcode_into_libs=yes ;; *) # from 3.2 on shlibpath_overrides_runpath=no hardcode_into_libs=yes ;; esac ;; gnu*) version_type=linux need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}${major} ${libname}${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' shlibpath_var=LD_LIBRARY_PATH hardcode_into_libs=yes ;; hpux9* | hpux10* | hpux11*) # Give a soname corresponding to the major version so that dld.sl refuses to # link against other versions. version_type=sunos need_lib_prefix=no need_version=no case "$host_cpu" in ia64*) shrext_cmds='.so' hardcode_into_libs=yes dynamic_linker="$host_os dld.so" shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=yes # Unless +noenvvar is specified. library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' if test "X$HPUX_IA64_MODE" = X32; then sys_lib_search_path_spec="/usr/lib/hpux32 /usr/local/lib/hpux32 /usr/local/lib" else sys_lib_search_path_spec="/usr/lib/hpux64 /usr/local/lib/hpux64" fi sys_lib_dlsearch_path_spec=$sys_lib_search_path_spec ;; hppa*64*) shrext_cmds='.sl' hardcode_into_libs=yes dynamic_linker="$host_os dld.sl" shlibpath_var=LD_LIBRARY_PATH # How should we handle SHLIB_PATH shlibpath_overrides_runpath=yes # Unless +noenvvar is specified. library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' sys_lib_search_path_spec="/usr/lib/pa20_64 /usr/ccs/lib/pa20_64" sys_lib_dlsearch_path_spec=$sys_lib_search_path_spec ;; *) shrext_cmds='.sl' dynamic_linker="$host_os dld.sl" shlibpath_var=SHLIB_PATH shlibpath_overrides_runpath=no # +s is required to enable SHLIB_PATH library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' ;; esac # HP-UX runs *really* slowly unless shared libraries are mode 555. postinstall_cmds='chmod 555 $lib' ;; irix5* | irix6* | nonstopux*) case $host_os in nonstopux*) version_type=nonstopux ;; *) if test "$lt_cv_prog_gnu_ld" = yes; then version_type=linux else version_type=irix fi ;; esac need_lib_prefix=no need_version=no soname_spec='${libname}${release}${shared_ext}$major' library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major ${libname}${release}${shared_ext} $libname${shared_ext}' case $host_os in irix5* | nonstopux*) libsuff= shlibsuff= ;; *) case $LD in # libtool.m4 will add one of these switches to LD *-32|*"-32 "|*-melf32bsmip|*"-melf32bsmip ") libsuff= shlibsuff= libmagic=32-bit;; *-n32|*"-n32 "|*-melf32bmipn32|*"-melf32bmipn32 ") libsuff=32 shlibsuff=N32 libmagic=N32;; *-64|*"-64 "|*-melf64bmip|*"-melf64bmip ") libsuff=64 shlibsuff=64 libmagic=64-bit;; *) libsuff= shlibsuff= libmagic=never-match;; esac ;; esac shlibpath_var=LD_LIBRARY${shlibsuff}_PATH shlibpath_overrides_runpath=no sys_lib_search_path_spec="/usr/lib${libsuff} /lib${libsuff} /usr/local/lib${libsuff}" sys_lib_dlsearch_path_spec="/usr/lib${libsuff} /lib${libsuff}" hardcode_into_libs=yes ;; # No shared lib support for Linux oldld, aout, or coff. linux*oldld* | linux*aout* | linux*coff*) dynamic_linker=no ;; # This must be Linux ELF. linux*) version_type=linux need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' finish_cmds='PATH="\$PATH:/sbin" ldconfig -n $libdir' shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=no # This implies no fast_install, which is unacceptable. # Some rework will be needed to allow for fast_install # before this can be enabled. hardcode_into_libs=yes # Append ld.so.conf contents to the search path if test -f /etc/ld.so.conf; then lt_ld_extra=`$SED -e 's/[:,\t]/ /g;s/=[^=]*$//;s/=[^= ]* / /g' /etc/ld.so.conf | tr '\n' ' '` sys_lib_dlsearch_path_spec="/lib /usr/lib $lt_ld_extra" fi # We used to test for /lib/ld.so.1 and disable shared libraries on # powerpc, because MkLinux only supported shared libraries with the # GNU dynamic linker. Since this was broken with cross compilers, # most powerpc-linux boxes support dynamic linking these days and # people can always --disable-shared, the test was removed, and we # assume the GNU/Linux dynamic linker is in use. dynamic_linker='GNU/Linux ld.so' ;; knetbsd*-gnu) version_type=linux need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major ${libname}${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=no hardcode_into_libs=yes dynamic_linker='GNU ld.so' ;; netbsd*) version_type=sunos need_lib_prefix=no need_version=no if echo __ELF__ | $CC -E - | grep __ELF__ >/dev/null; then library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${shared_ext}$versuffix' finish_cmds='PATH="\$PATH:/sbin" ldconfig -m $libdir' dynamic_linker='NetBSD (a.out) ld.so' else library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major ${libname}${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' dynamic_linker='NetBSD ld.elf_so' fi shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=yes hardcode_into_libs=yes ;; newsos6) version_type=linux library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=yes ;; nto-qnx*) version_type=linux need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=yes ;; openbsd*) version_type=sunos need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${shared_ext}$versuffix' finish_cmds='PATH="\$PATH:/sbin" ldconfig -m $libdir' shlibpath_var=LD_LIBRARY_PATH if test -z "`echo __ELF__ | $CC -E - | grep __ELF__`" || test "$host_os-$host_cpu" = "openbsd2.8-powerpc"; then case $host_os in openbsd2.[[89]] | openbsd2.[[89]].*) shlibpath_overrides_runpath=no ;; *) shlibpath_overrides_runpath=yes ;; esac else shlibpath_overrides_runpath=yes fi ;; os2*) libname_spec='$name' shrext_cmds=".dll" need_lib_prefix=no library_names_spec='$libname${shared_ext} $libname.a' dynamic_linker='OS/2 ld.exe' shlibpath_var=LIBPATH ;; osf3* | osf4* | osf5*) version_type=osf need_lib_prefix=no need_version=no soname_spec='${libname}${release}${shared_ext}$major' library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' shlibpath_var=LD_LIBRARY_PATH sys_lib_search_path_spec="/usr/shlib /usr/ccs/lib /usr/lib/cmplrs/cc /usr/lib /usr/local/lib /var/shlib" sys_lib_dlsearch_path_spec="$sys_lib_search_path_spec" ;; sco3.2v5*) version_type=osf soname_spec='${libname}${release}${shared_ext}$major' library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' shlibpath_var=LD_LIBRARY_PATH ;; solaris*) version_type=linux need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=yes hardcode_into_libs=yes # ldd complains unless libraries are executable postinstall_cmds='chmod +x $lib' ;; sunos4*) version_type=sunos library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${shared_ext}$versuffix' finish_cmds='PATH="\$PATH:/usr/etc" ldconfig $libdir' shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=yes if test "$with_gnu_ld" = yes; then need_lib_prefix=no fi need_version=yes ;; sysv4 | sysv4.2uw2* | sysv4.3* | sysv5*) version_type=linux library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' shlibpath_var=LD_LIBRARY_PATH case $host_vendor in sni) shlibpath_overrides_runpath=no need_lib_prefix=no export_dynamic_flag_spec='${wl}-Blargedynsym' runpath_var=LD_RUN_PATH ;; siemens) need_lib_prefix=no ;; motorola) need_lib_prefix=no need_version=no shlibpath_overrides_runpath=no sys_lib_search_path_spec='/lib /usr/lib /usr/ccs/lib' ;; esac ;; sysv4*MP*) if test -d /usr/nec ;then version_type=linux library_names_spec='$libname${shared_ext}.$versuffix $libname${shared_ext}.$major $libname${shared_ext}' soname_spec='$libname${shared_ext}.$major' shlibpath_var=LD_LIBRARY_PATH fi ;; uts4*) version_type=linux library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' shlibpath_var=LD_LIBRARY_PATH ;; *) dynamic_linker=no ;; esac AC_MSG_RESULT([$dynamic_linker]) test "$dynamic_linker" = no && can_build_shared=no ])# AC_LIBTOOL_SYS_DYNAMIC_LINKER # _LT_AC_TAGCONFIG # ---------------- AC_DEFUN([_LT_AC_TAGCONFIG], [AC_ARG_WITH([tags], [AC_HELP_STRING([--with-tags@<:@=TAGS@:>@], [include additional configurations @<:@automatic@:>@])], [tagnames="$withval"]) if test -f "$ltmain" && test -n "$tagnames"; then if test ! -f "${ofile}"; then AC_MSG_WARN([output file `$ofile' does not exist]) fi if test -z "$LTCC"; then eval "`$SHELL ${ofile} --config | grep '^LTCC='`" if test -z "$LTCC"; then AC_MSG_WARN([output file `$ofile' does not look like a libtool script]) else AC_MSG_WARN([using `LTCC=$LTCC', extracted from `$ofile']) fi fi # Extract list of available tagged configurations in $ofile. # Note that this assumes the entire list is on one line. available_tags=`grep "^available_tags=" "${ofile}" | $SED -e 's/available_tags=\(.*$\)/\1/' -e 's/\"//g'` lt_save_ifs="$IFS"; IFS="${IFS}$PATH_SEPARATOR," for tagname in $tagnames; do IFS="$lt_save_ifs" # Check whether tagname contains only valid characters case `$echo "X$tagname" | $Xsed -e 's:[[-_ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz1234567890,/]]::g'` in "") ;; *) AC_MSG_ERROR([invalid tag name: $tagname]) ;; esac if grep "^# ### BEGIN LIBTOOL TAG CONFIG: $tagname$" < "${ofile}" > /dev/null then AC_MSG_ERROR([tag name \"$tagname\" already exists]) fi # Update the list of available tags. if test -n "$tagname"; then echo appending configuration tag \"$tagname\" to $ofile case $tagname in CXX) if test -n "$CXX" && ( test "X$CXX" != "Xno" && ( (test "X$CXX" = "Xg++" && `g++ -v >/dev/null 2>&1` ) || (test "X$CXX" != "Xg++"))) ; then AC_LIBTOOL_LANG_CXX_CONFIG else tagname="" fi ;; F77) if test -n "$F77" && test "X$F77" != "Xno"; then AC_LIBTOOL_LANG_F77_CONFIG else tagname="" fi ;; GCJ) if test -n "$GCJ" && test "X$GCJ" != "Xno"; then AC_LIBTOOL_LANG_GCJ_CONFIG else tagname="" fi ;; RC) AC_LIBTOOL_LANG_RC_CONFIG ;; *) AC_MSG_ERROR([Unsupported tag name: $tagname]) ;; esac # Append the new tag name to the list of available tags. if test -n "$tagname" ; then available_tags="$available_tags $tagname" fi fi done IFS="$lt_save_ifs" # Now substitute the updated list of available tags. if eval "sed -e 's/^available_tags=.*\$/available_tags=\"$available_tags\"/' \"$ofile\" > \"${ofile}T\""; then mv "${ofile}T" "$ofile" chmod +x "$ofile" else rm -f "${ofile}T" AC_MSG_ERROR([unable to update list of available tagged configurations.]) fi fi ])# _LT_AC_TAGCONFIG # AC_LIBTOOL_DLOPEN # ----------------- # enable checks for dlopen support AC_DEFUN([AC_LIBTOOL_DLOPEN], [AC_BEFORE([$0],[AC_LIBTOOL_SETUP]) ])# AC_LIBTOOL_DLOPEN # AC_LIBTOOL_WIN32_DLL # -------------------- # declare package support for building win32 dll's AC_DEFUN([AC_LIBTOOL_WIN32_DLL], [AC_BEFORE([$0], [AC_LIBTOOL_SETUP]) ])# AC_LIBTOOL_WIN32_DLL # AC_ENABLE_SHARED([DEFAULT]) # --------------------------- # implement the --enable-shared flag # DEFAULT is either `yes' or `no'. If omitted, it defaults to `yes'. AC_DEFUN([AC_ENABLE_SHARED], [define([AC_ENABLE_SHARED_DEFAULT], ifelse($1, no, no, yes))dnl AC_ARG_ENABLE([shared], [AC_HELP_STRING([--enable-shared@<:@=PKGS@:>@], [build shared libraries @<:@default=]AC_ENABLE_SHARED_DEFAULT[@:>@])], [p=${PACKAGE-default} case $enableval in yes) enable_shared=yes ;; no) enable_shared=no ;; *) enable_shared=no # Look at the argument we got. We use all the common list separators. lt_save_ifs="$IFS"; IFS="${IFS}$PATH_SEPARATOR," for pkg in $enableval; do IFS="$lt_save_ifs" if test "X$pkg" = "X$p"; then enable_shared=yes fi done IFS="$lt_save_ifs" ;; esac], [enable_shared=]AC_ENABLE_SHARED_DEFAULT) ])# AC_ENABLE_SHARED # AC_DISABLE_SHARED # ----------------- #- set the default shared flag to --disable-shared AC_DEFUN([AC_DISABLE_SHARED], [AC_BEFORE([$0],[AC_LIBTOOL_SETUP])dnl AC_ENABLE_SHARED(no) ])# AC_DISABLE_SHARED # AC_ENABLE_STATIC([DEFAULT]) # --------------------------- # implement the --enable-static flag # DEFAULT is either `yes' or `no'. If omitted, it defaults to `yes'. AC_DEFUN([AC_ENABLE_STATIC], [define([AC_ENABLE_STATIC_DEFAULT], ifelse($1, no, no, yes))dnl AC_ARG_ENABLE([static], [AC_HELP_STRING([--enable-static@<:@=PKGS@:>@], [build static libraries @<:@default=]AC_ENABLE_STATIC_DEFAULT[@:>@])], [p=${PACKAGE-default} case $enableval in yes) enable_static=yes ;; no) enable_static=no ;; *) enable_static=no # Look at the argument we got. We use all the common list separators. lt_save_ifs="$IFS"; IFS="${IFS}$PATH_SEPARATOR," for pkg in $enableval; do IFS="$lt_save_ifs" if test "X$pkg" = "X$p"; then enable_static=yes fi done IFS="$lt_save_ifs" ;; esac], [enable_static=]AC_ENABLE_STATIC_DEFAULT) ])# AC_ENABLE_STATIC # AC_DISABLE_STATIC # ----------------- # set the default static flag to --disable-static AC_DEFUN([AC_DISABLE_STATIC], [AC_BEFORE([$0],[AC_LIBTOOL_SETUP])dnl AC_ENABLE_STATIC(no) ])# AC_DISABLE_STATIC # AC_ENABLE_FAST_INSTALL([DEFAULT]) # --------------------------------- # implement the --enable-fast-install flag # DEFAULT is either `yes' or `no'. If omitted, it defaults to `yes'. AC_DEFUN([AC_ENABLE_FAST_INSTALL], [define([AC_ENABLE_FAST_INSTALL_DEFAULT], ifelse($1, no, no, yes))dnl AC_ARG_ENABLE([fast-install], [AC_HELP_STRING([--enable-fast-install@<:@=PKGS@:>@], [optimize for fast installation @<:@default=]AC_ENABLE_FAST_INSTALL_DEFAULT[@:>@])], [p=${PACKAGE-default} case $enableval in yes) enable_fast_install=yes ;; no) enable_fast_install=no ;; *) enable_fast_install=no # Look at the argument we got. We use all the common list separators. lt_save_ifs="$IFS"; IFS="${IFS}$PATH_SEPARATOR," for pkg in $enableval; do IFS="$lt_save_ifs" if test "X$pkg" = "X$p"; then enable_fast_install=yes fi done IFS="$lt_save_ifs" ;; esac], [enable_fast_install=]AC_ENABLE_FAST_INSTALL_DEFAULT) ])# AC_ENABLE_FAST_INSTALL # AC_DISABLE_FAST_INSTALL # ----------------------- # set the default to --disable-fast-install AC_DEFUN([AC_DISABLE_FAST_INSTALL], [AC_BEFORE([$0],[AC_LIBTOOL_SETUP])dnl AC_ENABLE_FAST_INSTALL(no) ])# AC_DISABLE_FAST_INSTALL # AC_LIBTOOL_PICMODE([MODE]) # -------------------------- # implement the --with-pic flag # MODE is either `yes' or `no'. If omitted, it defaults to `both'. AC_DEFUN([AC_LIBTOOL_PICMODE], [AC_BEFORE([$0],[AC_LIBTOOL_SETUP])dnl pic_mode=ifelse($#,1,$1,default) ])# AC_LIBTOOL_PICMODE # AC_PROG_EGREP # ------------- # This is predefined starting with Autoconf 2.54, so this conditional # definition can be removed once we require Autoconf 2.54 or later. m4_ifndef([AC_PROG_EGREP], [AC_DEFUN([AC_PROG_EGREP], [AC_CACHE_CHECK([for egrep], [ac_cv_prog_egrep], [if echo a | (grep -E '(a|b)') >/dev/null 2>&1 then ac_cv_prog_egrep='grep -E' else ac_cv_prog_egrep='egrep' fi]) EGREP=$ac_cv_prog_egrep AC_SUBST([EGREP]) ])]) # AC_PATH_TOOL_PREFIX # ------------------- # find a file program which can recognise shared library AC_DEFUN([AC_PATH_TOOL_PREFIX], [AC_REQUIRE([AC_PROG_EGREP])dnl AC_MSG_CHECKING([for $1]) AC_CACHE_VAL(lt_cv_path_MAGIC_CMD, [case $MAGIC_CMD in [[\\/*] | ?:[\\/]*]) lt_cv_path_MAGIC_CMD="$MAGIC_CMD" # Let the user override the test with a path. ;; *) lt_save_MAGIC_CMD="$MAGIC_CMD" lt_save_ifs="$IFS"; IFS=$PATH_SEPARATOR dnl $ac_dummy forces splitting on constant user-supplied paths. dnl POSIX.2 word splitting is done only on the output of word expansions, dnl not every word. This closes a longstanding sh security hole. ac_dummy="ifelse([$2], , $PATH, [$2])" for ac_dir in $ac_dummy; do IFS="$lt_save_ifs" test -z "$ac_dir" && ac_dir=. if test -f $ac_dir/$1; then lt_cv_path_MAGIC_CMD="$ac_dir/$1" if test -n "$file_magic_test_file"; then case $deplibs_check_method in "file_magic "*) file_magic_regex="`expr \"$deplibs_check_method\" : \"file_magic \(.*\)\"`" MAGIC_CMD="$lt_cv_path_MAGIC_CMD" if eval $file_magic_cmd \$file_magic_test_file 2> /dev/null | $EGREP "$file_magic_regex" > /dev/null; then : else cat <&2 *** Warning: the command libtool uses to detect shared libraries, *** $file_magic_cmd, produces output that libtool cannot recognize. *** The result is that libtool may fail to recognize shared libraries *** as such. This will affect the creation of libtool libraries that *** depend on shared libraries, but programs linked with such libtool *** libraries will work regardless of this problem. Nevertheless, you *** may want to report the problem to your system manager and/or to *** bug-libtool@gnu.org EOF fi ;; esac fi break fi done IFS="$lt_save_ifs" MAGIC_CMD="$lt_save_MAGIC_CMD" ;; esac]) MAGIC_CMD="$lt_cv_path_MAGIC_CMD" if test -n "$MAGIC_CMD"; then AC_MSG_RESULT($MAGIC_CMD) else AC_MSG_RESULT(no) fi ])# AC_PATH_TOOL_PREFIX # AC_PATH_MAGIC # ------------- # find a file program which can recognise a shared library AC_DEFUN([AC_PATH_MAGIC], [AC_PATH_TOOL_PREFIX(${ac_tool_prefix}file, /usr/bin$PATH_SEPARATOR$PATH) if test -z "$lt_cv_path_MAGIC_CMD"; then if test -n "$ac_tool_prefix"; then AC_PATH_TOOL_PREFIX(file, /usr/bin$PATH_SEPARATOR$PATH) else MAGIC_CMD=: fi fi ])# AC_PATH_MAGIC # AC_PROG_LD # ---------- # find the pathname to the GNU or non-GNU linker AC_DEFUN([AC_PROG_LD], [AC_ARG_WITH([gnu-ld], [AC_HELP_STRING([--with-gnu-ld], [assume the C compiler uses GNU ld @<:@default=no@:>@])], [test "$withval" = no || with_gnu_ld=yes], [with_gnu_ld=no]) AC_REQUIRE([LT_AC_PROG_SED])dnl AC_REQUIRE([AC_PROG_CC])dnl AC_REQUIRE([AC_CANONICAL_HOST])dnl AC_REQUIRE([AC_CANONICAL_BUILD])dnl ac_prog=ld if test "$GCC" = yes; then # Check if gcc -print-prog-name=ld gives a path. AC_MSG_CHECKING([for ld used by $CC]) case $host in *-*-mingw*) # gcc leaves a trailing carriage return which upsets mingw ac_prog=`($CC -print-prog-name=ld) 2>&5 | tr -d '\015'` ;; *) ac_prog=`($CC -print-prog-name=ld) 2>&5` ;; esac case $ac_prog in # Accept absolute paths. [[\\/]]* | ?:[[\\/]]*) re_direlt='/[[^/]][[^/]]*/\.\./' # Canonicalize the pathname of ld ac_prog=`echo $ac_prog| $SED 's%\\\\%/%g'` while echo $ac_prog | grep "$re_direlt" > /dev/null 2>&1; do ac_prog=`echo $ac_prog| $SED "s%$re_direlt%/%"` done test -z "$LD" && LD="$ac_prog" ;; "") # If it fails, then pretend we aren't using GCC. ac_prog=ld ;; *) # If it is relative, then search for the first ld in PATH. with_gnu_ld=unknown ;; esac elif test "$with_gnu_ld" = yes; then AC_MSG_CHECKING([for GNU ld]) else AC_MSG_CHECKING([for non-GNU ld]) fi AC_CACHE_VAL(lt_cv_path_LD, [if test -z "$LD"; then lt_save_ifs="$IFS"; IFS=$PATH_SEPARATOR for ac_dir in $PATH; do IFS="$lt_save_ifs" test -z "$ac_dir" && ac_dir=. if test -f "$ac_dir/$ac_prog" || test -f "$ac_dir/$ac_prog$ac_exeext"; then lt_cv_path_LD="$ac_dir/$ac_prog" # Check to see if the program is GNU ld. I'd rather use --version, # but apparently some GNU ld's only accept -v. # Break only if it was the GNU/non-GNU ld that we prefer. case `"$lt_cv_path_LD" -v 2>&1 &1 /dev/null; then case $host_cpu in i*86 ) # Not sure whether the presence of OpenBSD here was a mistake. # Let's accept both of them until this is cleared up. lt_cv_deplibs_check_method='file_magic (FreeBSD|OpenBSD)/i[[3-9]]86 (compact )?demand paged shared library' lt_cv_file_magic_cmd=/usr/bin/file lt_cv_file_magic_test_file=`echo /usr/lib/libc.so.*` ;; esac else lt_cv_deplibs_check_method=pass_all fi ;; gnu*) lt_cv_deplibs_check_method=pass_all ;; hpux10.20* | hpux11*) lt_cv_file_magic_cmd=/usr/bin/file case "$host_cpu" in ia64*) lt_cv_deplibs_check_method='file_magic (s[[0-9]][[0-9]][[0-9]]|ELF-[[0-9]][[0-9]]) shared object file - IA64' lt_cv_file_magic_test_file=/usr/lib/hpux32/libc.so ;; hppa*64*) [lt_cv_deplibs_check_method='file_magic (s[0-9][0-9][0-9]|ELF-[0-9][0-9]) shared object file - PA-RISC [0-9].[0-9]'] lt_cv_file_magic_test_file=/usr/lib/pa20_64/libc.sl ;; *) lt_cv_deplibs_check_method='file_magic (s[[0-9]][[0-9]][[0-9]]|PA-RISC[[0-9]].[[0-9]]) shared library' lt_cv_file_magic_test_file=/usr/lib/libc.sl ;; esac ;; irix5* | irix6* | nonstopux*) case $LD in *-32|*"-32 ") libmagic=32-bit;; *-n32|*"-n32 ") libmagic=N32;; *-64|*"-64 ") libmagic=64-bit;; *) libmagic=never-match;; esac lt_cv_deplibs_check_method=pass_all ;; # This must be Linux ELF. linux*) lt_cv_deplibs_check_method=pass_all ;; netbsd*) if echo __ELF__ | $CC -E - | grep __ELF__ > /dev/null; then lt_cv_deplibs_check_method='match_pattern /lib[[^/]]+(\.so\.[[0-9]]+\.[[0-9]]+|_pic\.a)$' else lt_cv_deplibs_check_method='match_pattern /lib[[^/]]+(\.so|_pic\.a)$' fi ;; newos6*) lt_cv_deplibs_check_method='file_magic ELF [[0-9]][[0-9]]*-bit [[ML]]SB (executable|dynamic lib)' lt_cv_file_magic_cmd=/usr/bin/file lt_cv_file_magic_test_file=/usr/lib/libnls.so ;; nto-qnx*) lt_cv_deplibs_check_method=unknown ;; openbsd*) if test -z "`echo __ELF__ | $CC -E - | grep __ELF__`" || test "$host_os-$host_cpu" = "openbsd2.8-powerpc"; then lt_cv_deplibs_check_method='match_pattern /lib[[^/]]+(\.so\.[[0-9]]+\.[[0-9]]+|\.so|_pic\.a)$' else lt_cv_deplibs_check_method='match_pattern /lib[[^/]]+(\.so\.[[0-9]]+\.[[0-9]]+|_pic\.a)$' fi ;; osf3* | osf4* | osf5*) lt_cv_deplibs_check_method=pass_all ;; sco3.2v5*) lt_cv_deplibs_check_method=pass_all ;; solaris*) lt_cv_deplibs_check_method=pass_all ;; sysv4 | sysv4.2uw2* | sysv4.3* | sysv5*) case $host_vendor in motorola) lt_cv_deplibs_check_method='file_magic ELF [[0-9]][[0-9]]*-bit [[ML]]SB (shared object|dynamic lib) M[[0-9]][[0-9]]* Version [[0-9]]' lt_cv_file_magic_test_file=`echo /usr/lib/libc.so*` ;; ncr) lt_cv_deplibs_check_method=pass_all ;; sequent) lt_cv_file_magic_cmd='/bin/file' lt_cv_deplibs_check_method='file_magic ELF [[0-9]][[0-9]]*-bit [[LM]]SB (shared object|dynamic lib )' ;; sni) lt_cv_file_magic_cmd='/bin/file' lt_cv_deplibs_check_method="file_magic ELF [[0-9]][[0-9]]*-bit [[LM]]SB dynamic lib" lt_cv_file_magic_test_file=/lib/libc.so ;; siemens) lt_cv_deplibs_check_method=pass_all ;; esac ;; sysv5OpenUNIX8* | sysv5UnixWare7* | sysv5uw[[78]]* | unixware7* | sysv4*uw2*) lt_cv_deplibs_check_method=pass_all ;; esac ]) file_magic_cmd=$lt_cv_file_magic_cmd deplibs_check_method=$lt_cv_deplibs_check_method test -z "$deplibs_check_method" && deplibs_check_method=unknown ])# AC_DEPLIBS_CHECK_METHOD # AC_PROG_NM # ---------- # find the pathname to a BSD-compatible name lister AC_DEFUN([AC_PROG_NM], [AC_CACHE_CHECK([for BSD-compatible nm], lt_cv_path_NM, [if test -n "$NM"; then # Let the user override the test. lt_cv_path_NM="$NM" else lt_save_ifs="$IFS"; IFS=$PATH_SEPARATOR for ac_dir in $PATH /usr/ccs/bin /usr/ucb /bin; do IFS="$lt_save_ifs" test -z "$ac_dir" && ac_dir=. tmp_nm="$ac_dir/${ac_tool_prefix}nm" if test -f "$tmp_nm" || test -f "$tmp_nm$ac_exeext" ; then # Check to see if the nm accepts a BSD-compat flag. # Adding the `sed 1q' prevents false positives on HP-UX, which says: # nm: unknown option "B" ignored # Tru64's nm complains that /dev/null is an invalid object file case `"$tmp_nm" -B /dev/null 2>&1 | sed '1q'` in */dev/null* | *'Invalid file or object type'*) lt_cv_path_NM="$tmp_nm -B" break ;; *) case `"$tmp_nm" -p /dev/null 2>&1 | sed '1q'` in */dev/null*) lt_cv_path_NM="$tmp_nm -p" break ;; *) lt_cv_path_NM=${lt_cv_path_NM="$tmp_nm"} # keep the first match, but continue # so that we can try to find one that supports BSD flags ;; esac esac fi done IFS="$lt_save_ifs" test -z "$lt_cv_path_NM" && lt_cv_path_NM=nm fi]) NM="$lt_cv_path_NM" ])# AC_PROG_NM # AC_CHECK_LIBM # ------------- # check for math library AC_DEFUN([AC_CHECK_LIBM], [AC_REQUIRE([AC_CANONICAL_HOST])dnl LIBM= case $host in *-*-beos* | *-*-cygwin* | *-*-pw32* | *-*-darwin*) # These system don't have libm, or don't need it ;; *-ncr-sysv4.3*) AC_CHECK_LIB(mw, _mwvalidcheckl, LIBM="-lmw") AC_CHECK_LIB(m, cos, LIBM="$LIBM -lm") ;; *) AC_CHECK_LIB(m, cos, LIBM="-lm") ;; esac ])# AC_CHECK_LIBM # AC_LIBLTDL_CONVENIENCE([DIRECTORY]) # ----------------------------------- # sets LIBLTDL to the link flags for the libltdl convenience library and # LTDLINCL to the include flags for the libltdl header and adds # --enable-ltdl-convenience to the configure arguments. Note that LIBLTDL # and LTDLINCL are not AC_SUBSTed, nor is AC_CONFIG_SUBDIRS called. If # DIRECTORY is not provided, it is assumed to be `libltdl'. LIBLTDL will # be prefixed with '${top_builddir}/' and LTDLINCL will be prefixed with # '${top_srcdir}/' (note the single quotes!). If your package is not # flat and you're not using automake, define top_builddir and # top_srcdir appropriately in the Makefiles. AC_DEFUN([AC_LIBLTDL_CONVENIENCE], [AC_BEFORE([$0],[AC_LIBTOOL_SETUP])dnl case $enable_ltdl_convenience in no) AC_MSG_ERROR([this package needs a convenience libltdl]) ;; "") enable_ltdl_convenience=yes ac_configure_args="$ac_configure_args --enable-ltdl-convenience" ;; esac LIBLTDL='${top_builddir}/'ifelse($#,1,[$1],['libltdl'])/libltdlc.la LTDLINCL='-I${top_srcdir}/'ifelse($#,1,[$1],['libltdl']) # For backwards non-gettext consistent compatibility... INCLTDL="$LTDLINCL" ])# AC_LIBLTDL_CONVENIENCE # AC_LIBLTDL_INSTALLABLE([DIRECTORY]) # ----------------------------------- # sets LIBLTDL to the link flags for the libltdl installable library and # LTDLINCL to the include flags for the libltdl header and adds # --enable-ltdl-install to the configure arguments. Note that LIBLTDL # and LTDLINCL are not AC_SUBSTed, nor is AC_CONFIG_SUBDIRS called. If # DIRECTORY is not provided and an installed libltdl is not found, it is # assumed to be `libltdl'. LIBLTDL will be prefixed with '${top_builddir}/' # and LTDLINCL will be prefixed with '${top_srcdir}/' (note the single # quotes!). If your package is not flat and you're not using automake, # define top_builddir and top_srcdir appropriately in the Makefiles. # In the future, this macro may have to be called after AC_PROG_LIBTOOL. AC_DEFUN([AC_LIBLTDL_INSTALLABLE], [AC_BEFORE([$0],[AC_LIBTOOL_SETUP])dnl AC_CHECK_LIB(ltdl, lt_dlinit, [test x"$enable_ltdl_install" != xyes && enable_ltdl_install=no], [if test x"$enable_ltdl_install" = xno; then AC_MSG_WARN([libltdl not installed, but installation disabled]) else enable_ltdl_install=yes fi ]) if test x"$enable_ltdl_install" = x"yes"; then ac_configure_args="$ac_configure_args --enable-ltdl-install" LIBLTDL='${top_builddir}/'ifelse($#,1,[$1],['libltdl'])/libltdl.la LTDLINCL='-I${top_srcdir}/'ifelse($#,1,[$1],['libltdl']) else ac_configure_args="$ac_configure_args --enable-ltdl-install=no" LIBLTDL="-lltdl" LTDLINCL= fi # For backwards non-gettext consistent compatibility... INCLTDL="$LTDLINCL" ])# AC_LIBLTDL_INSTALLABLE # AC_LIBTOOL_CXX # -------------- # enable support for C++ libraries AC_DEFUN([AC_LIBTOOL_CXX], [AC_REQUIRE([_LT_AC_LANG_CXX]) ])# AC_LIBTOOL_CXX # _LT_AC_LANG_CXX # --------------- AC_DEFUN([_LT_AC_LANG_CXX], [AC_REQUIRE([AC_PROG_CXX]) AC_REQUIRE([_LT_AC_PROG_CXXCPP]) _LT_AC_SHELL_INIT([tagnames=${tagnames+${tagnames},}CXX]) ])# _LT_AC_LANG_CXX # _LT_AC_PROG_CXXCPP # --------------- AC_DEFUN([_LT_AC_PROG_CXXCPP], [ AC_REQUIRE([AC_PROG_CXX]) if test -n "$CXX" && ( test "X$CXX" != "Xno" && ( (test "X$CXX" = "Xg++" && `g++ -v >/dev/null 2>&1` ) || (test "X$CXX" != "Xg++"))) ; then AC_PROG_CXXCPP fi ])# _LT_AC_PROG_CXXCPP # AC_LIBTOOL_F77 # -------------- # enable support for Fortran 77 libraries AC_DEFUN([AC_LIBTOOL_F77], [AC_REQUIRE([_LT_AC_LANG_F77]) ])# AC_LIBTOOL_F77 # _LT_AC_LANG_F77 # --------------- AC_DEFUN([_LT_AC_LANG_F77], [AC_REQUIRE([AC_PROG_F77]) _LT_AC_SHELL_INIT([tagnames=${tagnames+${tagnames},}F77]) ])# _LT_AC_LANG_F77 # AC_LIBTOOL_GCJ # -------------- # enable support for GCJ libraries AC_DEFUN([AC_LIBTOOL_GCJ], [AC_REQUIRE([_LT_AC_LANG_GCJ]) ])# AC_LIBTOOL_GCJ # _LT_AC_LANG_GCJ # --------------- AC_DEFUN([_LT_AC_LANG_GCJ], [AC_PROVIDE_IFELSE([AC_PROG_GCJ],[], [AC_PROVIDE_IFELSE([A][M_PROG_GCJ],[], [AC_PROVIDE_IFELSE([LT_AC_PROG_GCJ],[], [ifdef([AC_PROG_GCJ],[AC_REQUIRE([AC_PROG_GCJ])], [ifdef([A][M_PROG_GCJ],[AC_REQUIRE([A][M_PROG_GCJ])], [AC_REQUIRE([A][C_PROG_GCJ_OR_A][M_PROG_GCJ])])])])])]) _LT_AC_SHELL_INIT([tagnames=${tagnames+${tagnames},}GCJ]) ])# _LT_AC_LANG_GCJ # AC_LIBTOOL_RC # -------------- # enable support for Windows resource files AC_DEFUN([AC_LIBTOOL_RC], [AC_REQUIRE([LT_AC_PROG_RC]) _LT_AC_SHELL_INIT([tagnames=${tagnames+${tagnames},}RC]) ])# AC_LIBTOOL_RC # AC_LIBTOOL_LANG_C_CONFIG # ------------------------ # Ensure that the configuration vars for the C compiler are # suitably defined. Those variables are subsequently used by # AC_LIBTOOL_CONFIG to write the compiler configuration to `libtool'. AC_DEFUN([AC_LIBTOOL_LANG_C_CONFIG], [_LT_AC_LANG_C_CONFIG]) AC_DEFUN([_LT_AC_LANG_C_CONFIG], [lt_save_CC="$CC" AC_LANG_PUSH(C) # Source file extension for C test sources. ac_ext=c # Object file extension for compiled C test sources. objext=o _LT_AC_TAGVAR(objext, $1)=$objext # Code to be used in simple compile tests lt_simple_compile_test_code="int some_variable = 0;\n" # Code to be used in simple link tests lt_simple_link_test_code='int main(){return(0);}\n' _LT_AC_SYS_COMPILER # # Check for any special shared library compilation flags. # _LT_AC_TAGVAR(lt_prog_cc_shlib, $1)= if test "$GCC" = no; then case $host_os in sco3.2v5*) _LT_AC_TAGVAR(lt_prog_cc_shlib, $1)='-belf' ;; esac fi if test -n "$_LT_AC_TAGVAR(lt_prog_cc_shlib, $1)"; then AC_MSG_WARN([`$CC' requires `$_LT_AC_TAGVAR(lt_prog_cc_shlib, $1)' to build shared libraries]) if echo "$old_CC $old_CFLAGS " | grep "[[ ]]$_LT_AC_TAGVAR(lt_prog_cc_shlib, $1)[[ ]]" >/dev/null; then : else AC_MSG_WARN([add `$_LT_AC_TAGVAR(lt_prog_cc_shlib, $1)' to the CC or CFLAGS env variable and reconfigure]) _LT_AC_TAGVAR(lt_cv_prog_cc_can_build_shared, $1)=no fi fi # # Check to make sure the static flag actually works. # AC_LIBTOOL_LINKER_OPTION([if $compiler static flag $_LT_AC_TAGVAR(lt_prog_compiler_static, $1) works], _LT_AC_TAGVAR(lt_prog_compiler_static_works, $1), $_LT_AC_TAGVAR(lt_prog_compiler_static, $1), [], [_LT_AC_TAGVAR(lt_prog_compiler_static, $1)=]) AC_LIBTOOL_PROG_COMPILER_NO_RTTI($1) AC_LIBTOOL_PROG_COMPILER_PIC($1) AC_LIBTOOL_PROG_CC_C_O($1) AC_LIBTOOL_SYS_HARD_LINK_LOCKS($1) AC_LIBTOOL_PROG_LD_SHLIBS($1) AC_LIBTOOL_SYS_DYNAMIC_LINKER($1) AC_LIBTOOL_PROG_LD_HARDCODE_LIBPATH($1) AC_LIBTOOL_SYS_LIB_STRIP AC_LIBTOOL_DLOPEN_SELF($1) # Report which librarie types wil actually be built AC_MSG_CHECKING([if libtool supports shared libraries]) AC_MSG_RESULT([$can_build_shared]) AC_MSG_CHECKING([whether to build shared libraries]) test "$can_build_shared" = "no" && enable_shared=no # On AIX, shared libraries and static libraries use the same namespace, and # are all built from PIC. case "$host_os" in aix3*) test "$enable_shared" = yes && enable_static=no if test -n "$RANLIB"; then archive_cmds="$archive_cmds~\$RANLIB \$lib" postinstall_cmds='$RANLIB $lib' fi ;; aix4* | aix5*) if test "$host_cpu" != ia64 && test "$aix_use_runtimelinking" = no ; then test "$enable_shared" = yes && enable_static=no fi ;; esac AC_MSG_RESULT([$enable_shared]) AC_MSG_CHECKING([whether to build static libraries]) # Make sure either enable_shared or enable_static is yes. test "$enable_shared" = yes || enable_static=yes AC_MSG_RESULT([$enable_static]) AC_LIBTOOL_CONFIG($1) AC_LANG_POP CC="$lt_save_CC" ])# AC_LIBTOOL_LANG_C_CONFIG # AC_LIBTOOL_LANG_CXX_CONFIG # -------------------------- # Ensure that the configuration vars for the C compiler are # suitably defined. Those variables are subsequently used by # AC_LIBTOOL_CONFIG to write the compiler configuration to `libtool'. AC_DEFUN([AC_LIBTOOL_LANG_CXX_CONFIG], [_LT_AC_LANG_CXX_CONFIG(CXX)]) AC_DEFUN([_LT_AC_LANG_CXX_CONFIG], [AC_LANG_PUSH(C++) AC_REQUIRE([AC_PROG_CXX]) AC_REQUIRE([_LT_AC_PROG_CXXCPP]) _LT_AC_TAGVAR(archive_cmds_need_lc, $1)=no _LT_AC_TAGVAR(allow_undefined_flag, $1)= _LT_AC_TAGVAR(always_export_symbols, $1)=no _LT_AC_TAGVAR(archive_expsym_cmds, $1)= _LT_AC_TAGVAR(export_dynamic_flag_spec, $1)= _LT_AC_TAGVAR(hardcode_direct, $1)=no _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)= _LT_AC_TAGVAR(hardcode_libdir_flag_spec_ld, $1)= _LT_AC_TAGVAR(hardcode_libdir_separator, $1)= _LT_AC_TAGVAR(hardcode_minus_L, $1)=no _LT_AC_TAGVAR(hardcode_automatic, $1)=no _LT_AC_TAGVAR(module_cmds, $1)= _LT_AC_TAGVAR(module_expsym_cmds, $1)= _LT_AC_TAGVAR(link_all_deplibs, $1)=unknown _LT_AC_TAGVAR(old_archive_cmds, $1)=$old_archive_cmds _LT_AC_TAGVAR(no_undefined_flag, $1)= _LT_AC_TAGVAR(whole_archive_flag_spec, $1)= _LT_AC_TAGVAR(enable_shared_with_static_runtimes, $1)=no # Dependencies to place before and after the object being linked: _LT_AC_TAGVAR(predep_objects, $1)= _LT_AC_TAGVAR(postdep_objects, $1)= _LT_AC_TAGVAR(predeps, $1)= _LT_AC_TAGVAR(postdeps, $1)= _LT_AC_TAGVAR(compiler_lib_search_path, $1)= # Source file extension for C++ test sources. ac_ext=cc # Object file extension for compiled C++ test sources. objext=o _LT_AC_TAGVAR(objext, $1)=$objext # Code to be used in simple compile tests lt_simple_compile_test_code="int some_variable = 0;\n" # Code to be used in simple link tests lt_simple_link_test_code='int main(int, char *[]) { return(0); }\n' # ltmain only uses $CC for tagged configurations so make sure $CC is set. _LT_AC_SYS_COMPILER # Allow CC to be a program name with arguments. lt_save_CC=$CC lt_save_LD=$LD lt_save_GCC=$GCC GCC=$GXX lt_save_with_gnu_ld=$with_gnu_ld lt_save_path_LD=$lt_cv_path_LD if test -n "${lt_cv_prog_gnu_ldcxx+set}"; then lt_cv_prog_gnu_ld=$lt_cv_prog_gnu_ldcxx else unset lt_cv_prog_gnu_ld fi if test -n "${lt_cv_path_LDCXX+set}"; then lt_cv_path_LD=$lt_cv_path_LDCXX else unset lt_cv_path_LD fi test -z "${LDCXX+set}" || LD=$LDCXX CC=${CXX-"c++"} compiler=$CC _LT_AC_TAGVAR(compiler, $1)=$CC cc_basename=`$echo X"$compiler" | $Xsed -e 's%^.*/%%'` # We don't want -fno-exception wen compiling C++ code, so set the # no_builtin_flag separately if test "$GXX" = yes; then _LT_AC_TAGVAR(lt_prog_compiler_no_builtin_flag, $1)=' -fno-builtin' else _LT_AC_TAGVAR(lt_prog_compiler_no_builtin_flag, $1)= fi if test "$GXX" = yes; then # Set up default GNU C++ configuration AC_PROG_LD # Check if GNU C++ uses GNU ld as the underlying linker, since the # archiving commands below assume that GNU ld is being used. if test "$with_gnu_ld" = yes; then _LT_AC_TAGVAR(archive_cmds, $1)='$CC -shared -nostdlib $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags ${wl}-soname $wl$soname -o $lib' _LT_AC_TAGVAR(archive_expsym_cmds, $1)='$CC -shared -nostdlib $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags ${wl}-soname $wl$soname ${wl}-retain-symbols-file $wl$export_symbols -o $lib' _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='${wl}--rpath ${wl}$libdir' _LT_AC_TAGVAR(export_dynamic_flag_spec, $1)='${wl}--export-dynamic' # If archive_cmds runs LD, not CC, wlarc should be empty # XXX I think wlarc can be eliminated in ltcf-cxx, but I need to # investigate it a little bit more. (MM) wlarc='${wl}' # ancient GNU ld didn't support --whole-archive et. al. if eval "`$CC -print-prog-name=ld` --help 2>&1" | \ grep 'no-whole-archive' > /dev/null; then _LT_AC_TAGVAR(whole_archive_flag_spec, $1)="$wlarc"'--whole-archive$convenience '"$wlarc"'--no-whole-archive' else _LT_AC_TAGVAR(whole_archive_flag_spec, $1)= fi else with_gnu_ld=no wlarc= # A generic and very simple default shared library creation # command for GNU C++ for the case where it uses the native # linker, instead of GNU ld. If possible, this setting should # overridden to take advantage of the native linker features on # the platform it is being used on. _LT_AC_TAGVAR(archive_cmds, $1)='$CC -shared -nostdlib $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags -o $lib' fi # Commands to make compiler produce verbose output that lists # what "hidden" libraries, object files and flags are used when # linking a shared library. output_verbose_link_cmd='$CC -shared $CFLAGS -v conftest.$objext 2>&1 | grep "\-L"' else GXX=no with_gnu_ld=no wlarc= fi # PORTME: fill in a description of your system's C++ link characteristics AC_MSG_CHECKING([whether the $compiler linker ($LD) supports shared libraries]) _LT_AC_TAGVAR(ld_shlibs, $1)=yes case $host_os in aix3*) # FIXME: insert proper C++ library support _LT_AC_TAGVAR(ld_shlibs, $1)=no ;; aix4* | aix5*) if test "$host_cpu" = ia64; then # On IA64, the linker does run time linking by default, so we don't # have to do anything special. aix_use_runtimelinking=no exp_sym_flag='-Bexport' no_entry_flag="" else aix_use_runtimelinking=no # Test if we are trying to use run time linking or normal # AIX style linking. If -brtl is somewhere in LDFLAGS, we # need to do runtime linking. case $host_os in aix4.[[23]]|aix4.[[23]].*|aix5*) for ld_flag in $LDFLAGS; do case $ld_flag in *-brtl*) aix_use_runtimelinking=yes break ;; esac done esac exp_sym_flag='-bexport' no_entry_flag='-bnoentry' fi # When large executables or shared objects are built, AIX ld can # have problems creating the table of contents. If linking a library # or program results in "error TOC overflow" add -mminimal-toc to # CXXFLAGS/CFLAGS for g++/gcc. In the cases where that is not # enough to fix the problem, add -Wl,-bbigtoc to LDFLAGS. _LT_AC_TAGVAR(archive_cmds, $1)='' _LT_AC_TAGVAR(hardcode_direct, $1)=yes _LT_AC_TAGVAR(hardcode_libdir_separator, $1)=':' _LT_AC_TAGVAR(link_all_deplibs, $1)=yes if test "$GXX" = yes; then case $host_os in aix4.[012]|aix4.[012].*) # We only want to do this on AIX 4.2 and lower, the check # below for broken collect2 doesn't work under 4.3+ collect2name=`${CC} -print-prog-name=collect2` if test -f "$collect2name" && \ strings "$collect2name" | grep resolve_lib_name >/dev/null then # We have reworked collect2 _LT_AC_TAGVAR(hardcode_direct, $1)=yes else # We have old collect2 _LT_AC_TAGVAR(hardcode_direct, $1)=unsupported # It fails to find uninstalled libraries when the uninstalled # path is not listed in the libpath. Setting hardcode_minus_L # to unsupported forces relinking _LT_AC_TAGVAR(hardcode_minus_L, $1)=yes _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='-L$libdir' _LT_AC_TAGVAR(hardcode_libdir_separator, $1)= fi esac shared_flag='-shared' else # not using gcc if test "$host_cpu" = ia64; then # VisualAge C++, Version 5.5 for AIX 5L for IA-64, Beta 3 Release # chokes on -Wl,-G. The following line is correct: shared_flag='-G' else if test "$aix_use_runtimelinking" = yes; then shared_flag='${wl}-G' else shared_flag='${wl}-bM:SRE' fi fi fi # It seems that -bexpall does not export symbols beginning with # underscore (_), so it is better to generate a list of symbols to export. _LT_AC_TAGVAR(always_export_symbols, $1)=yes if test "$aix_use_runtimelinking" = yes; then # Warning - without using the other runtime loading flags (-brtl), # -berok will link without error, but may produce a broken library. _LT_AC_TAGVAR(allow_undefined_flag, $1)='-berok' # Determine the default libpath from the value encoded in an empty executable. _LT_AC_SYS_LIBPATH_AIX _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='${wl}-blibpath:$libdir:'"$aix_libpath" _LT_AC_TAGVAR(archive_expsym_cmds, $1)="\$CC"' -o $output_objdir/$soname $libobjs $deplibs $compiler_flags `if test "x${allow_undefined_flag}" != "x"; then echo "${wl}${allow_undefined_flag}"; else :; fi` '"\${wl}$no_entry_flag \${wl}$exp_sym_flag:\$export_symbols $shared_flag" else if test "$host_cpu" = ia64; then _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='${wl}-R $libdir:/usr/lib:/lib' _LT_AC_TAGVAR(allow_undefined_flag, $1)="-z nodefs" _LT_AC_TAGVAR(archive_expsym_cmds, $1)="\$CC $shared_flag"' -o $output_objdir/$soname $libobjs $deplibs $compiler_flags ${wl}${allow_undefined_flag} '"\${wl}$no_entry_flag \${wl}$exp_sym_flag:\$export_symbols" else # Determine the default libpath from the value encoded in an empty executable. _LT_AC_SYS_LIBPATH_AIX _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='${wl}-blibpath:$libdir:'"$aix_libpath" # Warning - without using the other run time loading flags, # -berok will link without error, but may produce a broken library. _LT_AC_TAGVAR(no_undefined_flag, $1)=' ${wl}-bernotok' _LT_AC_TAGVAR(allow_undefined_flag, $1)=' ${wl}-berok' # -bexpall does not export symbols beginning with underscore (_) _LT_AC_TAGVAR(always_export_symbols, $1)=yes # Exported symbols can be pulled into shared objects from archives _LT_AC_TAGVAR(whole_archive_flag_spec, $1)=' ' _LT_AC_TAGVAR(archive_cmds_need_lc, $1)=yes # This is similar to how AIX traditionally builds it's shared libraries. _LT_AC_TAGVAR(archive_expsym_cmds, $1)="\$CC $shared_flag"' -o $output_objdir/$soname $libobjs $deplibs $compiler_flags ${wl}-bE:$export_symbols ${wl}-bnoentry${allow_undefined_flag}~$AR $AR_FLAGS $output_objdir/$libname$release.a $output_objdir/$soname' fi fi ;; chorus*) case $cc_basename in *) # FIXME: insert proper C++ library support _LT_AC_TAGVAR(ld_shlibs, $1)=no ;; esac ;; cygwin* | mingw* | pw32*) # _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1) is actually meaningless, # as there is no search path for DLLs. _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='-L$libdir' _LT_AC_TAGVAR(allow_undefined_flag, $1)=unsupported _LT_AC_TAGVAR(always_export_symbols, $1)=no _LT_AC_TAGVAR(enable_shared_with_static_runtimes, $1)=yes if $LD --help 2>&1 | grep 'auto-import' > /dev/null; then _LT_AC_TAGVAR(archive_cmds, $1)='$CC -shared -nostdlib $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags -o $output_objdir/$soname ${wl}--image-base=0x10000000 ${wl}--out-implib,$lib' # If the export-symbols file already is a .def file (1st line # is EXPORTS), use it as is; otherwise, prepend... _LT_AC_TAGVAR(archive_expsym_cmds, $1)='if test "x`$SED 1q $export_symbols`" = xEXPORTS; then cp $export_symbols $output_objdir/$soname.def; else echo EXPORTS > $output_objdir/$soname.def; cat $export_symbols >> $output_objdir/$soname.def; fi~ $CC -shared -nostdlib $output_objdir/$soname.def $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags -o $output_objdir/$soname ${wl}--image-base=0x10000000 ${wl}--out-implib,$lib' else _LT_AC_TAGVAR(ld_shlibs, $1)=no fi ;; darwin* | rhapsody*) case "$host_os" in rhapsody* | darwin1.[[012]]) _LT_AC_TAGVAR(allow_undefined_flag, $1)='${wl}-undefined ${wl}suppress' ;; *) # Darwin 1.3 on if test -z ${MACOSX_DEPLOYMENT_TARGET} ; then _LT_AC_TAGVAR(allow_undefined_flag, $1)='${wl}-flat_namespace ${wl}-undefined ${wl}suppress' else case ${MACOSX_DEPLOYMENT_TARGET} in 10.[[012]]) _LT_AC_TAGVAR(allow_undefined_flag, $1)='${wl}-flat_namespace ${wl}-undefined ${wl}suppress' ;; 10.*) _LT_AC_TAGVAR(allow_undefined_flag, $1)='${wl}-undefined ${wl}dynamic_lookup' ;; esac fi ;; esac _LT_AC_TAGVAR(archive_cmds_need_lc, $1)=no _LT_AC_TAGVAR(hardcode_direct, $1)=no _LT_AC_TAGVAR(hardcode_automatic, $1)=yes _LT_AC_TAGVAR(hardcode_shlibpath_var, $1)=unsupported _LT_AC_TAGVAR(whole_archive_flag_spec, $1)='' _LT_AC_TAGVAR(link_all_deplibs, $1)=yes if test "$GXX" = yes ; then lt_int_apple_cc_single_mod=no output_verbose_link_cmd='echo' if $CC -dumpspecs 2>&1 | $EGREP 'single_module' >/dev/null ; then lt_int_apple_cc_single_mod=yes fi if test "X$lt_int_apple_cc_single_mod" = Xyes ; then _LT_AC_TAGVAR(archive_cmds, $1)='$CC -dynamiclib -single_module $allow_undefined_flag -o $lib $libobjs $deplibs $compiler_flags -install_name $rpath/$soname $verstring' else _LT_AC_TAGVAR(archive_cmds, $1)='$CC -r -keep_private_externs -nostdlib -o ${lib}-master.o $libobjs~$CC -dynamiclib $allow_undefined_flag -o $lib ${lib}-master.o $deplibs $compiler_flags -install_name $rpath/$soname $verstring' fi _LT_AC_TAGVAR(module_cmds, $1)='$CC $allow_undefined_flag -o $lib -bundle $libobjs $deplibs$compiler_flags' # Don't fix this by using the ld -exported_symbols_list flag, it doesn't exist in older darwin ld's if test "X$lt_int_apple_cc_single_mod" = Xyes ; then _LT_AC_TAGVAR(archive_expsym_cmds, $1)='sed -e "s,#.*,," -e "s,^[ ]*,," -e "s,^\(..*\),_&," < $export_symbols > $output_objdir/${libname}-symbols.expsym~$CC -dynamiclib -single_module $allow_undefined_flag -o $lib $libobjs $deplibs $compiler_flags -install_name $rpath/$soname $verstring~nmedit -s $output_objdir/${libname}-symbols.expsym ${lib}' else _LT_AC_TAGVAR(archive_expsym_cmds, $1)='sed -e "s,#.*,," -e "s,^[ ]*,," -e "s,^\(..*\),_&," < $export_symbols > $output_objdir/${libname}-symbols.expsym~$CC -r -keep_private_externs -nostdlib -o ${lib}-master.o $libobjs~$CC -dynamiclib $allow_undefined_flag -o $lib ${lib}-master.o $deplibs $compiler_flags -install_name $rpath/$soname $verstring~nmedit -s $output_objdir/${libname}-symbols.expsym ${lib}' fi _LT_AC_TAGVAR(module_expsym_cmds, $1)='sed -e "s,#.*,," -e "s,^[ ]*,," -e "s,^\(..*\),_&," < $export_symbols > $output_objdir/${libname}-symbols.expsym~$CC $allow_undefined_flag -o $lib -bundle $libobjs $deplibs$compiler_flags~nmedit -s $output_objdir/${libname}-symbols.expsym ${lib}' else case "$cc_basename" in xlc*) output_verbose_link_cmd='echo' _LT_AC_TAGVAR(archive_cmds, $1)='$CC -qmkshrobj ${wl}-single_module $allow_undefined_flag -o $lib $libobjs $deplibs $compiler_flags ${wl}-install_name ${wl}`echo $rpath/$soname` $verstring' _LT_AC_TAGVAR(module_cmds, $1)='$CC $allow_undefined_flag -o $lib -bundle $libobjs $deplibs$compiler_flags' # Don't fix this by using the ld -exported_symbols_list flag, it doesn't exist in older darwin ld's _LT_AC_TAGVAR(archive_expsym_cmds, $1)='sed -e "s,#.*,," -e "s,^[ ]*,," -e "s,^\(..*\),_&," < $export_symbols > $output_objdir/${libname}-symbols.expsym~$CC -qmkshrobj ${wl}-single_module $allow_undefined_flag -o $lib $libobjs $deplibs $compiler_flags ${wl}-install_name ${wl}$rpath/$soname $verstring~nmedit -s $output_objdir/${libname}-symbols.expsym ${lib}' _LT_AC_TAGVAR(module_expsym_cmds, $1)='sed -e "s,#.*,," -e "s,^[ ]*,," -e "s,^\(..*\),_&," < $export_symbols > $output_objdir/${libname}-symbols.expsym~$CC $allow_undefined_flag -o $lib -bundle $libobjs $deplibs$compiler_flags~nmedit -s $output_objdir/${libname}-symbols.expsym ${lib}' ;; *) _LT_AC_TAGVAR(ld_shlibs, $1)=no ;; esac fi ;; dgux*) case $cc_basename in ec++) # FIXME: insert proper C++ library support _LT_AC_TAGVAR(ld_shlibs, $1)=no ;; ghcx) # Green Hills C++ Compiler # FIXME: insert proper C++ library support _LT_AC_TAGVAR(ld_shlibs, $1)=no ;; *) # FIXME: insert proper C++ library support _LT_AC_TAGVAR(ld_shlibs, $1)=no ;; esac ;; freebsd[12]*) # C++ shared libraries reported to be fairly broken before switch to ELF _LT_AC_TAGVAR(ld_shlibs, $1)=no ;; freebsd-elf*) _LT_AC_TAGVAR(archive_cmds_need_lc, $1)=no ;; freebsd* | kfreebsd*-gnu) # FreeBSD 3 and later use GNU C++ and GNU ld with standard ELF # conventions _LT_AC_TAGVAR(ld_shlibs, $1)=yes ;; gnu*) ;; hpux9*) _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='${wl}+b ${wl}$libdir' _LT_AC_TAGVAR(hardcode_libdir_separator, $1)=: _LT_AC_TAGVAR(export_dynamic_flag_spec, $1)='${wl}-E' _LT_AC_TAGVAR(hardcode_direct, $1)=yes _LT_AC_TAGVAR(hardcode_minus_L, $1)=yes # Not in the search PATH, # but as the default # location of the library. case $cc_basename in CC) # FIXME: insert proper C++ library support _LT_AC_TAGVAR(ld_shlibs, $1)=no ;; aCC) _LT_AC_TAGVAR(archive_cmds, $1)='$rm $output_objdir/$soname~$CC -b ${wl}+b ${wl}$install_libdir -o $output_objdir/$soname $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags~test $output_objdir/$soname = $lib || mv $output_objdir/$soname $lib' # Commands to make compiler produce verbose output that lists # what "hidden" libraries, object files and flags are used when # linking a shared library. # # There doesn't appear to be a way to prevent this compiler from # explicitly linking system object files so we need to strip them # from the output so that they don't get included in the library # dependencies. output_verbose_link_cmd='templist=`($CC -b $CFLAGS -v conftest.$objext 2>&1) | grep "[-]L"`; list=""; for z in $templist; do case $z in conftest.$objext) list="$list $z";; *.$objext);; *) list="$list $z";;esac; done; echo $list' ;; *) if test "$GXX" = yes; then _LT_AC_TAGVAR(archive_cmds, $1)='$rm $output_objdir/$soname~$CC -shared -nostdlib -fPIC ${wl}+b ${wl}$install_libdir -o $output_objdir/$soname $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags~test $output_objdir/$soname = $lib || mv $output_objdir/$soname $lib' else # FIXME: insert proper C++ library support _LT_AC_TAGVAR(ld_shlibs, $1)=no fi ;; esac ;; hpux10*|hpux11*) if test $with_gnu_ld = no; then case "$host_cpu" in hppa*64*) _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='${wl}+b ${wl}$libdir' _LT_AC_TAGVAR(hardcode_libdir_flag_spec_ld, $1)='+b $libdir' _LT_AC_TAGVAR(hardcode_libdir_separator, $1)=: ;; ia64*) _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='-L$libdir' ;; *) _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='${wl}+b ${wl}$libdir' _LT_AC_TAGVAR(hardcode_libdir_separator, $1)=: _LT_AC_TAGVAR(export_dynamic_flag_spec, $1)='${wl}-E' ;; esac fi case "$host_cpu" in hppa*64*) _LT_AC_TAGVAR(hardcode_direct, $1)=no _LT_AC_TAGVAR(hardcode_shlibpath_var, $1)=no ;; ia64*) _LT_AC_TAGVAR(hardcode_direct, $1)=no _LT_AC_TAGVAR(hardcode_shlibpath_var, $1)=no _LT_AC_TAGVAR(hardcode_minus_L, $1)=yes # Not in the search PATH, # but as the default # location of the library. ;; *) _LT_AC_TAGVAR(hardcode_direct, $1)=yes _LT_AC_TAGVAR(hardcode_minus_L, $1)=yes # Not in the search PATH, # but as the default # location of the library. ;; esac case $cc_basename in CC) # FIXME: insert proper C++ library support _LT_AC_TAGVAR(ld_shlibs, $1)=no ;; aCC) case "$host_cpu" in hppa*64*|ia64*) _LT_AC_TAGVAR(archive_cmds, $1)='$LD -b +h $soname -o $lib $linker_flags $libobjs $deplibs' ;; *) _LT_AC_TAGVAR(archive_cmds, $1)='$CC -b ${wl}+h ${wl}$soname ${wl}+b ${wl}$install_libdir -o $lib $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags' ;; esac # Commands to make compiler produce verbose output that lists # what "hidden" libraries, object files and flags are used when # linking a shared library. # # There doesn't appear to be a way to prevent this compiler from # explicitly linking system object files so we need to strip them # from the output so that they don't get included in the library # dependencies. output_verbose_link_cmd='templist=`($CC -b $CFLAGS -v conftest.$objext 2>&1) | grep "\-L"`; list=""; for z in $templist; do case $z in conftest.$objext) list="$list $z";; *.$objext);; *) list="$list $z";;esac; done; echo $list' ;; *) if test "$GXX" = yes; then if test $with_gnu_ld = no; then case "$host_cpu" in ia64*|hppa*64*) _LT_AC_TAGVAR(archive_cmds, $1)='$LD -b +h $soname -o $lib $linker_flags $libobjs $deplibs' ;; *) _LT_AC_TAGVAR(archive_cmds, $1)='$CC -shared -nostdlib -fPIC ${wl}+h ${wl}$soname ${wl}+b ${wl}$install_libdir -o $lib $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags' ;; esac fi else # FIXME: insert proper C++ library support _LT_AC_TAGVAR(ld_shlibs, $1)=no fi ;; esac ;; irix5* | irix6*) case $cc_basename in CC) # SGI C++ _LT_AC_TAGVAR(archive_cmds, $1)='$CC -shared -all -multigot $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags -soname $soname `test -n "$verstring" && echo -set_version $verstring` -update_registry ${objdir}/so_locations -o $lib' # Archives containing C++ object files must be created using # "CC -ar", where "CC" is the IRIX C++ compiler. This is # necessary to make sure instantiated templates are included # in the archive. _LT_AC_TAGVAR(old_archive_cmds, $1)='$CC -ar -WR,-u -o $oldlib $oldobjs' ;; *) if test "$GXX" = yes; then if test "$with_gnu_ld" = no; then _LT_AC_TAGVAR(archive_cmds, $1)='$CC -shared -nostdlib $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags ${wl}-soname ${wl}$soname `test -n "$verstring" && echo ${wl}-set_version ${wl}$verstring` ${wl}-update_registry ${wl}${objdir}/so_locations -o $lib' else _LT_AC_TAGVAR(archive_cmds, $1)='$CC -shared -nostdlib $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags ${wl}-soname ${wl}$soname `test -n "$verstring" && echo ${wl}-set_version ${wl}$verstring` -o $lib' fi fi _LT_AC_TAGVAR(link_all_deplibs, $1)=yes ;; esac _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='${wl}-rpath ${wl}$libdir' _LT_AC_TAGVAR(hardcode_libdir_separator, $1)=: ;; linux*) case $cc_basename in KCC) # Kuck and Associates, Inc. (KAI) C++ Compiler # KCC will only create a shared library if the output file # ends with ".so" (or ".sl" for HP-UX), so rename the library # to its proper name (with version) after linking. _LT_AC_TAGVAR(archive_cmds, $1)='tempext=`echo $shared_ext | $SED -e '\''s/\([[^()0-9A-Za-z{}]]\)/\\\\\1/g'\''`; templib=`echo $lib | $SED -e "s/\${tempext}\..*/.so/"`; $CC $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags --soname $soname -o \$templib; mv \$templib $lib' _LT_AC_TAGVAR(archive_expsym_cmds, $1)='tempext=`echo $shared_ext | $SED -e '\''s/\([[^()0-9A-Za-z{}]]\)/\\\\\1/g'\''`; templib=`echo $lib | $SED -e "s/\${tempext}\..*/.so/"`; $CC $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags --soname $soname -o \$templib ${wl}-retain-symbols-file,$export_symbols; mv \$templib $lib' # Commands to make compiler produce verbose output that lists # what "hidden" libraries, object files and flags are used when # linking a shared library. # # There doesn't appear to be a way to prevent this compiler from # explicitly linking system object files so we need to strip them # from the output so that they don't get included in the library # dependencies. output_verbose_link_cmd='templist=`$CC $CFLAGS -v conftest.$objext -o libconftest$shared_ext 2>&1 | grep "ld"`; rm -f libconftest$shared_ext; list=""; for z in $templist; do case $z in conftest.$objext) list="$list $z";; *.$objext);; *) list="$list $z";;esac; done; echo $list' _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='${wl}--rpath,$libdir' _LT_AC_TAGVAR(export_dynamic_flag_spec, $1)='${wl}--export-dynamic' # Archives containing C++ object files must be created using # "CC -Bstatic", where "CC" is the KAI C++ compiler. _LT_AC_TAGVAR(old_archive_cmds, $1)='$CC -Bstatic -o $oldlib $oldobjs' ;; icpc) # Intel C++ with_gnu_ld=yes # version 8.0 and above of icpc choke on multiply defined symbols # if we add $predep_objects and $postdep_objects, however 7.1 and # earlier do not add the objects themselves. case `$CC -V 2>&1` in *"Version 7."*) _LT_AC_TAGVAR(archive_cmds, $1)='$CC -shared $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags ${wl}-soname $wl$soname -o $lib' _LT_AC_TAGVAR(archive_expsym_cmds, $1)='$CC -shared $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags ${wl}-soname $wl$soname ${wl}-retain-symbols-file $wl$export_symbols -o $lib' ;; *) # Version 8.0 or newer _LT_AC_TAGVAR(archive_cmds, $1)='$CC -shared $libobjs $deplibs $compiler_flags ${wl}-soname $wl$soname -o $lib' _LT_AC_TAGVAR(archive_expsym_cmds, $1)='$CC -shared $libobjs $deplibs $compiler_flags ${wl}-soname $wl$soname ${wl}-retain-symbols-file $wl$export_symbols -o $lib' ;; esac _LT_AC_TAGVAR(archive_cmds_need_lc, $1)=no _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='${wl}-rpath,$libdir' _LT_AC_TAGVAR(export_dynamic_flag_spec, $1)='${wl}--export-dynamic' _LT_AC_TAGVAR(whole_archive_flag_spec, $1)='${wl}--whole-archive$convenience ${wl}--no-whole-archive' ;; cxx) # Compaq C++ _LT_AC_TAGVAR(archive_cmds, $1)='$CC -shared $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags ${wl}-soname $wl$soname -o $lib' _LT_AC_TAGVAR(archive_expsym_cmds, $1)='$CC -shared $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags ${wl}-soname $wl$soname -o $lib ${wl}-retain-symbols-file $wl$export_symbols' runpath_var=LD_RUN_PATH _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='-rpath $libdir' _LT_AC_TAGVAR(hardcode_libdir_separator, $1)=: # Commands to make compiler produce verbose output that lists # what "hidden" libraries, object files and flags are used when # linking a shared library. # # There doesn't appear to be a way to prevent this compiler from # explicitly linking system object files so we need to strip them # from the output so that they don't get included in the library # dependencies. output_verbose_link_cmd='templist=`$CC -shared $CFLAGS -v conftest.$objext 2>&1 | grep "ld"`; templist=`echo $templist | $SED "s/\(^.*ld.*\)\( .*ld .*$\)/\1/"`; list=""; for z in $templist; do case $z in conftest.$objext) list="$list $z";; *.$objext);; *) list="$list $z";;esac; done; echo $list' ;; esac ;; lynxos*) # FIXME: insert proper C++ library support _LT_AC_TAGVAR(ld_shlibs, $1)=no ;; m88k*) # FIXME: insert proper C++ library support _LT_AC_TAGVAR(ld_shlibs, $1)=no ;; mvs*) case $cc_basename in cxx) # FIXME: insert proper C++ library support _LT_AC_TAGVAR(ld_shlibs, $1)=no ;; *) # FIXME: insert proper C++ library support _LT_AC_TAGVAR(ld_shlibs, $1)=no ;; esac ;; netbsd*) if echo __ELF__ | $CC -E - | grep __ELF__ >/dev/null; then _LT_AC_TAGVAR(archive_cmds, $1)='$LD -Bshareable -o $lib $predep_objects $libobjs $deplibs $postdep_objects $linker_flags' wlarc= _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='-R$libdir' _LT_AC_TAGVAR(hardcode_direct, $1)=yes _LT_AC_TAGVAR(hardcode_shlibpath_var, $1)=no fi # Workaround some broken pre-1.5 toolchains output_verbose_link_cmd='$CC -shared $CFLAGS -v conftest.$objext 2>&1 | grep conftest.$objext | $SED -e "s:-lgcc -lc -lgcc::"' ;; openbsd2*) # C++ shared libraries are fairly broken _LT_AC_TAGVAR(ld_shlibs, $1)=no ;; openbsd*) _LT_AC_TAGVAR(hardcode_direct, $1)=yes _LT_AC_TAGVAR(hardcode_shlibpath_var, $1)=no _LT_AC_TAGVAR(archive_cmds, $1)='$CC -shared $pic_flag $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags -o $lib' _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='${wl}-rpath,$libdir' if test -z "`echo __ELF__ | $CC -E - | grep __ELF__`" || test "$host_os-$host_cpu" = "openbsd2.8-powerpc"; then _LT_AC_TAGVAR(archive_expsym_cmds, $1)='$CC -shared $pic_flag $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags ${wl}-retain-symbols-file,$export_symbols -o $lib' _LT_AC_TAGVAR(export_dynamic_flag_spec, $1)='${wl}-E' _LT_AC_TAGVAR(whole_archive_flag_spec, $1)="$wlarc"'--whole-archive$convenience '"$wlarc"'--no-whole-archive' fi output_verbose_link_cmd='echo' ;; osf3*) case $cc_basename in KCC) # Kuck and Associates, Inc. (KAI) C++ Compiler # KCC will only create a shared library if the output file # ends with ".so" (or ".sl" for HP-UX), so rename the library # to its proper name (with version) after linking. _LT_AC_TAGVAR(archive_cmds, $1)='tempext=`echo $shared_ext | $SED -e '\''s/\([[^()0-9A-Za-z{}]]\)/\\\\\1/g'\''`; templib=`echo $lib | $SED -e "s/\${tempext}\..*/.so/"`; $CC $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags --soname $soname -o \$templib; mv \$templib $lib' _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='${wl}-rpath,$libdir' _LT_AC_TAGVAR(hardcode_libdir_separator, $1)=: # Archives containing C++ object files must be created using # "CC -Bstatic", where "CC" is the KAI C++ compiler. _LT_AC_TAGVAR(old_archive_cmds, $1)='$CC -Bstatic -o $oldlib $oldobjs' ;; RCC) # Rational C++ 2.4.1 # FIXME: insert proper C++ library support _LT_AC_TAGVAR(ld_shlibs, $1)=no ;; cxx) _LT_AC_TAGVAR(allow_undefined_flag, $1)=' ${wl}-expect_unresolved ${wl}\*' _LT_AC_TAGVAR(archive_cmds, $1)='$CC -shared${allow_undefined_flag} $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags ${wl}-soname $soname `test -n "$verstring" && echo ${wl}-set_version $verstring` -update_registry ${objdir}/so_locations -o $lib' _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='${wl}-rpath ${wl}$libdir' _LT_AC_TAGVAR(hardcode_libdir_separator, $1)=: # Commands to make compiler produce verbose output that lists # what "hidden" libraries, object files and flags are used when # linking a shared library. # # There doesn't appear to be a way to prevent this compiler from # explicitly linking system object files so we need to strip them # from the output so that they don't get included in the library # dependencies. output_verbose_link_cmd='templist=`$CC -shared $CFLAGS -v conftest.$objext 2>&1 | grep "ld" | grep -v "ld:"`; templist=`echo $templist | $SED "s/\(^.*ld.*\)\( .*ld.*$\)/\1/"`; list=""; for z in $templist; do case $z in conftest.$objext) list="$list $z";; *.$objext);; *) list="$list $z";;esac; done; echo $list' ;; *) if test "$GXX" = yes && test "$with_gnu_ld" = no; then _LT_AC_TAGVAR(allow_undefined_flag, $1)=' ${wl}-expect_unresolved ${wl}\*' _LT_AC_TAGVAR(archive_cmds, $1)='$CC -shared -nostdlib ${allow_undefined_flag} $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags ${wl}-soname ${wl}$soname `test -n "$verstring" && echo ${wl}-set_version ${wl}$verstring` ${wl}-update_registry ${wl}${objdir}/so_locations -o $lib' _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='${wl}-rpath ${wl}$libdir' _LT_AC_TAGVAR(hardcode_libdir_separator, $1)=: # Commands to make compiler produce verbose output that lists # what "hidden" libraries, object files and flags are used when # linking a shared library. output_verbose_link_cmd='$CC -shared $CFLAGS -v conftest.$objext 2>&1 | grep "\-L"' else # FIXME: insert proper C++ library support _LT_AC_TAGVAR(ld_shlibs, $1)=no fi ;; esac ;; osf4* | osf5*) case $cc_basename in KCC) # Kuck and Associates, Inc. (KAI) C++ Compiler # KCC will only create a shared library if the output file # ends with ".so" (or ".sl" for HP-UX), so rename the library # to its proper name (with version) after linking. _LT_AC_TAGVAR(archive_cmds, $1)='tempext=`echo $shared_ext | $SED -e '\''s/\([[^()0-9A-Za-z{}]]\)/\\\\\1/g'\''`; templib=`echo $lib | $SED -e "s/\${tempext}\..*/.so/"`; $CC $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags --soname $soname -o \$templib; mv \$templib $lib' _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='${wl}-rpath,$libdir' _LT_AC_TAGVAR(hardcode_libdir_separator, $1)=: # Archives containing C++ object files must be created using # the KAI C++ compiler. _LT_AC_TAGVAR(old_archive_cmds, $1)='$CC -o $oldlib $oldobjs' ;; RCC) # Rational C++ 2.4.1 # FIXME: insert proper C++ library support _LT_AC_TAGVAR(ld_shlibs, $1)=no ;; cxx) _LT_AC_TAGVAR(allow_undefined_flag, $1)=' -expect_unresolved \*' _LT_AC_TAGVAR(archive_cmds, $1)='$CC -shared${allow_undefined_flag} $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags -msym -soname $soname `test -n "$verstring" && echo -set_version $verstring` -update_registry ${objdir}/so_locations -o $lib' _LT_AC_TAGVAR(archive_expsym_cmds, $1)='for i in `cat $export_symbols`; do printf "%s %s\\n" -exported_symbol "\$i" >> $lib.exp; done~ echo "-hidden">> $lib.exp~ $CC -shared$allow_undefined_flag $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags -msym -soname $soname -Wl,-input -Wl,$lib.exp `test -n "$verstring" && echo -set_version $verstring` -update_registry $objdir/so_locations -o $lib~ $rm $lib.exp' _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='-rpath $libdir' _LT_AC_TAGVAR(hardcode_libdir_separator, $1)=: # Commands to make compiler produce verbose output that lists # what "hidden" libraries, object files and flags are used when # linking a shared library. # # There doesn't appear to be a way to prevent this compiler from # explicitly linking system object files so we need to strip them # from the output so that they don't get included in the library # dependencies. output_verbose_link_cmd='templist=`$CC -shared $CFLAGS -v conftest.$objext 2>&1 | grep "ld" | grep -v "ld:"`; templist=`echo $templist | $SED "s/\(^.*ld.*\)\( .*ld.*$\)/\1/"`; list=""; for z in $templist; do case $z in conftest.$objext) list="$list $z";; *.$objext);; *) list="$list $z";;esac; done; echo $list' ;; *) if test "$GXX" = yes && test "$with_gnu_ld" = no; then _LT_AC_TAGVAR(allow_undefined_flag, $1)=' ${wl}-expect_unresolved ${wl}\*' _LT_AC_TAGVAR(archive_cmds, $1)='$CC -shared -nostdlib ${allow_undefined_flag} $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags ${wl}-msym ${wl}-soname ${wl}$soname `test -n "$verstring" && echo ${wl}-set_version ${wl}$verstring` ${wl}-update_registry ${wl}${objdir}/so_locations -o $lib' _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='${wl}-rpath ${wl}$libdir' _LT_AC_TAGVAR(hardcode_libdir_separator, $1)=: # Commands to make compiler produce verbose output that lists # what "hidden" libraries, object files and flags are used when # linking a shared library. output_verbose_link_cmd='$CC -shared $CFLAGS -v conftest.$objext 2>&1 | grep "\-L"' else # FIXME: insert proper C++ library support _LT_AC_TAGVAR(ld_shlibs, $1)=no fi ;; esac ;; psos*) # FIXME: insert proper C++ library support _LT_AC_TAGVAR(ld_shlibs, $1)=no ;; sco*) _LT_AC_TAGVAR(archive_cmds_need_lc, $1)=no case $cc_basename in CC) # FIXME: insert proper C++ library support _LT_AC_TAGVAR(ld_shlibs, $1)=no ;; *) # FIXME: insert proper C++ library support _LT_AC_TAGVAR(ld_shlibs, $1)=no ;; esac ;; sunos4*) case $cc_basename in CC) # Sun C++ 4.x # FIXME: insert proper C++ library support _LT_AC_TAGVAR(ld_shlibs, $1)=no ;; lcc) # Lucid # FIXME: insert proper C++ library support _LT_AC_TAGVAR(ld_shlibs, $1)=no ;; *) # FIXME: insert proper C++ library support _LT_AC_TAGVAR(ld_shlibs, $1)=no ;; esac ;; solaris*) case $cc_basename in CC) # Sun C++ 4.2, 5.x and Centerline C++ _LT_AC_TAGVAR(no_undefined_flag, $1)=' -zdefs' _LT_AC_TAGVAR(archive_cmds, $1)='$CC -G${allow_undefined_flag} -nolib -h$soname -o $lib $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags' _LT_AC_TAGVAR(archive_expsym_cmds, $1)='$echo "{ global:" > $lib.exp~cat $export_symbols | $SED -e "s/\(.*\)/\1;/" >> $lib.exp~$echo "local: *; };" >> $lib.exp~ $CC -G${allow_undefined_flag} -nolib ${wl}-M ${wl}$lib.exp -h$soname -o $lib $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags~$rm $lib.exp' _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='-R$libdir' _LT_AC_TAGVAR(hardcode_shlibpath_var, $1)=no case $host_os in solaris2.[0-5] | solaris2.[0-5].*) ;; *) # The C++ compiler is used as linker so we must use $wl # flag to pass the commands to the underlying system # linker. # Supported since Solaris 2.6 (maybe 2.5.1?) _LT_AC_TAGVAR(whole_archive_flag_spec, $1)='${wl}-z ${wl}allextract$convenience ${wl}-z ${wl}defaultextract' ;; esac _LT_AC_TAGVAR(link_all_deplibs, $1)=yes # Commands to make compiler produce verbose output that lists # what "hidden" libraries, object files and flags are used when # linking a shared library. # # There doesn't appear to be a way to prevent this compiler from # explicitly linking system object files so we need to strip them # from the output so that they don't get included in the library # dependencies. output_verbose_link_cmd='templist=`$CC -G $CFLAGS -v conftest.$objext 2>&1 | grep "\-[[LR]]"`; list=""; for z in $templist; do case $z in conftest.$objext) list="$list $z";; *.$objext);; *) list="$list $z";;esac; done; echo $list' # Archives containing C++ object files must be created using # "CC -xar", where "CC" is the Sun C++ compiler. This is # necessary to make sure instantiated templates are included # in the archive. _LT_AC_TAGVAR(old_archive_cmds, $1)='$CC -xar -o $oldlib $oldobjs' ;; gcx) # Green Hills C++ Compiler _LT_AC_TAGVAR(archive_cmds, $1)='$CC -shared $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags ${wl}-h $wl$soname -o $lib' # The C++ compiler must be used to create the archive. _LT_AC_TAGVAR(old_archive_cmds, $1)='$CC $LDFLAGS -archive -o $oldlib $oldobjs' ;; *) # GNU C++ compiler with Solaris linker if test "$GXX" = yes && test "$with_gnu_ld" = no; then _LT_AC_TAGVAR(no_undefined_flag, $1)=' ${wl}-z ${wl}defs' if $CC --version | grep -v '^2\.7' > /dev/null; then _LT_AC_TAGVAR(archive_cmds, $1)='$CC -shared -nostdlib $LDFLAGS $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags ${wl}-h $wl$soname -o $lib' _LT_AC_TAGVAR(archive_expsym_cmds, $1)='$echo "{ global:" > $lib.exp~cat $export_symbols | $SED -e "s/\(.*\)/\1;/" >> $lib.exp~$echo "local: *; };" >> $lib.exp~ $CC -shared -nostdlib ${wl}-M $wl$lib.exp -o $lib $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags~$rm $lib.exp' # Commands to make compiler produce verbose output that lists # what "hidden" libraries, object files and flags are used when # linking a shared library. output_verbose_link_cmd="$CC -shared $CFLAGS -v conftest.$objext 2>&1 | grep \"\-L\"" else # g++ 2.7 appears to require `-G' NOT `-shared' on this # platform. _LT_AC_TAGVAR(archive_cmds, $1)='$CC -G -nostdlib $LDFLAGS $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags ${wl}-h $wl$soname -o $lib' _LT_AC_TAGVAR(archive_expsym_cmds, $1)='$echo "{ global:" > $lib.exp~cat $export_symbols | $SED -e "s/\(.*\)/\1;/" >> $lib.exp~$echo "local: *; };" >> $lib.exp~ $CC -G -nostdlib ${wl}-M $wl$lib.exp -o $lib $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags~$rm $lib.exp' # Commands to make compiler produce verbose output that lists # what "hidden" libraries, object files and flags are used when # linking a shared library. output_verbose_link_cmd="$CC -G $CFLAGS -v conftest.$objext 2>&1 | grep \"\-L\"" fi _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='${wl}-R $wl$libdir' fi ;; esac ;; sysv5OpenUNIX8* | sysv5UnixWare7* | sysv5uw[[78]]* | unixware7*) _LT_AC_TAGVAR(archive_cmds_need_lc, $1)=no ;; tandem*) case $cc_basename in NCC) # NonStop-UX NCC 3.20 # FIXME: insert proper C++ library support _LT_AC_TAGVAR(ld_shlibs, $1)=no ;; *) # FIXME: insert proper C++ library support _LT_AC_TAGVAR(ld_shlibs, $1)=no ;; esac ;; vxworks*) # FIXME: insert proper C++ library support _LT_AC_TAGVAR(ld_shlibs, $1)=no ;; *) # FIXME: insert proper C++ library support _LT_AC_TAGVAR(ld_shlibs, $1)=no ;; esac AC_MSG_RESULT([$_LT_AC_TAGVAR(ld_shlibs, $1)]) test "$_LT_AC_TAGVAR(ld_shlibs, $1)" = no && can_build_shared=no _LT_AC_TAGVAR(GCC, $1)="$GXX" _LT_AC_TAGVAR(LD, $1)="$LD" AC_LIBTOOL_POSTDEP_PREDEP($1) AC_LIBTOOL_PROG_COMPILER_PIC($1) AC_LIBTOOL_PROG_CC_C_O($1) AC_LIBTOOL_SYS_HARD_LINK_LOCKS($1) AC_LIBTOOL_PROG_LD_SHLIBS($1) AC_LIBTOOL_SYS_DYNAMIC_LINKER($1) AC_LIBTOOL_PROG_LD_HARDCODE_LIBPATH($1) AC_LIBTOOL_SYS_LIB_STRIP AC_LIBTOOL_DLOPEN_SELF($1) AC_LIBTOOL_CONFIG($1) AC_LANG_POP CC=$lt_save_CC LDCXX=$LD LD=$lt_save_LD GCC=$lt_save_GCC with_gnu_ldcxx=$with_gnu_ld with_gnu_ld=$lt_save_with_gnu_ld lt_cv_path_LDCXX=$lt_cv_path_LD lt_cv_path_LD=$lt_save_path_LD lt_cv_prog_gnu_ldcxx=$lt_cv_prog_gnu_ld lt_cv_prog_gnu_ld=$lt_save_with_gnu_ld ])# AC_LIBTOOL_LANG_CXX_CONFIG # AC_LIBTOOL_POSTDEP_PREDEP([TAGNAME]) # ------------------------ # Figure out "hidden" library dependencies from verbose # compiler output when linking a shared library. # Parse the compiler output and extract the necessary # objects, libraries and library flags. AC_DEFUN([AC_LIBTOOL_POSTDEP_PREDEP],[ dnl we can't use the lt_simple_compile_test_code here, dnl because it contains code intended for an executable, dnl not a library. It's possible we should let each dnl tag define a new lt_????_link_test_code variable, dnl but it's only used here... ifelse([$1],[],[cat > conftest.$ac_ext < conftest.$ac_ext < conftest.$ac_ext < conftest.$ac_ext <> "$cfgfile" ifelse([$1], [], [#! $SHELL # `$echo "$cfgfile" | sed 's%^.*/%%'` - Provide generalized library-building support services. # Generated automatically by $PROGRAM (GNU $PACKAGE $VERSION$TIMESTAMP) # NOTE: Changes made to this file will be lost: look at ltmain.sh. # # Copyright (C) 1996, 1997, 1998, 1999, 2000, 2001 # Free Software Foundation, Inc. # # This file is part of GNU Libtool: # Originally by Gordon Matzigkeit , 1996 # # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2 of the License, or # (at your option) any later version. # # This program is distributed in the hope that it will be useful, but # WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU # General Public License for more details. # # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA. # # As a special exception to the GNU General Public License, if you # distribute this file as part of a program that contains a # configuration script generated by Autoconf, you may include it under # the same distribution terms that you use for the rest of that program. # A sed program that does not truncate output. SED=$lt_SED # Sed that helps us avoid accidentally triggering echo(1) options like -n. Xsed="$SED -e s/^X//" # The HP-UX ksh and POSIX shell print the target directory to stdout # if CDPATH is set. (unset CDPATH) >/dev/null 2>&1 && unset CDPATH # The names of the tagged configurations supported by this script. available_tags= # ### BEGIN LIBTOOL CONFIG], [# ### BEGIN LIBTOOL TAG CONFIG: $tagname]) # Libtool was configured on host `(hostname || uname -n) 2>/dev/null | sed 1q`: # Shell to use when invoking shell scripts. SHELL=$lt_SHELL # Whether or not to build shared libraries. build_libtool_libs=$enable_shared # Whether or not to build static libraries. build_old_libs=$enable_static # Whether or not to add -lc for building shared libraries. build_libtool_need_lc=$_LT_AC_TAGVAR(archive_cmds_need_lc, $1) # Whether or not to disallow shared libs when runtime libs are static allow_libtool_libs_with_static_runtimes=$_LT_AC_TAGVAR(enable_shared_with_static_runtimes, $1) # Whether or not to optimize for fast installation. fast_install=$enable_fast_install # The host system. host_alias=$host_alias host=$host # An echo program that does not interpret backslashes. echo=$lt_echo # The archiver. AR=$lt_AR AR_FLAGS=$lt_AR_FLAGS # A C compiler. LTCC=$lt_LTCC # A language-specific compiler. CC=$lt_[]_LT_AC_TAGVAR(compiler, $1) # Is the compiler the GNU C compiler? with_gcc=$_LT_AC_TAGVAR(GCC, $1) # An ERE matcher. EGREP=$lt_EGREP # The linker used to build libraries. LD=$lt_[]_LT_AC_TAGVAR(LD, $1) # Whether we need hard or soft links. LN_S=$lt_LN_S # A BSD-compatible nm program. NM=$lt_NM # A symbol stripping program STRIP=$lt_STRIP # Used to examine libraries when file_magic_cmd begins "file" MAGIC_CMD=$MAGIC_CMD # Used on cygwin: DLL creation program. DLLTOOL="$DLLTOOL" # Used on cygwin: object dumper. OBJDUMP="$OBJDUMP" # Used on cygwin: assembler. AS="$AS" # The name of the directory that contains temporary libtool files. objdir=$objdir # How to create reloadable object files. reload_flag=$lt_reload_flag reload_cmds=$lt_reload_cmds # How to pass a linker flag through the compiler. wl=$lt_[]_LT_AC_TAGVAR(lt_prog_compiler_wl, $1) # Object file suffix (normally "o"). objext="$ac_objext" # Old archive suffix (normally "a"). libext="$libext" # Shared library suffix (normally ".so"). shrext_cmds='$shrext_cmds' # Executable file suffix (normally ""). exeext="$exeext" # Additional compiler flags for building library objects. pic_flag=$lt_[]_LT_AC_TAGVAR(lt_prog_compiler_pic, $1) pic_mode=$pic_mode # What is the maximum length of a command? max_cmd_len=$lt_cv_sys_max_cmd_len # Does compiler simultaneously support -c and -o options? compiler_c_o=$lt_[]_LT_AC_TAGVAR(lt_cv_prog_compiler_c_o, $1) # Must we lock files when doing compilation ? need_locks=$lt_need_locks # Do we need the lib prefix for modules? need_lib_prefix=$need_lib_prefix # Do we need a version for libraries? need_version=$need_version # Whether dlopen is supported. dlopen_support=$enable_dlopen # Whether dlopen of programs is supported. dlopen_self=$enable_dlopen_self # Whether dlopen of statically linked programs is supported. dlopen_self_static=$enable_dlopen_self_static # Compiler flag to prevent dynamic linking. link_static_flag=$lt_[]_LT_AC_TAGVAR(lt_prog_compiler_static, $1) # Compiler flag to turn off builtin functions. no_builtin_flag=$lt_[]_LT_AC_TAGVAR(lt_prog_compiler_no_builtin_flag, $1) # Compiler flag to allow reflexive dlopens. export_dynamic_flag_spec=$lt_[]_LT_AC_TAGVAR(export_dynamic_flag_spec, $1) # Compiler flag to generate shared objects directly from archives. whole_archive_flag_spec=$lt_[]_LT_AC_TAGVAR(whole_archive_flag_spec, $1) # Compiler flag to generate thread-safe objects. thread_safe_flag_spec=$lt_[]_LT_AC_TAGVAR(thread_safe_flag_spec, $1) # Library versioning type. version_type=$version_type # Format of library name prefix. libname_spec=$lt_libname_spec # List of archive names. First name is the real one, the rest are links. # The last name is the one that the linker finds with -lNAME. library_names_spec=$lt_library_names_spec # The coded name of the library, if different from the real name. soname_spec=$lt_soname_spec # Commands used to build and install an old-style archive. RANLIB=$lt_RANLIB old_archive_cmds=$lt_[]_LT_AC_TAGVAR(old_archive_cmds, $1) old_postinstall_cmds=$lt_old_postinstall_cmds old_postuninstall_cmds=$lt_old_postuninstall_cmds # Create an old-style archive from a shared archive. old_archive_from_new_cmds=$lt_[]_LT_AC_TAGVAR(old_archive_from_new_cmds, $1) # Create a temporary old-style archive to link instead of a shared archive. old_archive_from_expsyms_cmds=$lt_[]_LT_AC_TAGVAR(old_archive_from_expsyms_cmds, $1) # Commands used to build and install a shared archive. archive_cmds=$lt_[]_LT_AC_TAGVAR(archive_cmds, $1) archive_expsym_cmds=$lt_[]_LT_AC_TAGVAR(archive_expsym_cmds, $1) postinstall_cmds=$lt_postinstall_cmds postuninstall_cmds=$lt_postuninstall_cmds # Commands used to build a loadable module (assumed same as above if empty) module_cmds=$lt_[]_LT_AC_TAGVAR(module_cmds, $1) module_expsym_cmds=$lt_[]_LT_AC_TAGVAR(module_expsym_cmds, $1) # Commands to strip libraries. old_striplib=$lt_old_striplib striplib=$lt_striplib # Dependencies to place before the objects being linked to create a # shared library. predep_objects=$lt_[]_LT_AC_TAGVAR(predep_objects, $1) # Dependencies to place after the objects being linked to create a # shared library. postdep_objects=$lt_[]_LT_AC_TAGVAR(postdep_objects, $1) # Dependencies to place before the objects being linked to create a # shared library. predeps=$lt_[]_LT_AC_TAGVAR(predeps, $1) # Dependencies to place after the objects being linked to create a # shared library. postdeps=$lt_[]_LT_AC_TAGVAR(postdeps, $1) # The library search path used internally by the compiler when linking # a shared library. compiler_lib_search_path=$lt_[]_LT_AC_TAGVAR(compiler_lib_search_path, $1) # Method to check whether dependent libraries are shared objects. deplibs_check_method=$lt_deplibs_check_method # Command to use when deplibs_check_method == file_magic. file_magic_cmd=$lt_file_magic_cmd # Flag that allows shared libraries with undefined symbols to be built. allow_undefined_flag=$lt_[]_LT_AC_TAGVAR(allow_undefined_flag, $1) # Flag that forces no undefined symbols. no_undefined_flag=$lt_[]_LT_AC_TAGVAR(no_undefined_flag, $1) # Commands used to finish a libtool library installation in a directory. finish_cmds=$lt_finish_cmds # Same as above, but a single script fragment to be evaled but not shown. finish_eval=$lt_finish_eval # Take the output of nm and produce a listing of raw symbols and C names. global_symbol_pipe=$lt_lt_cv_sys_global_symbol_pipe # Transform the output of nm in a proper C declaration global_symbol_to_cdecl=$lt_lt_cv_sys_global_symbol_to_cdecl # Transform the output of nm in a C name address pair global_symbol_to_c_name_address=$lt_lt_cv_sys_global_symbol_to_c_name_address # This is the shared library runtime path variable. runpath_var=$runpath_var # This is the shared library path variable. shlibpath_var=$shlibpath_var # Is shlibpath searched before the hard-coded library search path? shlibpath_overrides_runpath=$shlibpath_overrides_runpath # How to hardcode a shared library path into an executable. hardcode_action=$_LT_AC_TAGVAR(hardcode_action, $1) # Whether we should hardcode library paths into libraries. hardcode_into_libs=$hardcode_into_libs # Flag to hardcode \$libdir into a binary during linking. # This must work even if \$libdir does not exist. hardcode_libdir_flag_spec=$lt_[]_LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1) # If ld is used when linking, flag to hardcode \$libdir into # a binary during linking. This must work even if \$libdir does # not exist. hardcode_libdir_flag_spec_ld=$lt_[]_LT_AC_TAGVAR(hardcode_libdir_flag_spec_ld, $1) # Whether we need a single -rpath flag with a separated argument. hardcode_libdir_separator=$lt_[]_LT_AC_TAGVAR(hardcode_libdir_separator, $1) # Set to yes if using DIR/libNAME${shared_ext} during linking hardcodes DIR into the # resulting binary. hardcode_direct=$_LT_AC_TAGVAR(hardcode_direct, $1) # Set to yes if using the -LDIR flag during linking hardcodes DIR into the # resulting binary. hardcode_minus_L=$_LT_AC_TAGVAR(hardcode_minus_L, $1) # Set to yes if using SHLIBPATH_VAR=DIR during linking hardcodes DIR into # the resulting binary. hardcode_shlibpath_var=$_LT_AC_TAGVAR(hardcode_shlibpath_var, $1) # Set to yes if building a shared library automatically hardcodes DIR into the library # and all subsequent libraries and executables linked against it. hardcode_automatic=$_LT_AC_TAGVAR(hardcode_automatic, $1) # Variables whose values should be saved in libtool wrapper scripts and # restored at relink time. variables_saved_for_relink="$variables_saved_for_relink" # Whether libtool must link a program against all its dependency libraries. link_all_deplibs=$_LT_AC_TAGVAR(link_all_deplibs, $1) # Compile-time system search path for libraries sys_lib_search_path_spec=$lt_sys_lib_search_path_spec # Run-time system search path for libraries sys_lib_dlsearch_path_spec=$lt_sys_lib_dlsearch_path_spec # Fix the shell variable \$srcfile for the compiler. fix_srcfile_path="$_LT_AC_TAGVAR(fix_srcfile_path, $1)" # Set to yes if exported symbols are required. always_export_symbols=$_LT_AC_TAGVAR(always_export_symbols, $1) # The commands to list exported symbols. export_symbols_cmds=$lt_[]_LT_AC_TAGVAR(export_symbols_cmds, $1) # The commands to extract the exported symbol list from a shared archive. extract_expsyms_cmds=$lt_extract_expsyms_cmds # Symbols that should not be listed in the preloaded symbols. exclude_expsyms=$lt_[]_LT_AC_TAGVAR(exclude_expsyms, $1) # Symbols that must always be exported. include_expsyms=$lt_[]_LT_AC_TAGVAR(include_expsyms, $1) ifelse([$1],[], [# ### END LIBTOOL CONFIG], [# ### END LIBTOOL TAG CONFIG: $tagname]) __EOF__ ifelse([$1],[], [ case $host_os in aix3*) cat <<\EOF >> "$cfgfile" # AIX sometimes has problems with the GCC collect2 program. For some # reason, if we set the COLLECT_NAMES environment variable, the problems # vanish in a puff of smoke. if test "X${COLLECT_NAMES+set}" != Xset; then COLLECT_NAMES= export COLLECT_NAMES fi EOF ;; esac # We use sed instead of cat because bash on DJGPP gets confused if # if finds mixed CR/LF and LF-only lines. Since sed operates in # text mode, it properly converts lines to CR/LF. This bash problem # is reportedly fixed, but why not run on old versions too? sed '$q' "$ltmain" >> "$cfgfile" || (rm -f "$cfgfile"; exit 1) mv -f "$cfgfile" "$ofile" || \ (rm -f "$ofile" && cp "$cfgfile" "$ofile" && rm -f "$cfgfile") chmod +x "$ofile" ]) else # If there is no Makefile yet, we rely on a make rule to execute # `config.status --recheck' to rerun these tests and create the # libtool script then. ltmain_in=`echo $ltmain | sed -e 's/\.sh$/.in/'` if test -f "$ltmain_in"; then test -f Makefile && make "$ltmain" fi fi ])# AC_LIBTOOL_CONFIG # AC_LIBTOOL_PROG_COMPILER_NO_RTTI([TAGNAME]) # ------------------------------------------- AC_DEFUN([AC_LIBTOOL_PROG_COMPILER_NO_RTTI], [AC_REQUIRE([_LT_AC_SYS_COMPILER])dnl _LT_AC_TAGVAR(lt_prog_compiler_no_builtin_flag, $1)= if test "$GCC" = yes; then _LT_AC_TAGVAR(lt_prog_compiler_no_builtin_flag, $1)=' -fno-builtin' AC_LIBTOOL_COMPILER_OPTION([if $compiler supports -fno-rtti -fno-exceptions], lt_cv_prog_compiler_rtti_exceptions, [-fno-rtti -fno-exceptions], [], [_LT_AC_TAGVAR(lt_prog_compiler_no_builtin_flag, $1)="$_LT_AC_TAGVAR(lt_prog_compiler_no_builtin_flag, $1) -fno-rtti -fno-exceptions"]) fi ])# AC_LIBTOOL_PROG_COMPILER_NO_RTTI # AC_LIBTOOL_SYS_GLOBAL_SYMBOL_PIPE # --------------------------------- AC_DEFUN([AC_LIBTOOL_SYS_GLOBAL_SYMBOL_PIPE], [AC_REQUIRE([AC_CANONICAL_HOST]) AC_REQUIRE([AC_PROG_NM]) AC_REQUIRE([AC_OBJEXT]) # Check for command to grab the raw symbol name followed by C symbol from nm. AC_MSG_CHECKING([command to parse $NM output from $compiler object]) AC_CACHE_VAL([lt_cv_sys_global_symbol_pipe], [ # These are sane defaults that work on at least a few old systems. # [They come from Ultrix. What could be older than Ultrix?!! ;)] # Character class describing NM global symbol codes. symcode='[[BCDEGRST]]' # Regexp to match symbols that can be accessed directly from C. sympat='\([[_A-Za-z]][[_A-Za-z0-9]]*\)' # Transform the above into a raw symbol and a C symbol. symxfrm='\1 \2\3 \3' # Transform an extracted symbol line into a proper C declaration lt_cv_sys_global_symbol_to_cdecl="sed -n -e 's/^. .* \(.*\)$/extern int \1;/p'" # Transform an extracted symbol line into symbol name and symbol address lt_cv_sys_global_symbol_to_c_name_address="sed -n -e 's/^: \([[^ ]]*\) $/ {\\\"\1\\\", (lt_ptr) 0},/p' -e 's/^$symcode \([[^ ]]*\) \([[^ ]]*\)$/ {\"\2\", (lt_ptr) \&\2},/p'" # Define system-specific variables. case $host_os in aix*) symcode='[[BCDT]]' ;; cygwin* | mingw* | pw32*) symcode='[[ABCDGISTW]]' ;; hpux*) # Its linker distinguishes data from code symbols if test "$host_cpu" = ia64; then symcode='[[ABCDEGRST]]' fi lt_cv_sys_global_symbol_to_cdecl="sed -n -e 's/^T .* \(.*\)$/extern int \1();/p' -e 's/^$symcode* .* \(.*\)$/extern char \1;/p'" lt_cv_sys_global_symbol_to_c_name_address="sed -n -e 's/^: \([[^ ]]*\) $/ {\\\"\1\\\", (lt_ptr) 0},/p' -e 's/^$symcode* \([[^ ]]*\) \([[^ ]]*\)$/ {\"\2\", (lt_ptr) \&\2},/p'" ;; linux*) if test "$host_cpu" = ia64; then symcode='[[ABCDGIRSTW]]' lt_cv_sys_global_symbol_to_cdecl="sed -n -e 's/^T .* \(.*\)$/extern int \1();/p' -e 's/^$symcode* .* \(.*\)$/extern char \1;/p'" lt_cv_sys_global_symbol_to_c_name_address="sed -n -e 's/^: \([[^ ]]*\) $/ {\\\"\1\\\", (lt_ptr) 0},/p' -e 's/^$symcode* \([[^ ]]*\) \([[^ ]]*\)$/ {\"\2\", (lt_ptr) \&\2},/p'" fi ;; irix* | nonstopux*) symcode='[[BCDEGRST]]' ;; osf*) symcode='[[BCDEGQRST]]' ;; solaris* | sysv5*) symcode='[[BDRT]]' ;; sysv4) symcode='[[DFNSTU]]' ;; esac # Handle CRLF in mingw tool chain opt_cr= case $build_os in mingw*) opt_cr=`echo 'x\{0,1\}' | tr x '\015'` # option cr in regexp ;; esac # If we're using GNU nm, then use its standard symbol codes. case `$NM -V 2>&1` in *GNU* | *'with BFD'*) symcode='[[ABCDGIRSTW]]' ;; esac # Try without a prefix undercore, then with it. for ac_symprfx in "" "_"; do # Write the raw and C identifiers. lt_cv_sys_global_symbol_pipe="sed -n -e 's/^.*[[ ]]\($symcode$symcode*\)[[ ]][[ ]]*\($ac_symprfx\)$sympat$opt_cr$/$symxfrm/p'" # Check to see that the pipe works correctly. pipe_works=no rm -f conftest* cat > conftest.$ac_ext < $nlist) && test -s "$nlist"; then # Try sorting and uniquifying the output. if sort "$nlist" | uniq > "$nlist"T; then mv -f "$nlist"T "$nlist" else rm -f "$nlist"T fi # Make sure that we snagged all the symbols we need. if grep ' nm_test_var$' "$nlist" >/dev/null; then if grep ' nm_test_func$' "$nlist" >/dev/null; then cat < conftest.$ac_ext #ifdef __cplusplus extern "C" { #endif EOF # Now generate the symbol file. eval "$lt_cv_sys_global_symbol_to_cdecl"' < "$nlist" | grep -v main >> conftest.$ac_ext' cat <> conftest.$ac_ext #if defined (__STDC__) && __STDC__ # define lt_ptr_t void * #else # define lt_ptr_t char * # define const #endif /* The mapping between symbol names and symbols. */ const struct { const char *name; lt_ptr_t address; } lt_preloaded_symbols[[]] = { EOF $SED "s/^$symcode$symcode* \(.*\) \(.*\)$/ {\"\2\", (lt_ptr_t) \&\2},/" < "$nlist" | grep -v main >> conftest.$ac_ext cat <<\EOF >> conftest.$ac_ext {0, (lt_ptr_t) 0} }; #ifdef __cplusplus } #endif EOF # Now try linking the two files. mv conftest.$ac_objext conftstm.$ac_objext lt_save_LIBS="$LIBS" lt_save_CFLAGS="$CFLAGS" LIBS="conftstm.$ac_objext" CFLAGS="$CFLAGS$_LT_AC_TAGVAR(lt_prog_compiler_no_builtin_flag, $1)" if AC_TRY_EVAL(ac_link) && test -s conftest${ac_exeext}; then pipe_works=yes fi LIBS="$lt_save_LIBS" CFLAGS="$lt_save_CFLAGS" else echo "cannot find nm_test_func in $nlist" >&AS_MESSAGE_LOG_FD fi else echo "cannot find nm_test_var in $nlist" >&AS_MESSAGE_LOG_FD fi else echo "cannot run $lt_cv_sys_global_symbol_pipe" >&AS_MESSAGE_LOG_FD fi else echo "$progname: failed program was:" >&AS_MESSAGE_LOG_FD cat conftest.$ac_ext >&5 fi rm -f conftest* conftst* # Do not use the global_symbol_pipe unless it works. if test "$pipe_works" = yes; then break else lt_cv_sys_global_symbol_pipe= fi done ]) if test -z "$lt_cv_sys_global_symbol_pipe"; then lt_cv_sys_global_symbol_to_cdecl= fi if test -z "$lt_cv_sys_global_symbol_pipe$lt_cv_sys_global_symbol_to_cdecl"; then AC_MSG_RESULT(failed) else AC_MSG_RESULT(ok) fi ]) # AC_LIBTOOL_SYS_GLOBAL_SYMBOL_PIPE # AC_LIBTOOL_PROG_COMPILER_PIC([TAGNAME]) # --------------------------------------- AC_DEFUN([AC_LIBTOOL_PROG_COMPILER_PIC], [_LT_AC_TAGVAR(lt_prog_compiler_wl, $1)= _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)= _LT_AC_TAGVAR(lt_prog_compiler_static, $1)= AC_MSG_CHECKING([for $compiler option to produce PIC]) ifelse([$1],[CXX],[ # C++ specific cases for pic, static, wl, etc. if test "$GXX" = yes; then _LT_AC_TAGVAR(lt_prog_compiler_wl, $1)='-Wl,' _LT_AC_TAGVAR(lt_prog_compiler_static, $1)='-static' case $host_os in aix*) # All AIX code is PIC. if test "$host_cpu" = ia64; then # AIX 5 now supports IA64 processor _LT_AC_TAGVAR(lt_prog_compiler_static, $1)='-Bstatic' fi ;; amigaos*) # FIXME: we need at least 68020 code to build shared libraries, but # adding the `-m68020' flag to GCC prevents building anything better, # like `-m68040'. _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)='-m68020 -resident32 -malways-restore-a4' ;; beos* | cygwin* | irix5* | irix6* | nonstopux* | osf3* | osf4* | osf5*) # PIC is the default for these OSes. ;; mingw* | os2* | pw32*) # This hack is so that the source file can tell whether it is being # built for inclusion in a dll (and should export symbols for example). _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)='-DDLL_EXPORT' ;; darwin* | rhapsody*) # PIC is the default on this platform # Common symbols not allowed in MH_DYLIB files _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)='-fno-common' ;; *djgpp*) # DJGPP does not support shared libraries at all _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)= ;; sysv4*MP*) if test -d /usr/nec; then _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)=-Kconform_pic fi ;; hpux*) # PIC is the default for IA64 HP-UX and 64-bit HP-UX, but # not for PA HP-UX. case "$host_cpu" in hppa*64*|ia64*) ;; *) _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)='-fPIC' ;; esac ;; *) _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)='-fPIC' ;; esac else case $host_os in aix4* | aix5*) # All AIX code is PIC. if test "$host_cpu" = ia64; then # AIX 5 now supports IA64 processor _LT_AC_TAGVAR(lt_prog_compiler_static, $1)='-Bstatic' else _LT_AC_TAGVAR(lt_prog_compiler_static, $1)='-bnso -bI:/lib/syscalls.exp' fi ;; chorus*) case $cc_basename in cxch68) # Green Hills C++ Compiler # _LT_AC_TAGVAR(lt_prog_compiler_static, $1)="--no_auto_instantiation -u __main -u __premain -u _abort -r $COOL_DIR/lib/libOrb.a $MVME_DIR/lib/CC/libC.a $MVME_DIR/lib/classix/libcx.s.a" ;; esac ;; darwin*) # PIC is the default on this platform # Common symbols not allowed in MH_DYLIB files case "$cc_basename" in xlc*) _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)='-qnocommon' _LT_AC_TAGVAR(lt_prog_compiler_wl, $1)='-Wl,' ;; esac ;; dgux*) case $cc_basename in ec++) _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)='-KPIC' ;; ghcx) # Green Hills C++ Compiler _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)='-pic' ;; *) ;; esac ;; freebsd* | kfreebsd*-gnu) # FreeBSD uses GNU C++ ;; hpux9* | hpux10* | hpux11*) case $cc_basename in CC) _LT_AC_TAGVAR(lt_prog_compiler_wl, $1)='-Wl,' _LT_AC_TAGVAR(lt_prog_compiler_static, $1)="${ac_cv_prog_cc_wl}-a ${ac_cv_prog_cc_wl}archive" if test "$host_cpu" != ia64; then _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)='+Z' fi ;; aCC) _LT_AC_TAGVAR(lt_prog_compiler_wl, $1)='-Wl,' _LT_AC_TAGVAR(lt_prog_compiler_static, $1)="${ac_cv_prog_cc_wl}-a ${ac_cv_prog_cc_wl}archive" case "$host_cpu" in hppa*64*|ia64*) # +Z the default ;; *) _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)='+Z' ;; esac ;; *) ;; esac ;; irix5* | irix6* | nonstopux*) case $cc_basename in CC) _LT_AC_TAGVAR(lt_prog_compiler_wl, $1)='-Wl,' _LT_AC_TAGVAR(lt_prog_compiler_static, $1)='-non_shared' # CC pic flag -KPIC is the default. ;; *) ;; esac ;; linux*) case $cc_basename in KCC) # KAI C++ Compiler _LT_AC_TAGVAR(lt_prog_compiler_wl, $1)='--backend -Wl,' _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)='-fPIC' ;; icpc) # Intel C++ _LT_AC_TAGVAR(lt_prog_compiler_wl, $1)='-Wl,' _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)='-KPIC' _LT_AC_TAGVAR(lt_prog_compiler_static, $1)='-static' ;; cxx) # Compaq C++ # Make sure the PIC flag is empty. It appears that all Alpha # Linux and Compaq Tru64 Unix objects are PIC. _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)= _LT_AC_TAGVAR(lt_prog_compiler_static, $1)='-non_shared' ;; *) ;; esac ;; lynxos*) ;; m88k*) ;; mvs*) case $cc_basename in cxx) _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)='-W c,exportall' ;; *) ;; esac ;; netbsd*) ;; osf3* | osf4* | osf5*) case $cc_basename in KCC) _LT_AC_TAGVAR(lt_prog_compiler_wl, $1)='--backend -Wl,' ;; RCC) # Rational C++ 2.4.1 _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)='-pic' ;; cxx) # Digital/Compaq C++ _LT_AC_TAGVAR(lt_prog_compiler_wl, $1)='-Wl,' # Make sure the PIC flag is empty. It appears that all Alpha # Linux and Compaq Tru64 Unix objects are PIC. _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)= _LT_AC_TAGVAR(lt_prog_compiler_static, $1)='-non_shared' ;; *) ;; esac ;; psos*) ;; sco*) case $cc_basename in CC) _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)='-fPIC' ;; *) ;; esac ;; solaris*) case $cc_basename in CC) # Sun C++ 4.2, 5.x and Centerline C++ _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)='-KPIC' _LT_AC_TAGVAR(lt_prog_compiler_static, $1)='-Bstatic' _LT_AC_TAGVAR(lt_prog_compiler_wl, $1)='-Qoption ld ' ;; gcx) # Green Hills C++ Compiler _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)='-PIC' ;; *) ;; esac ;; sunos4*) case $cc_basename in CC) # Sun C++ 4.x _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)='-pic' _LT_AC_TAGVAR(lt_prog_compiler_static, $1)='-Bstatic' ;; lcc) # Lucid _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)='-pic' ;; *) ;; esac ;; tandem*) case $cc_basename in NCC) # NonStop-UX NCC 3.20 _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)='-KPIC' ;; *) ;; esac ;; unixware*) ;; vxworks*) ;; *) _LT_AC_TAGVAR(lt_prog_compiler_can_build_shared, $1)=no ;; esac fi ], [ if test "$GCC" = yes; then _LT_AC_TAGVAR(lt_prog_compiler_wl, $1)='-Wl,' _LT_AC_TAGVAR(lt_prog_compiler_static, $1)='-static' case $host_os in aix*) # All AIX code is PIC. if test "$host_cpu" = ia64; then # AIX 5 now supports IA64 processor _LT_AC_TAGVAR(lt_prog_compiler_static, $1)='-Bstatic' fi ;; amigaos*) # FIXME: we need at least 68020 code to build shared libraries, but # adding the `-m68020' flag to GCC prevents building anything better, # like `-m68040'. _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)='-m68020 -resident32 -malways-restore-a4' ;; beos* | cygwin* | irix5* | irix6* | nonstopux* | osf3* | osf4* | osf5*) # PIC is the default for these OSes. ;; mingw* | pw32* | os2*) # This hack is so that the source file can tell whether it is being # built for inclusion in a dll (and should export symbols for example). _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)='-DDLL_EXPORT' ;; darwin* | rhapsody*) # PIC is the default on this platform # Common symbols not allowed in MH_DYLIB files _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)='-fno-common' ;; msdosdjgpp*) # Just because we use GCC doesn't mean we suddenly get shared libraries # on systems that don't support them. _LT_AC_TAGVAR(lt_prog_compiler_can_build_shared, $1)=no enable_shared=no ;; sysv4*MP*) if test -d /usr/nec; then _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)=-Kconform_pic fi ;; hpux*) # PIC is the default for IA64 HP-UX and 64-bit HP-UX, but # not for PA HP-UX. case "$host_cpu" in hppa*64*|ia64*) # +Z the default ;; *) _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)='-fPIC' ;; esac ;; *) _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)='-fPIC' ;; esac else # PORTME Check for flag to pass linker flags through the system compiler. case $host_os in aix*) _LT_AC_TAGVAR(lt_prog_compiler_wl, $1)='-Wl,' if test "$host_cpu" = ia64; then # AIX 5 now supports IA64 processor _LT_AC_TAGVAR(lt_prog_compiler_static, $1)='-Bstatic' else _LT_AC_TAGVAR(lt_prog_compiler_static, $1)='-bnso -bI:/lib/syscalls.exp' fi ;; darwin*) # PIC is the default on this platform # Common symbols not allowed in MH_DYLIB files case "$cc_basename" in xlc*) _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)='-qnocommon' _LT_AC_TAGVAR(lt_prog_compiler_wl, $1)='-Wl,' ;; esac ;; mingw* | pw32* | os2*) # This hack is so that the source file can tell whether it is being # built for inclusion in a dll (and should export symbols for example). _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)='-DDLL_EXPORT' ;; hpux9* | hpux10* | hpux11*) _LT_AC_TAGVAR(lt_prog_compiler_wl, $1)='-Wl,' # PIC is the default for IA64 HP-UX and 64-bit HP-UX, but # not for PA HP-UX. case "$host_cpu" in hppa*64*|ia64*) # +Z the default ;; *) _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)='+Z' ;; esac # Is there a better lt_prog_compiler_static that works with the bundled CC? _LT_AC_TAGVAR(lt_prog_compiler_static, $1)='${wl}-a ${wl}archive' ;; irix5* | irix6* | nonstopux*) _LT_AC_TAGVAR(lt_prog_compiler_wl, $1)='-Wl,' # PIC (with -KPIC) is the default. _LT_AC_TAGVAR(lt_prog_compiler_static, $1)='-non_shared' ;; newsos6) _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)='-KPIC' _LT_AC_TAGVAR(lt_prog_compiler_static, $1)='-Bstatic' ;; linux*) case $CC in icc* | ecc*) _LT_AC_TAGVAR(lt_prog_compiler_wl, $1)='-Wl,' _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)='-KPIC' _LT_AC_TAGVAR(lt_prog_compiler_static, $1)='-static' ;; ccc*) _LT_AC_TAGVAR(lt_prog_compiler_wl, $1)='-Wl,' # All Alpha code is PIC. _LT_AC_TAGVAR(lt_prog_compiler_static, $1)='-non_shared' ;; esac ;; osf3* | osf4* | osf5*) _LT_AC_TAGVAR(lt_prog_compiler_wl, $1)='-Wl,' # All OSF/1 code is PIC. _LT_AC_TAGVAR(lt_prog_compiler_static, $1)='-non_shared' ;; sco3.2v5*) _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)='-Kpic' _LT_AC_TAGVAR(lt_prog_compiler_static, $1)='-dn' ;; solaris*) _LT_AC_TAGVAR(lt_prog_compiler_wl, $1)='-Wl,' _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)='-KPIC' _LT_AC_TAGVAR(lt_prog_compiler_static, $1)='-Bstatic' ;; sunos4*) _LT_AC_TAGVAR(lt_prog_compiler_wl, $1)='-Qoption ld ' _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)='-PIC' _LT_AC_TAGVAR(lt_prog_compiler_static, $1)='-Bstatic' ;; sysv4 | sysv4.2uw2* | sysv4.3* | sysv5*) _LT_AC_TAGVAR(lt_prog_compiler_wl, $1)='-Wl,' _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)='-KPIC' _LT_AC_TAGVAR(lt_prog_compiler_static, $1)='-Bstatic' ;; sysv4*MP*) if test -d /usr/nec ;then _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)='-Kconform_pic' _LT_AC_TAGVAR(lt_prog_compiler_static, $1)='-Bstatic' fi ;; uts4*) _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)='-pic' _LT_AC_TAGVAR(lt_prog_compiler_static, $1)='-Bstatic' ;; *) _LT_AC_TAGVAR(lt_prog_compiler_can_build_shared, $1)=no ;; esac fi ]) AC_MSG_RESULT([$_LT_AC_TAGVAR(lt_prog_compiler_pic, $1)]) # # Check to make sure the PIC flag actually works. # if test -n "$_LT_AC_TAGVAR(lt_prog_compiler_pic, $1)"; then AC_LIBTOOL_COMPILER_OPTION([if $compiler PIC flag $_LT_AC_TAGVAR(lt_prog_compiler_pic, $1) works], _LT_AC_TAGVAR(lt_prog_compiler_pic_works, $1), [$_LT_AC_TAGVAR(lt_prog_compiler_pic, $1)ifelse([$1],[],[ -DPIC],[ifelse([$1],[CXX],[ -DPIC],[])])], [], [case $_LT_AC_TAGVAR(lt_prog_compiler_pic, $1) in "" | " "*) ;; *) _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)=" $_LT_AC_TAGVAR(lt_prog_compiler_pic, $1)" ;; esac], [_LT_AC_TAGVAR(lt_prog_compiler_pic, $1)= _LT_AC_TAGVAR(lt_prog_compiler_can_build_shared, $1)=no]) fi case "$host_os" in # For platforms which do not support PIC, -DPIC is meaningless: *djgpp*) _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)= ;; *) _LT_AC_TAGVAR(lt_prog_compiler_pic, $1)="$_LT_AC_TAGVAR(lt_prog_compiler_pic, $1)ifelse([$1],[],[ -DPIC],[ifelse([$1],[CXX],[ -DPIC],[])])" ;; esac ]) # AC_LIBTOOL_PROG_LD_SHLIBS([TAGNAME]) # ------------------------------------ # See if the linker supports building shared libraries. AC_DEFUN([AC_LIBTOOL_PROG_LD_SHLIBS], [AC_MSG_CHECKING([whether the $compiler linker ($LD) supports shared libraries]) ifelse([$1],[CXX],[ _LT_AC_TAGVAR(export_symbols_cmds, $1)='$NM $libobjs $convenience | $global_symbol_pipe | $SED '\''s/.* //'\'' | sort | uniq > $export_symbols' case $host_os in aix4* | aix5*) # If we're using GNU nm, then we don't want the "-C" option. # -C means demangle to AIX nm, but means don't demangle with GNU nm if $NM -V 2>&1 | grep 'GNU' > /dev/null; then _LT_AC_TAGVAR(export_symbols_cmds, $1)='$NM -Bpg $libobjs $convenience | awk '\''{ if (((\[$]2 == "T") || (\[$]2 == "D") || (\[$]2 == "B")) && ([substr](\[$]3,1,1) != ".")) { print \[$]3 } }'\'' | sort -u > $export_symbols' else _LT_AC_TAGVAR(export_symbols_cmds, $1)='$NM -BCpg $libobjs $convenience | awk '\''{ if (((\[$]2 == "T") || (\[$]2 == "D") || (\[$]2 == "B")) && ([substr](\[$]3,1,1) != ".")) { print \[$]3 } }'\'' | sort -u > $export_symbols' fi ;; pw32*) _LT_AC_TAGVAR(export_symbols_cmds, $1)="$ltdll_cmds" ;; cygwin* | mingw*) _LT_AC_TAGVAR(export_symbols_cmds, $1)='$NM $libobjs $convenience | $global_symbol_pipe | $SED -e '\''/^[[BCDGS]] /s/.* \([[^ ]]*\)/\1 DATA/'\'' | $SED -e '\''/^[[AITW]] /s/.* //'\'' | sort | uniq > $export_symbols' ;; *) _LT_AC_TAGVAR(export_symbols_cmds, $1)='$NM $libobjs $convenience | $global_symbol_pipe | $SED '\''s/.* //'\'' | sort | uniq > $export_symbols' ;; esac ],[ runpath_var= _LT_AC_TAGVAR(allow_undefined_flag, $1)= _LT_AC_TAGVAR(enable_shared_with_static_runtimes, $1)=no _LT_AC_TAGVAR(archive_cmds, $1)= _LT_AC_TAGVAR(archive_expsym_cmds, $1)= _LT_AC_TAGVAR(old_archive_From_new_cmds, $1)= _LT_AC_TAGVAR(old_archive_from_expsyms_cmds, $1)= _LT_AC_TAGVAR(export_dynamic_flag_spec, $1)= _LT_AC_TAGVAR(whole_archive_flag_spec, $1)= _LT_AC_TAGVAR(thread_safe_flag_spec, $1)= _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)= _LT_AC_TAGVAR(hardcode_libdir_flag_spec_ld, $1)= _LT_AC_TAGVAR(hardcode_libdir_separator, $1)= _LT_AC_TAGVAR(hardcode_direct, $1)=no _LT_AC_TAGVAR(hardcode_minus_L, $1)=no _LT_AC_TAGVAR(hardcode_shlibpath_var, $1)=unsupported _LT_AC_TAGVAR(link_all_deplibs, $1)=unknown _LT_AC_TAGVAR(hardcode_automatic, $1)=no _LT_AC_TAGVAR(module_cmds, $1)= _LT_AC_TAGVAR(module_expsym_cmds, $1)= _LT_AC_TAGVAR(always_export_symbols, $1)=no _LT_AC_TAGVAR(export_symbols_cmds, $1)='$NM $libobjs $convenience | $global_symbol_pipe | $SED '\''s/.* //'\'' | sort | uniq > $export_symbols' # include_expsyms should be a list of space-separated symbols to be *always* # included in the symbol list _LT_AC_TAGVAR(include_expsyms, $1)= # exclude_expsyms can be an extended regexp of symbols to exclude # it will be wrapped by ` (' and `)$', so one must not match beginning or # end of line. Example: `a|bc|.*d.*' will exclude the symbols `a' and `bc', # as well as any symbol that contains `d'. _LT_AC_TAGVAR(exclude_expsyms, $1)="_GLOBAL_OFFSET_TABLE_" # Although _GLOBAL_OFFSET_TABLE_ is a valid symbol C name, most a.out # platforms (ab)use it in PIC code, but their linkers get confused if # the symbol is explicitly referenced. Since portable code cannot # rely on this symbol name, it's probably fine to never include it in # preloaded symbol tables. extract_expsyms_cmds= case $host_os in cygwin* | mingw* | pw32*) # FIXME: the MSVC++ port hasn't been tested in a loooong time # When not using gcc, we currently assume that we are using # Microsoft Visual C++. if test "$GCC" != yes; then with_gnu_ld=no fi ;; openbsd*) with_gnu_ld=no ;; esac _LT_AC_TAGVAR(ld_shlibs, $1)=yes if test "$with_gnu_ld" = yes; then # If archive_cmds runs LD, not CC, wlarc should be empty wlarc='${wl}' # See if GNU ld supports shared libraries. case $host_os in aix3* | aix4* | aix5*) # On AIX/PPC, the GNU linker is very broken if test "$host_cpu" != ia64; then _LT_AC_TAGVAR(ld_shlibs, $1)=no cat <&2 *** Warning: the GNU linker, at least up to release 2.9.1, is reported *** to be unable to reliably create shared libraries on AIX. *** Therefore, libtool is disabling shared libraries support. If you *** really care for shared libraries, you may want to modify your PATH *** so that a non-GNU linker is found, and then restart. EOF fi ;; amigaos*) _LT_AC_TAGVAR(archive_cmds, $1)='$rm $output_objdir/a2ixlibrary.data~$echo "#define NAME $libname" > $output_objdir/a2ixlibrary.data~$echo "#define LIBRARY_ID 1" >> $output_objdir/a2ixlibrary.data~$echo "#define VERSION $major" >> $output_objdir/a2ixlibrary.data~$echo "#define REVISION $revision" >> $output_objdir/a2ixlibrary.data~$AR $AR_FLAGS $lib $libobjs~$RANLIB $lib~(cd $output_objdir && a2ixlibrary -32)' _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='-L$libdir' _LT_AC_TAGVAR(hardcode_minus_L, $1)=yes # Samuel A. Falvo II reports # that the semantics of dynamic libraries on AmigaOS, at least up # to version 4, is to share data among multiple programs linked # with the same dynamic library. Since this doesn't match the # behavior of shared libraries on other platforms, we can't use # them. _LT_AC_TAGVAR(ld_shlibs, $1)=no ;; beos*) if $LD --help 2>&1 | grep ': supported targets:.* elf' > /dev/null; then _LT_AC_TAGVAR(allow_undefined_flag, $1)=unsupported # Joseph Beckenbach says some releases of gcc # support --undefined. This deserves some investigation. FIXME _LT_AC_TAGVAR(archive_cmds, $1)='$CC -nostart $libobjs $deplibs $compiler_flags ${wl}-soname $wl$soname -o $lib' else _LT_AC_TAGVAR(ld_shlibs, $1)=no fi ;; cygwin* | mingw* | pw32*) # _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1) is actually meaningless, # as there is no search path for DLLs. _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='-L$libdir' _LT_AC_TAGVAR(allow_undefined_flag, $1)=unsupported _LT_AC_TAGVAR(always_export_symbols, $1)=no _LT_AC_TAGVAR(enable_shared_with_static_runtimes, $1)=yes _LT_AC_TAGVAR(export_symbols_cmds, $1)='$NM $libobjs $convenience | $global_symbol_pipe | $SED -e '\''/^[[BCDGS]] /s/.* \([[^ ]]*\)/\1 DATA/'\'' | $SED -e '\''/^[[AITW]] /s/.* //'\'' | sort | uniq > $export_symbols' if $LD --help 2>&1 | grep 'auto-import' > /dev/null; then _LT_AC_TAGVAR(archive_cmds, $1)='$CC -shared $libobjs $deplibs $compiler_flags -o $output_objdir/$soname ${wl}--image-base=0x10000000 ${wl}--out-implib,$lib' # If the export-symbols file already is a .def file (1st line # is EXPORTS), use it as is; otherwise, prepend... _LT_AC_TAGVAR(archive_expsym_cmds, $1)='if test "x`$SED 1q $export_symbols`" = xEXPORTS; then cp $export_symbols $output_objdir/$soname.def; else echo EXPORTS > $output_objdir/$soname.def; cat $export_symbols >> $output_objdir/$soname.def; fi~ $CC -shared $output_objdir/$soname.def $libobjs $deplibs $compiler_flags -o $output_objdir/$soname ${wl}--image-base=0x10000000 ${wl}--out-implib,$lib' else ld_shlibs=no fi ;; netbsd*) if echo __ELF__ | $CC -E - | grep __ELF__ >/dev/null; then _LT_AC_TAGVAR(archive_cmds, $1)='$LD -Bshareable $libobjs $deplibs $linker_flags -o $lib' wlarc= else _LT_AC_TAGVAR(archive_cmds, $1)='$CC -shared $libobjs $deplibs $compiler_flags ${wl}-soname $wl$soname -o $lib' _LT_AC_TAGVAR(archive_expsym_cmds, $1)='$CC -shared $libobjs $deplibs $compiler_flags ${wl}-soname $wl$soname ${wl}-retain-symbols-file $wl$export_symbols -o $lib' fi ;; solaris* | sysv5*) if $LD -v 2>&1 | grep 'BFD 2\.8' > /dev/null; then _LT_AC_TAGVAR(ld_shlibs, $1)=no cat <&2 *** Warning: The releases 2.8.* of the GNU linker cannot reliably *** create shared libraries on Solaris systems. Therefore, libtool *** is disabling shared libraries support. We urge you to upgrade GNU *** binutils to release 2.9.1 or newer. Another option is to modify *** your PATH or compiler configuration so that the native linker is *** used, and then restart. EOF elif $LD --help 2>&1 | grep ': supported targets:.* elf' > /dev/null; then _LT_AC_TAGVAR(archive_cmds, $1)='$CC -shared $libobjs $deplibs $compiler_flags ${wl}-soname $wl$soname -o $lib' _LT_AC_TAGVAR(archive_expsym_cmds, $1)='$CC -shared $libobjs $deplibs $compiler_flags ${wl}-soname $wl$soname ${wl}-retain-symbols-file $wl$export_symbols -o $lib' else _LT_AC_TAGVAR(ld_shlibs, $1)=no fi ;; sunos4*) _LT_AC_TAGVAR(archive_cmds, $1)='$LD -assert pure-text -Bshareable -o $lib $libobjs $deplibs $linker_flags' wlarc= _LT_AC_TAGVAR(hardcode_direct, $1)=yes _LT_AC_TAGVAR(hardcode_shlibpath_var, $1)=no ;; linux*) if $LD --help 2>&1 | grep ': supported targets:.* elf' > /dev/null; then tmp_archive_cmds='$CC -shared $libobjs $deplibs $compiler_flags ${wl}-soname $wl$soname -o $lib' _LT_AC_TAGVAR(archive_cmds, $1)="$tmp_archive_cmds" supports_anon_versioning=no case `$LD -v 2>/dev/null` in *\ [01].* | *\ 2.[[0-9]].* | *\ 2.10.*) ;; # catch versions < 2.11 *\ 2.11.93.0.2\ *) supports_anon_versioning=yes ;; # RH7.3 ... *\ 2.11.92.0.12\ *) supports_anon_versioning=yes ;; # Mandrake 8.2 ... *\ 2.11.*) ;; # other 2.11 versions *) supports_anon_versioning=yes ;; esac if test $supports_anon_versioning = yes; then _LT_AC_TAGVAR(archive_expsym_cmds, $1)='$echo "{ global:" > $output_objdir/$libname.ver~ cat $export_symbols | sed -e "s/\(.*\)/\1;/" >> $output_objdir/$libname.ver~ $echo "local: *; };" >> $output_objdir/$libname.ver~ $CC -shared $libobjs $deplibs $compiler_flags ${wl}-soname $wl$soname ${wl}-version-script ${wl}$output_objdir/$libname.ver -o $lib' else _LT_AC_TAGVAR(archive_expsym_cmds, $1)="$tmp_archive_cmds" fi else _LT_AC_TAGVAR(ld_shlibs, $1)=no fi ;; *) if $LD --help 2>&1 | grep ': supported targets:.* elf' > /dev/null; then _LT_AC_TAGVAR(archive_cmds, $1)='$CC -shared $libobjs $deplibs $compiler_flags ${wl}-soname $wl$soname -o $lib' _LT_AC_TAGVAR(archive_expsym_cmds, $1)='$CC -shared $libobjs $deplibs $compiler_flags ${wl}-soname $wl$soname ${wl}-retain-symbols-file $wl$export_symbols -o $lib' else _LT_AC_TAGVAR(ld_shlibs, $1)=no fi ;; esac if test "$_LT_AC_TAGVAR(ld_shlibs, $1)" = yes; then runpath_var=LD_RUN_PATH _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='${wl}--rpath ${wl}$libdir' _LT_AC_TAGVAR(export_dynamic_flag_spec, $1)='${wl}--export-dynamic' # ancient GNU ld didn't support --whole-archive et. al. if $LD --help 2>&1 | grep 'no-whole-archive' > /dev/null; then _LT_AC_TAGVAR(whole_archive_flag_spec, $1)="$wlarc"'--whole-archive$convenience '"$wlarc"'--no-whole-archive' else _LT_AC_TAGVAR(whole_archive_flag_spec, $1)= fi fi else # PORTME fill in a description of your system's linker (not GNU ld) case $host_os in aix3*) _LT_AC_TAGVAR(allow_undefined_flag, $1)=unsupported _LT_AC_TAGVAR(always_export_symbols, $1)=yes _LT_AC_TAGVAR(archive_expsym_cmds, $1)='$LD -o $output_objdir/$soname $libobjs $deplibs $linker_flags -bE:$export_symbols -T512 -H512 -bM:SRE~$AR $AR_FLAGS $lib $output_objdir/$soname' # Note: this linker hardcodes the directories in LIBPATH if there # are no directories specified by -L. _LT_AC_TAGVAR(hardcode_minus_L, $1)=yes if test "$GCC" = yes && test -z "$link_static_flag"; then # Neither direct hardcoding nor static linking is supported with a # broken collect2. _LT_AC_TAGVAR(hardcode_direct, $1)=unsupported fi ;; aix4* | aix5*) if test "$host_cpu" = ia64; then # On IA64, the linker does run time linking by default, so we don't # have to do anything special. aix_use_runtimelinking=no exp_sym_flag='-Bexport' no_entry_flag="" else # If we're using GNU nm, then we don't want the "-C" option. # -C means demangle to AIX nm, but means don't demangle with GNU nm if $NM -V 2>&1 | grep 'GNU' > /dev/null; then _LT_AC_TAGVAR(export_symbols_cmds, $1)='$NM -Bpg $libobjs $convenience | awk '\''{ if (((\[$]2 == "T") || (\[$]2 == "D") || (\[$]2 == "B")) && ([substr](\[$]3,1,1) != ".")) { print \[$]3 } }'\'' | sort -u > $export_symbols' else _LT_AC_TAGVAR(export_symbols_cmds, $1)='$NM -BCpg $libobjs $convenience | awk '\''{ if (((\[$]2 == "T") || (\[$]2 == "D") || (\[$]2 == "B")) && ([substr](\[$]3,1,1) != ".")) { print \[$]3 } }'\'' | sort -u > $export_symbols' fi aix_use_runtimelinking=no # Test if we are trying to use run time linking or normal # AIX style linking. If -brtl is somewhere in LDFLAGS, we # need to do runtime linking. case $host_os in aix4.[[23]]|aix4.[[23]].*|aix5*) for ld_flag in $LDFLAGS; do if (test $ld_flag = "-brtl" || test $ld_flag = "-Wl,-brtl"); then aix_use_runtimelinking=yes break fi done esac exp_sym_flag='-bexport' no_entry_flag='-bnoentry' fi # When large executables or shared objects are built, AIX ld can # have problems creating the table of contents. If linking a library # or program results in "error TOC overflow" add -mminimal-toc to # CXXFLAGS/CFLAGS for g++/gcc. In the cases where that is not # enough to fix the problem, add -Wl,-bbigtoc to LDFLAGS. _LT_AC_TAGVAR(archive_cmds, $1)='' _LT_AC_TAGVAR(hardcode_direct, $1)=yes _LT_AC_TAGVAR(hardcode_libdir_separator, $1)=':' _LT_AC_TAGVAR(link_all_deplibs, $1)=yes if test "$GCC" = yes; then case $host_os in aix4.[012]|aix4.[012].*) # We only want to do this on AIX 4.2 and lower, the check # below for broken collect2 doesn't work under 4.3+ collect2name=`${CC} -print-prog-name=collect2` if test -f "$collect2name" && \ strings "$collect2name" | grep resolve_lib_name >/dev/null then # We have reworked collect2 _LT_AC_TAGVAR(hardcode_direct, $1)=yes else # We have old collect2 _LT_AC_TAGVAR(hardcode_direct, $1)=unsupported # It fails to find uninstalled libraries when the uninstalled # path is not listed in the libpath. Setting hardcode_minus_L # to unsupported forces relinking _LT_AC_TAGVAR(hardcode_minus_L, $1)=yes _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='-L$libdir' _LT_AC_TAGVAR(hardcode_libdir_separator, $1)= fi esac shared_flag='-shared' else # not using gcc if test "$host_cpu" = ia64; then # VisualAge C++, Version 5.5 for AIX 5L for IA-64, Beta 3 Release # chokes on -Wl,-G. The following line is correct: shared_flag='-G' else if test "$aix_use_runtimelinking" = yes; then shared_flag='${wl}-G' else shared_flag='${wl}-bM:SRE' fi fi fi # It seems that -bexpall does not export symbols beginning with # underscore (_), so it is better to generate a list of symbols to export. _LT_AC_TAGVAR(always_export_symbols, $1)=yes if test "$aix_use_runtimelinking" = yes; then # Warning - without using the other runtime loading flags (-brtl), # -berok will link without error, but may produce a broken library. _LT_AC_TAGVAR(allow_undefined_flag, $1)='-berok' # Determine the default libpath from the value encoded in an empty executable. _LT_AC_SYS_LIBPATH_AIX _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='${wl}-blibpath:$libdir:'"$aix_libpath" _LT_AC_TAGVAR(archive_expsym_cmds, $1)="\$CC"' -o $output_objdir/$soname $libobjs $deplibs $compiler_flags `if test "x${allow_undefined_flag}" != "x"; then echo "${wl}${allow_undefined_flag}"; else :; fi` '"\${wl}$no_entry_flag \${wl}$exp_sym_flag:\$export_symbols $shared_flag" else if test "$host_cpu" = ia64; then _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='${wl}-R $libdir:/usr/lib:/lib' _LT_AC_TAGVAR(allow_undefined_flag, $1)="-z nodefs" _LT_AC_TAGVAR(archive_expsym_cmds, $1)="\$CC $shared_flag"' -o $output_objdir/$soname $libobjs $deplibs $compiler_flags ${wl}${allow_undefined_flag} '"\${wl}$no_entry_flag \${wl}$exp_sym_flag:\$export_symbols" else # Determine the default libpath from the value encoded in an empty executable. _LT_AC_SYS_LIBPATH_AIX _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='${wl}-blibpath:$libdir:'"$aix_libpath" # Warning - without using the other run time loading flags, # -berok will link without error, but may produce a broken library. _LT_AC_TAGVAR(no_undefined_flag, $1)=' ${wl}-bernotok' _LT_AC_TAGVAR(allow_undefined_flag, $1)=' ${wl}-berok' # -bexpall does not export symbols beginning with underscore (_) _LT_AC_TAGVAR(always_export_symbols, $1)=yes # Exported symbols can be pulled into shared objects from archives _LT_AC_TAGVAR(whole_archive_flag_spec, $1)=' ' _LT_AC_TAGVAR(archive_cmds_need_lc, $1)=yes # This is similar to how AIX traditionally builds it's shared libraries. _LT_AC_TAGVAR(archive_expsym_cmds, $1)="\$CC $shared_flag"' -o $output_objdir/$soname $libobjs $deplibs $compiler_flags ${wl}-bE:$export_symbols ${wl}-bnoentry${allow_undefined_flag}~$AR $AR_FLAGS $output_objdir/$libname$release.a $output_objdir/$soname' fi fi ;; amigaos*) _LT_AC_TAGVAR(archive_cmds, $1)='$rm $output_objdir/a2ixlibrary.data~$echo "#define NAME $libname" > $output_objdir/a2ixlibrary.data~$echo "#define LIBRARY_ID 1" >> $output_objdir/a2ixlibrary.data~$echo "#define VERSION $major" >> $output_objdir/a2ixlibrary.data~$echo "#define REVISION $revision" >> $output_objdir/a2ixlibrary.data~$AR $AR_FLAGS $lib $libobjs~$RANLIB $lib~(cd $output_objdir && a2ixlibrary -32)' _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='-L$libdir' _LT_AC_TAGVAR(hardcode_minus_L, $1)=yes # see comment about different semantics on the GNU ld section _LT_AC_TAGVAR(ld_shlibs, $1)=no ;; bsdi[[45]]*) _LT_AC_TAGVAR(export_dynamic_flag_spec, $1)=-rdynamic ;; cygwin* | mingw* | pw32*) # When not using gcc, we currently assume that we are using # Microsoft Visual C++. # hardcode_libdir_flag_spec is actually meaningless, as there is # no search path for DLLs. _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)=' ' _LT_AC_TAGVAR(allow_undefined_flag, $1)=unsupported # Tell ltmain to make .lib files, not .a files. libext=lib # Tell ltmain to make .dll files, not .so files. shrext_cmds=".dll" # FIXME: Setting linknames here is a bad hack. _LT_AC_TAGVAR(archive_cmds, $1)='$CC -o $lib $libobjs $compiler_flags `echo "$deplibs" | $SED -e '\''s/ -lc$//'\''` -link -dll~linknames=' # The linker will automatically build a .lib file if we build a DLL. _LT_AC_TAGVAR(old_archive_From_new_cmds, $1)='true' # FIXME: Should let the user specify the lib program. _LT_AC_TAGVAR(old_archive_cmds, $1)='lib /OUT:$oldlib$oldobjs$old_deplibs' fix_srcfile_path='`cygpath -w "$srcfile"`' _LT_AC_TAGVAR(enable_shared_with_static_runtimes, $1)=yes ;; darwin* | rhapsody*) case "$host_os" in rhapsody* | darwin1.[[012]]) _LT_AC_TAGVAR(allow_undefined_flag, $1)='${wl}-undefined ${wl}suppress' ;; *) # Darwin 1.3 on if test -z ${MACOSX_DEPLOYMENT_TARGET} ; then _LT_AC_TAGVAR(allow_undefined_flag, $1)='${wl}-flat_namespace ${wl}-undefined ${wl}suppress' else case ${MACOSX_DEPLOYMENT_TARGET} in 10.[[012]]) _LT_AC_TAGVAR(allow_undefined_flag, $1)='${wl}-flat_namespace ${wl}-undefined ${wl}suppress' ;; 10.*) _LT_AC_TAGVAR(allow_undefined_flag, $1)='${wl}-undefined ${wl}dynamic_lookup' ;; esac fi ;; esac _LT_AC_TAGVAR(archive_cmds_need_lc, $1)=no _LT_AC_TAGVAR(hardcode_direct, $1)=no _LT_AC_TAGVAR(hardcode_automatic, $1)=yes _LT_AC_TAGVAR(hardcode_shlibpath_var, $1)=unsupported _LT_AC_TAGVAR(whole_archive_flag_spec, $1)='' _LT_AC_TAGVAR(link_all_deplibs, $1)=yes if test "$GCC" = yes ; then output_verbose_link_cmd='echo' _LT_AC_TAGVAR(archive_cmds, $1)='$CC -dynamiclib $allow_undefined_flag -o $lib $libobjs $deplibs $compiler_flags -install_name $rpath/$soname $verstring' _LT_AC_TAGVAR(module_cmds, $1)='$CC $allow_undefined_flag -o $lib -bundle $libobjs $deplibs$compiler_flags' # Don't fix this by using the ld -exported_symbols_list flag, it doesn't exist in older darwin ld's _LT_AC_TAGVAR(archive_expsym_cmds, $1)='sed -e "s,#.*,," -e "s,^[ ]*,," -e "s,^\(..*\),_&," < $export_symbols > $output_objdir/${libname}-symbols.expsym~$CC -dynamiclib $allow_undefined_flag -o $lib $libobjs $deplibs $compiler_flags -install_name $rpath/$soname $verstring~nmedit -s $output_objdir/${libname}-symbols.expsym ${lib}' _LT_AC_TAGVAR(module_expsym_cmds, $1)='sed -e "s,#.*,," -e "s,^[ ]*,," -e "s,^\(..*\),_&," < $export_symbols > $output_objdir/${libname}-symbols.expsym~$CC $allow_undefined_flag -o $lib -bundle $libobjs $deplibs$compiler_flags~nmedit -s $output_objdir/${libname}-symbols.expsym ${lib}' else case "$cc_basename" in xlc*) output_verbose_link_cmd='echo' _LT_AC_TAGVAR(archive_cmds, $1)='$CC -qmkshrobj $allow_undefined_flag -o $lib $libobjs $deplibs $compiler_flags ${wl}-install_name ${wl}`echo $rpath/$soname` $verstring' _LT_AC_TAGVAR(module_cmds, $1)='$CC $allow_undefined_flag -o $lib -bundle $libobjs $deplibs$compiler_flags' # Don't fix this by using the ld -exported_symbols_list flag, it doesn't exist in older darwin ld's _LT_AC_TAGVAR(archive_expsym_cmds, $1)='sed -e "s,#.*,," -e "s,^[ ]*,," -e "s,^\(..*\),_&," < $export_symbols > $output_objdir/${libname}-symbols.expsym~$CC -qmkshrobj $allow_undefined_flag -o $lib $libobjs $deplibs $compiler_flags ${wl}-install_name ${wl}$rpath/$soname $verstring~nmedit -s $output_objdir/${libname}-symbols.expsym ${lib}' _LT_AC_TAGVAR(module_expsym_cmds, $1)='sed -e "s,#.*,," -e "s,^[ ]*,," -e "s,^\(..*\),_&," < $export_symbols > $output_objdir/${libname}-symbols.expsym~$CC $allow_undefined_flag -o $lib -bundle $libobjs $deplibs$compiler_flags~nmedit -s $output_objdir/${libname}-symbols.expsym ${lib}' ;; *) _LT_AC_TAGVAR(ld_shlibs, $1)=no ;; esac fi ;; dgux*) _LT_AC_TAGVAR(archive_cmds, $1)='$LD -G -h $soname -o $lib $libobjs $deplibs $linker_flags' _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='-L$libdir' _LT_AC_TAGVAR(hardcode_shlibpath_var, $1)=no ;; freebsd1*) _LT_AC_TAGVAR(ld_shlibs, $1)=no ;; # FreeBSD 2.2.[012] allows us to include c++rt0.o to get C++ constructor # support. Future versions do this automatically, but an explicit c++rt0.o # does not break anything, and helps significantly (at the cost of a little # extra space). freebsd2.2*) _LT_AC_TAGVAR(archive_cmds, $1)='$LD -Bshareable -o $lib $libobjs $deplibs $linker_flags /usr/lib/c++rt0.o' _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='-R$libdir' _LT_AC_TAGVAR(hardcode_direct, $1)=yes _LT_AC_TAGVAR(hardcode_shlibpath_var, $1)=no ;; # Unfortunately, older versions of FreeBSD 2 do not have this feature. freebsd2*) _LT_AC_TAGVAR(archive_cmds, $1)='$LD -Bshareable -o $lib $libobjs $deplibs $linker_flags' _LT_AC_TAGVAR(hardcode_direct, $1)=yes _LT_AC_TAGVAR(hardcode_minus_L, $1)=yes _LT_AC_TAGVAR(hardcode_shlibpath_var, $1)=no ;; # FreeBSD 3 and greater uses gcc -shared to do shared libraries. freebsd* | kfreebsd*-gnu) _LT_AC_TAGVAR(archive_cmds, $1)='$CC -shared -o $lib $libobjs $deplibs $compiler_flags' _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='-R$libdir' _LT_AC_TAGVAR(hardcode_direct, $1)=yes _LT_AC_TAGVAR(hardcode_shlibpath_var, $1)=no ;; hpux9*) if test "$GCC" = yes; then _LT_AC_TAGVAR(archive_cmds, $1)='$rm $output_objdir/$soname~$CC -shared -fPIC ${wl}+b ${wl}$install_libdir -o $output_objdir/$soname $libobjs $deplibs $compiler_flags~test $output_objdir/$soname = $lib || mv $output_objdir/$soname $lib' else _LT_AC_TAGVAR(archive_cmds, $1)='$rm $output_objdir/$soname~$LD -b +b $install_libdir -o $output_objdir/$soname $libobjs $deplibs $linker_flags~test $output_objdir/$soname = $lib || mv $output_objdir/$soname $lib' fi _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='${wl}+b ${wl}$libdir' _LT_AC_TAGVAR(hardcode_libdir_separator, $1)=: _LT_AC_TAGVAR(hardcode_direct, $1)=yes # hardcode_minus_L: Not really in the search PATH, # but as the default location of the library. _LT_AC_TAGVAR(hardcode_minus_L, $1)=yes _LT_AC_TAGVAR(export_dynamic_flag_spec, $1)='${wl}-E' ;; hpux10* | hpux11*) if test "$GCC" = yes -a "$with_gnu_ld" = no; then case "$host_cpu" in hppa*64*|ia64*) _LT_AC_TAGVAR(archive_cmds, $1)='$CC -shared ${wl}+h ${wl}$soname -o $lib $libobjs $deplibs $compiler_flags' ;; *) _LT_AC_TAGVAR(archive_cmds, $1)='$CC -shared -fPIC ${wl}+h ${wl}$soname ${wl}+b ${wl}$install_libdir -o $lib $libobjs $deplibs $compiler_flags' ;; esac else case "$host_cpu" in hppa*64*|ia64*) _LT_AC_TAGVAR(archive_cmds, $1)='$LD -b +h $soname -o $lib $libobjs $deplibs $linker_flags' ;; *) _LT_AC_TAGVAR(archive_cmds, $1)='$LD -b +h $soname +b $install_libdir -o $lib $libobjs $deplibs $linker_flags' ;; esac fi if test "$with_gnu_ld" = no; then case "$host_cpu" in hppa*64*) _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='${wl}+b ${wl}$libdir' _LT_AC_TAGVAR(hardcode_libdir_flag_spec_ld, $1)='+b $libdir' _LT_AC_TAGVAR(hardcode_libdir_separator, $1)=: _LT_AC_TAGVAR(hardcode_direct, $1)=no _LT_AC_TAGVAR(hardcode_shlibpath_var, $1)=no ;; ia64*) _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='-L$libdir' _LT_AC_TAGVAR(hardcode_direct, $1)=no _LT_AC_TAGVAR(hardcode_shlibpath_var, $1)=no # hardcode_minus_L: Not really in the search PATH, # but as the default location of the library. _LT_AC_TAGVAR(hardcode_minus_L, $1)=yes ;; *) _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='${wl}+b ${wl}$libdir' _LT_AC_TAGVAR(hardcode_libdir_separator, $1)=: _LT_AC_TAGVAR(hardcode_direct, $1)=yes _LT_AC_TAGVAR(export_dynamic_flag_spec, $1)='${wl}-E' # hardcode_minus_L: Not really in the search PATH, # but as the default location of the library. _LT_AC_TAGVAR(hardcode_minus_L, $1)=yes ;; esac fi ;; irix5* | irix6* | nonstopux*) if test "$GCC" = yes; then _LT_AC_TAGVAR(archive_cmds, $1)='$CC -shared $libobjs $deplibs $compiler_flags ${wl}-soname ${wl}$soname `test -n "$verstring" && echo ${wl}-set_version ${wl}$verstring` ${wl}-update_registry ${wl}${output_objdir}/so_locations -o $lib' else _LT_AC_TAGVAR(archive_cmds, $1)='$LD -shared $libobjs $deplibs $linker_flags -soname $soname `test -n "$verstring" && echo -set_version $verstring` -update_registry ${output_objdir}/so_locations -o $lib' _LT_AC_TAGVAR(hardcode_libdir_flag_spec_ld, $1)='-rpath $libdir' fi _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='${wl}-rpath ${wl}$libdir' _LT_AC_TAGVAR(hardcode_libdir_separator, $1)=: _LT_AC_TAGVAR(link_all_deplibs, $1)=yes ;; netbsd*) if echo __ELF__ | $CC -E - | grep __ELF__ >/dev/null; then _LT_AC_TAGVAR(archive_cmds, $1)='$LD -Bshareable -o $lib $libobjs $deplibs $linker_flags' # a.out else _LT_AC_TAGVAR(archive_cmds, $1)='$LD -shared -o $lib $libobjs $deplibs $linker_flags' # ELF fi _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='-R$libdir' _LT_AC_TAGVAR(hardcode_direct, $1)=yes _LT_AC_TAGVAR(hardcode_shlibpath_var, $1)=no ;; newsos6) _LT_AC_TAGVAR(archive_cmds, $1)='$LD -G -h $soname -o $lib $libobjs $deplibs $linker_flags' _LT_AC_TAGVAR(hardcode_direct, $1)=yes _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='${wl}-rpath ${wl}$libdir' _LT_AC_TAGVAR(hardcode_libdir_separator, $1)=: _LT_AC_TAGVAR(hardcode_shlibpath_var, $1)=no ;; openbsd*) _LT_AC_TAGVAR(hardcode_direct, $1)=yes _LT_AC_TAGVAR(hardcode_shlibpath_var, $1)=no if test -z "`echo __ELF__ | $CC -E - | grep __ELF__`" || test "$host_os-$host_cpu" = "openbsd2.8-powerpc"; then _LT_AC_TAGVAR(archive_cmds, $1)='$CC -shared $pic_flag -o $lib $libobjs $deplibs $compiler_flags' _LT_AC_TAGVAR(archive_expsym_cmds, $1)='$CC -shared $pic_flag -o $lib $libobjs $deplibs $compiler_flags ${wl}-retain-symbols-file,$export_symbols' _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='${wl}-rpath,$libdir' _LT_AC_TAGVAR(export_dynamic_flag_spec, $1)='${wl}-E' else case $host_os in openbsd[[01]].* | openbsd2.[[0-7]] | openbsd2.[[0-7]].*) _LT_AC_TAGVAR(archive_cmds, $1)='$LD -Bshareable -o $lib $libobjs $deplibs $linker_flags' _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='-R$libdir' ;; *) _LT_AC_TAGVAR(archive_cmds, $1)='$CC -shared $pic_flag -o $lib $libobjs $deplibs $compiler_flags' _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='${wl}-rpath,$libdir' ;; esac fi ;; os2*) _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='-L$libdir' _LT_AC_TAGVAR(hardcode_minus_L, $1)=yes _LT_AC_TAGVAR(allow_undefined_flag, $1)=unsupported _LT_AC_TAGVAR(archive_cmds, $1)='$echo "LIBRARY $libname INITINSTANCE" > $output_objdir/$libname.def~$echo "DESCRIPTION \"$libname\"" >> $output_objdir/$libname.def~$echo DATA >> $output_objdir/$libname.def~$echo " SINGLE NONSHARED" >> $output_objdir/$libname.def~$echo EXPORTS >> $output_objdir/$libname.def~emxexp $libobjs >> $output_objdir/$libname.def~$CC -Zdll -Zcrtdll -o $lib $libobjs $deplibs $compiler_flags $output_objdir/$libname.def' _LT_AC_TAGVAR(old_archive_From_new_cmds, $1)='emximp -o $output_objdir/$libname.a $output_objdir/$libname.def' ;; osf3*) if test "$GCC" = yes; then _LT_AC_TAGVAR(allow_undefined_flag, $1)=' ${wl}-expect_unresolved ${wl}\*' _LT_AC_TAGVAR(archive_cmds, $1)='$CC -shared${allow_undefined_flag} $libobjs $deplibs $compiler_flags ${wl}-soname ${wl}$soname `test -n "$verstring" && echo ${wl}-set_version ${wl}$verstring` ${wl}-update_registry ${wl}${output_objdir}/so_locations -o $lib' else _LT_AC_TAGVAR(allow_undefined_flag, $1)=' -expect_unresolved \*' _LT_AC_TAGVAR(archive_cmds, $1)='$LD -shared${allow_undefined_flag} $libobjs $deplibs $linker_flags -soname $soname `test -n "$verstring" && echo -set_version $verstring` -update_registry ${output_objdir}/so_locations -o $lib' fi _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='${wl}-rpath ${wl}$libdir' _LT_AC_TAGVAR(hardcode_libdir_separator, $1)=: ;; osf4* | osf5*) # as osf3* with the addition of -msym flag if test "$GCC" = yes; then _LT_AC_TAGVAR(allow_undefined_flag, $1)=' ${wl}-expect_unresolved ${wl}\*' _LT_AC_TAGVAR(archive_cmds, $1)='$CC -shared${allow_undefined_flag} $libobjs $deplibs $compiler_flags ${wl}-msym ${wl}-soname ${wl}$soname `test -n "$verstring" && echo ${wl}-set_version ${wl}$verstring` ${wl}-update_registry ${wl}${output_objdir}/so_locations -o $lib' _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='${wl}-rpath ${wl}$libdir' else _LT_AC_TAGVAR(allow_undefined_flag, $1)=' -expect_unresolved \*' _LT_AC_TAGVAR(archive_cmds, $1)='$LD -shared${allow_undefined_flag} $libobjs $deplibs $linker_flags -msym -soname $soname `test -n "$verstring" && echo -set_version $verstring` -update_registry ${output_objdir}/so_locations -o $lib' _LT_AC_TAGVAR(archive_expsym_cmds, $1)='for i in `cat $export_symbols`; do printf "%s %s\\n" -exported_symbol "\$i" >> $lib.exp; done; echo "-hidden">> $lib.exp~ $LD -shared${allow_undefined_flag} -input $lib.exp $linker_flags $libobjs $deplibs -soname $soname `test -n "$verstring" && echo -set_version $verstring` -update_registry ${objdir}/so_locations -o $lib~$rm $lib.exp' # Both c and cxx compiler support -rpath directly _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='-rpath $libdir' fi _LT_AC_TAGVAR(hardcode_libdir_separator, $1)=: ;; sco3.2v5*) _LT_AC_TAGVAR(archive_cmds, $1)='$LD -G -h $soname -o $lib $libobjs $deplibs $linker_flags' _LT_AC_TAGVAR(hardcode_shlibpath_var, $1)=no _LT_AC_TAGVAR(export_dynamic_flag_spec, $1)='${wl}-Bexport' runpath_var=LD_RUN_PATH hardcode_runpath_var=yes ;; solaris*) _LT_AC_TAGVAR(no_undefined_flag, $1)=' -z text' if test "$GCC" = yes; then _LT_AC_TAGVAR(archive_cmds, $1)='$CC -shared ${wl}-h ${wl}$soname -o $lib $libobjs $deplibs $compiler_flags' _LT_AC_TAGVAR(archive_expsym_cmds, $1)='$echo "{ global:" > $lib.exp~cat $export_symbols | $SED -e "s/\(.*\)/\1;/" >> $lib.exp~$echo "local: *; };" >> $lib.exp~ $CC -shared ${wl}-M ${wl}$lib.exp ${wl}-h ${wl}$soname -o $lib $libobjs $deplibs $compiler_flags~$rm $lib.exp' else _LT_AC_TAGVAR(archive_cmds, $1)='$LD -G${allow_undefined_flag} -h $soname -o $lib $libobjs $deplibs $linker_flags' _LT_AC_TAGVAR(archive_expsym_cmds, $1)='$echo "{ global:" > $lib.exp~cat $export_symbols | $SED -e "s/\(.*\)/\1;/" >> $lib.exp~$echo "local: *; };" >> $lib.exp~ $LD -G${allow_undefined_flag} -M $lib.exp -h $soname -o $lib $libobjs $deplibs $linker_flags~$rm $lib.exp' fi _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='-R$libdir' _LT_AC_TAGVAR(hardcode_shlibpath_var, $1)=no case $host_os in solaris2.[[0-5]] | solaris2.[[0-5]].*) ;; *) # Supported since Solaris 2.6 (maybe 2.5.1?) _LT_AC_TAGVAR(whole_archive_flag_spec, $1)='-z allextract$convenience -z defaultextract' ;; esac _LT_AC_TAGVAR(link_all_deplibs, $1)=yes ;; sunos4*) if test "x$host_vendor" = xsequent; then # Use $CC to link under sequent, because it throws in some extra .o # files that make .init and .fini sections work. _LT_AC_TAGVAR(archive_cmds, $1)='$CC -G ${wl}-h $soname -o $lib $libobjs $deplibs $compiler_flags' else _LT_AC_TAGVAR(archive_cmds, $1)='$LD -assert pure-text -Bstatic -o $lib $libobjs $deplibs $linker_flags' fi _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='-L$libdir' _LT_AC_TAGVAR(hardcode_direct, $1)=yes _LT_AC_TAGVAR(hardcode_minus_L, $1)=yes _LT_AC_TAGVAR(hardcode_shlibpath_var, $1)=no ;; sysv4) case $host_vendor in sni) _LT_AC_TAGVAR(archive_cmds, $1)='$LD -G -h $soname -o $lib $libobjs $deplibs $linker_flags' _LT_AC_TAGVAR(hardcode_direct, $1)=yes # is this really true??? ;; siemens) ## LD is ld it makes a PLAMLIB ## CC just makes a GrossModule. _LT_AC_TAGVAR(archive_cmds, $1)='$LD -G -o $lib $libobjs $deplibs $linker_flags' _LT_AC_TAGVAR(reload_cmds, $1)='$CC -r -o $output$reload_objs' _LT_AC_TAGVAR(hardcode_direct, $1)=no ;; motorola) _LT_AC_TAGVAR(archive_cmds, $1)='$LD -G -h $soname -o $lib $libobjs $deplibs $linker_flags' _LT_AC_TAGVAR(hardcode_direct, $1)=no #Motorola manual says yes, but my tests say they lie ;; esac runpath_var='LD_RUN_PATH' _LT_AC_TAGVAR(hardcode_shlibpath_var, $1)=no ;; sysv4.3*) _LT_AC_TAGVAR(archive_cmds, $1)='$LD -G -h $soname -o $lib $libobjs $deplibs $linker_flags' _LT_AC_TAGVAR(hardcode_shlibpath_var, $1)=no _LT_AC_TAGVAR(export_dynamic_flag_spec, $1)='-Bexport' ;; sysv4*MP*) if test -d /usr/nec; then _LT_AC_TAGVAR(archive_cmds, $1)='$LD -G -h $soname -o $lib $libobjs $deplibs $linker_flags' _LT_AC_TAGVAR(hardcode_shlibpath_var, $1)=no runpath_var=LD_RUN_PATH hardcode_runpath_var=yes _LT_AC_TAGVAR(ld_shlibs, $1)=yes fi ;; sysv4.2uw2*) _LT_AC_TAGVAR(archive_cmds, $1)='$LD -G -o $lib $libobjs $deplibs $linker_flags' _LT_AC_TAGVAR(hardcode_direct, $1)=yes _LT_AC_TAGVAR(hardcode_minus_L, $1)=no _LT_AC_TAGVAR(hardcode_shlibpath_var, $1)=no hardcode_runpath_var=yes runpath_var=LD_RUN_PATH ;; sysv5OpenUNIX8* | sysv5UnixWare7* | sysv5uw[[78]]* | unixware7*) _LT_AC_TAGVAR(no_undefined_flag, $1)='${wl}-z ${wl}text' if test "$GCC" = yes; then _LT_AC_TAGVAR(archive_cmds, $1)='$CC -shared ${wl}-h ${wl}$soname -o $lib $libobjs $deplibs $compiler_flags' else _LT_AC_TAGVAR(archive_cmds, $1)='$CC -G ${wl}-h ${wl}$soname -o $lib $libobjs $deplibs $compiler_flags' fi runpath_var='LD_RUN_PATH' _LT_AC_TAGVAR(hardcode_shlibpath_var, $1)=no ;; sysv5*) _LT_AC_TAGVAR(no_undefined_flag, $1)=' -z text' # $CC -shared without GNU ld will not create a library from C++ # object files and a static libstdc++, better avoid it by now _LT_AC_TAGVAR(archive_cmds, $1)='$LD -G${allow_undefined_flag} -h $soname -o $lib $libobjs $deplibs $linker_flags' _LT_AC_TAGVAR(archive_expsym_cmds, $1)='$echo "{ global:" > $lib.exp~cat $export_symbols | $SED -e "s/\(.*\)/\1;/" >> $lib.exp~$echo "local: *; };" >> $lib.exp~ $LD -G${allow_undefined_flag} -M $lib.exp -h $soname -o $lib $libobjs $deplibs $linker_flags~$rm $lib.exp' _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)= _LT_AC_TAGVAR(hardcode_shlibpath_var, $1)=no runpath_var='LD_RUN_PATH' ;; uts4*) _LT_AC_TAGVAR(archive_cmds, $1)='$LD -G -h $soname -o $lib $libobjs $deplibs $linker_flags' _LT_AC_TAGVAR(hardcode_libdir_flag_spec, $1)='-L$libdir' _LT_AC_TAGVAR(hardcode_shlibpath_var, $1)=no ;; *) _LT_AC_TAGVAR(ld_shlibs, $1)=no ;; esac fi ]) AC_MSG_RESULT([$_LT_AC_TAGVAR(ld_shlibs, $1)]) test "$_LT_AC_TAGVAR(ld_shlibs, $1)" = no && can_build_shared=no variables_saved_for_relink="PATH $shlibpath_var $runpath_var" if test "$GCC" = yes; then variables_saved_for_relink="$variables_saved_for_relink GCC_EXEC_PREFIX COMPILER_PATH LIBRARY_PATH" fi # # Do we need to explicitly link libc? # case "x$_LT_AC_TAGVAR(archive_cmds_need_lc, $1)" in x|xyes) # Assume -lc should be added _LT_AC_TAGVAR(archive_cmds_need_lc, $1)=yes if test "$enable_shared" = yes && test "$GCC" = yes; then case $_LT_AC_TAGVAR(archive_cmds, $1) in *'~'*) # FIXME: we may have to deal with multi-command sequences. ;; '$CC '*) # Test whether the compiler implicitly links with -lc since on some # systems, -lgcc has to come before -lc. If gcc already passes -lc # to ld, don't add -lc before -lgcc. AC_MSG_CHECKING([whether -lc should be explicitly linked in]) $rm conftest* printf "$lt_simple_compile_test_code" > conftest.$ac_ext if AC_TRY_EVAL(ac_compile) 2>conftest.err; then soname=conftest lib=conftest libobjs=conftest.$ac_objext deplibs= wl=$_LT_AC_TAGVAR(lt_prog_compiler_wl, $1) compiler_flags=-v linker_flags=-v verstring= output_objdir=. libname=conftest lt_save_allow_undefined_flag=$_LT_AC_TAGVAR(allow_undefined_flag, $1) _LT_AC_TAGVAR(allow_undefined_flag, $1)= if AC_TRY_EVAL(_LT_AC_TAGVAR(archive_cmds, $1) 2\>\&1 \| grep \" -lc \" \>/dev/null 2\>\&1) then _LT_AC_TAGVAR(archive_cmds_need_lc, $1)=no else _LT_AC_TAGVAR(archive_cmds_need_lc, $1)=yes fi _LT_AC_TAGVAR(allow_undefined_flag, $1)=$lt_save_allow_undefined_flag else cat conftest.err 1>&5 fi $rm conftest* AC_MSG_RESULT([$_LT_AC_TAGVAR(archive_cmds_need_lc, $1)]) ;; esac fi ;; esac ])# AC_LIBTOOL_PROG_LD_SHLIBS # _LT_AC_FILE_LTDLL_C # ------------------- # Be careful that the start marker always follows a newline. AC_DEFUN([_LT_AC_FILE_LTDLL_C], [ # /* ltdll.c starts here */ # #define WIN32_LEAN_AND_MEAN # #include # #undef WIN32_LEAN_AND_MEAN # #include # # #ifndef __CYGWIN__ # # ifdef __CYGWIN32__ # # define __CYGWIN__ __CYGWIN32__ # # endif # #endif # # #ifdef __cplusplus # extern "C" { # #endif # BOOL APIENTRY DllMain (HINSTANCE hInst, DWORD reason, LPVOID reserved); # #ifdef __cplusplus # } # #endif # # #ifdef __CYGWIN__ # #include # DECLARE_CYGWIN_DLL( DllMain ); # #endif # HINSTANCE __hDllInstance_base; # # BOOL APIENTRY # DllMain (HINSTANCE hInst, DWORD reason, LPVOID reserved) # { # __hDllInstance_base = hInst; # return TRUE; # } # /* ltdll.c ends here */ ])# _LT_AC_FILE_LTDLL_C # _LT_AC_TAGVAR(VARNAME, [TAGNAME]) # --------------------------------- AC_DEFUN([_LT_AC_TAGVAR], [ifelse([$2], [], [$1], [$1_$2])]) # old names AC_DEFUN([AM_PROG_LIBTOOL], [AC_PROG_LIBTOOL]) AC_DEFUN([AM_ENABLE_SHARED], [AC_ENABLE_SHARED($@)]) AC_DEFUN([AM_ENABLE_STATIC], [AC_ENABLE_STATIC($@)]) AC_DEFUN([AM_DISABLE_SHARED], [AC_DISABLE_SHARED($@)]) AC_DEFUN([AM_DISABLE_STATIC], [AC_DISABLE_STATIC($@)]) AC_DEFUN([AM_PROG_LD], [AC_PROG_LD]) AC_DEFUN([AM_PROG_NM], [AC_PROG_NM]) # This is just to silence aclocal about the macro not being used ifelse([AC_DISABLE_FAST_INSTALL]) AC_DEFUN([LT_AC_PROG_GCJ], [AC_CHECK_TOOL(GCJ, gcj, no) test "x${GCJFLAGS+set}" = xset || GCJFLAGS="-g -O2" AC_SUBST(GCJFLAGS) ]) AC_DEFUN([LT_AC_PROG_RC], [AC_CHECK_TOOL(RC, windres, no) ]) # NOTE: This macro has been submitted for inclusion into # # GNU Autoconf as AC_PROG_SED. When it is available in # # a released version of Autoconf we should remove this # # macro and use it instead. # # LT_AC_PROG_SED # -------------- # Check for a fully-functional sed program, that truncates # as few characters as possible. Prefer GNU sed if found. AC_DEFUN([LT_AC_PROG_SED], [AC_MSG_CHECKING([for a sed that does not truncate output]) AC_CACHE_VAL(lt_cv_path_SED, [# Loop through the user's path and test for sed and gsed. # Then use that list of sed's as ones to test for truncation. as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for lt_ac_prog in sed gsed; do for ac_exec_ext in '' $ac_executable_extensions; do if $as_executable_p "$as_dir/$lt_ac_prog$ac_exec_ext"; then lt_ac_sed_list="$lt_ac_sed_list $as_dir/$lt_ac_prog$ac_exec_ext" fi done done done lt_ac_max=0 lt_ac_count=0 # Add /usr/xpg4/bin/sed as it is typically found on Solaris # along with /bin/sed that truncates output. for lt_ac_sed in $lt_ac_sed_list /usr/xpg4/bin/sed; do test ! -f $lt_ac_sed && break cat /dev/null > conftest.in lt_ac_count=0 echo $ECHO_N "0123456789$ECHO_C" >conftest.in # Check for GNU sed and select it if it is found. if "$lt_ac_sed" --version 2>&1 < /dev/null | grep 'GNU' > /dev/null; then lt_cv_path_SED=$lt_ac_sed break fi while true; do cat conftest.in conftest.in >conftest.tmp mv conftest.tmp conftest.in cp conftest.in conftest.nl echo >>conftest.nl $lt_ac_sed -e 's/a$//' < conftest.nl >conftest.out || break cmp -s conftest.out conftest.nl || break # 10000 chars as input seems more than enough test $lt_ac_count -gt 10 && break lt_ac_count=`expr $lt_ac_count + 1` if test $lt_ac_count -gt $lt_ac_max; then lt_ac_max=$lt_ac_count lt_cv_path_SED=$lt_ac_sed fi done done ]) SED=$lt_cv_path_SED AC_MSG_RESULT([$SED]) ]) dnl PKG_CHECK_MODULES(GSTUFF, gtk+-2.0 >= 1.3 glib = 1.3.4, action-if, action-not) dnl defines GSTUFF_LIBS, GSTUFF_CFLAGS, see pkg-config man page dnl also defines GSTUFF_PKG_ERRORS on error AC_DEFUN(PKG_CHECK_MODULES, [ succeeded=no if test -z "$PKG_CONFIG"; then AC_PATH_PROG(PKG_CONFIG, pkg-config, no) fi if test "$PKG_CONFIG" = "no" ; then echo "*** The pkg-config script could not be found. Make sure it is" echo "*** in your path, or set the PKG_CONFIG environment variable" echo "*** to the full path to pkg-config." echo "*** Or see http://www.freedesktop.org/software/pkgconfig to get pkg-config." else PKG_CONFIG_MIN_VERSION=0.9.0 if $PKG_CONFIG --atleast-pkgconfig-version $PKG_CONFIG_MIN_VERSION; then AC_MSG_CHECKING(for $2) if $PKG_CONFIG --exists "$2" ; then AC_MSG_RESULT(yes) succeeded=yes AC_MSG_CHECKING($1_CFLAGS) $1_CFLAGS=`$PKG_CONFIG --cflags "$2"` AC_MSG_RESULT($$1_CFLAGS) AC_MSG_CHECKING($1_LIBS) $1_LIBS=`$PKG_CONFIG --libs "$2"` AC_MSG_RESULT($$1_LIBS) else $1_CFLAGS="" $1_LIBS="" ## If we have a custom action on failure, don't print errors, but ## do set a variable so people can do so. $1_PKG_ERRORS=`$PKG_CONFIG --errors-to-stdout --print-errors "$2"` ifelse([$4], ,echo $$1_PKG_ERRORS,) fi AC_SUBST($1_CFLAGS) AC_SUBST($1_LIBS) else echo "*** Your version of pkg-config is too old. You need version $PKG_CONFIG_MIN_VERSION or newer." echo "*** See http://www.freedesktop.org/software/pkgconfig" fi fi if test $succeeded = yes; then ifelse([$3], , :, [$3]) else ifelse([$4], , AC_MSG_ERROR([Library requirements ($2) not met; consider adjusting the PKG_CONFIG_PATH environment variable if your libraries are in a nonstandard prefix so pkg-config can find them.]), [$4]) fi ]) # -*- Autoconf -*- # Copyright (C) 2002, 2003 Free Software Foundation, Inc. # Generated from amversion.in; do not edit by hand. # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2, or (at your option) # any later version. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA # AM_AUTOMAKE_VERSION(VERSION) # ---------------------------- # Automake X.Y traces this macro to ensure aclocal.m4 has been # generated from the m4 files accompanying Automake X.Y. AC_DEFUN([AM_AUTOMAKE_VERSION], [am__api_version="1.9"]) # AM_SET_CURRENT_AUTOMAKE_VERSION # ------------------------------- # Call AM_AUTOMAKE_VERSION so it can be traced. # This function is AC_REQUIREd by AC_INIT_AUTOMAKE. AC_DEFUN([AM_SET_CURRENT_AUTOMAKE_VERSION], [AM_AUTOMAKE_VERSION([1.9.2])]) # AM_AUX_DIR_EXPAND # Copyright (C) 2001, 2003 Free Software Foundation, Inc. # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2, or (at your option) # any later version. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA # 02111-1307, USA. # For projects using AC_CONFIG_AUX_DIR([foo]), Autoconf sets # $ac_aux_dir to `$srcdir/foo'. In other projects, it is set to # `$srcdir', `$srcdir/..', or `$srcdir/../..'. # # Of course, Automake must honor this variable whenever it calls a # tool from the auxiliary directory. The problem is that $srcdir (and # therefore $ac_aux_dir as well) can be either absolute or relative, # depending on how configure is run. This is pretty annoying, since # it makes $ac_aux_dir quite unusable in subdirectories: in the top # source directory, any form will work fine, but in subdirectories a # relative path needs to be adjusted first. # # $ac_aux_dir/missing # fails when called from a subdirectory if $ac_aux_dir is relative # $top_srcdir/$ac_aux_dir/missing # fails if $ac_aux_dir is absolute, # fails when called from a subdirectory in a VPATH build with # a relative $ac_aux_dir # # The reason of the latter failure is that $top_srcdir and $ac_aux_dir # are both prefixed by $srcdir. In an in-source build this is usually # harmless because $srcdir is `.', but things will broke when you # start a VPATH build or use an absolute $srcdir. # # So we could use something similar to $top_srcdir/$ac_aux_dir/missing, # iff we strip the leading $srcdir from $ac_aux_dir. That would be: # am_aux_dir='\$(top_srcdir)/'`expr "$ac_aux_dir" : "$srcdir//*\(.*\)"` # and then we would define $MISSING as # MISSING="\${SHELL} $am_aux_dir/missing" # This will work as long as MISSING is not called from configure, because # unfortunately $(top_srcdir) has no meaning in configure. # However there are other variables, like CC, which are often used in # configure, and could therefore not use this "fixed" $ac_aux_dir. # # Another solution, used here, is to always expand $ac_aux_dir to an # absolute PATH. The drawback is that using absolute paths prevent a # configured tree to be moved without reconfiguration. AC_DEFUN([AM_AUX_DIR_EXPAND], [dnl Rely on autoconf to set up CDPATH properly. AC_PREREQ([2.50])dnl # expand $ac_aux_dir to an absolute path am_aux_dir=`cd $ac_aux_dir && pwd` ]) # AM_CONDITIONAL -*- Autoconf -*- # Copyright (C) 1997, 2000, 2001, 2003, 2004 Free Software Foundation, Inc. # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2, or (at your option) # any later version. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA # 02111-1307, USA. # serial 6 # AM_CONDITIONAL(NAME, SHELL-CONDITION) # ------------------------------------- # Define a conditional. AC_DEFUN([AM_CONDITIONAL], [AC_PREREQ(2.52)dnl ifelse([$1], [TRUE], [AC_FATAL([$0: invalid condition: $1])], [$1], [FALSE], [AC_FATAL([$0: invalid condition: $1])])dnl AC_SUBST([$1_TRUE]) AC_SUBST([$1_FALSE]) if $2; then $1_TRUE= $1_FALSE='#' else $1_TRUE='#' $1_FALSE= fi AC_CONFIG_COMMANDS_PRE( [if test -z "${$1_TRUE}" && test -z "${$1_FALSE}"; then AC_MSG_ERROR([[conditional "$1" was never defined. Usually this means the macro was only invoked conditionally.]]) fi])]) # serial 7 -*- Autoconf -*- # Copyright (C) 1999, 2000, 2001, 2002, 2003, 2004 # Free Software Foundation, Inc. # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2, or (at your option) # any later version. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA # 02111-1307, USA. # There are a few dirty hacks below to avoid letting `AC_PROG_CC' be # written in clear, in which case automake, when reading aclocal.m4, # will think it sees a *use*, and therefore will trigger all it's # C support machinery. Also note that it means that autoscan, seeing # CC etc. in the Makefile, will ask for an AC_PROG_CC use... # _AM_DEPENDENCIES(NAME) # ---------------------- # See how the compiler implements dependency checking. # NAME is "CC", "CXX", "GCJ", or "OBJC". # We try a few techniques and use that to set a single cache variable. # # We don't AC_REQUIRE the corresponding AC_PROG_CC since the latter was # modified to invoke _AM_DEPENDENCIES(CC); we would have a circular # dependency, and given that the user is not expected to run this macro, # just rely on AC_PROG_CC. AC_DEFUN([_AM_DEPENDENCIES], [AC_REQUIRE([AM_SET_DEPDIR])dnl AC_REQUIRE([AM_OUTPUT_DEPENDENCY_COMMANDS])dnl AC_REQUIRE([AM_MAKE_INCLUDE])dnl AC_REQUIRE([AM_DEP_TRACK])dnl ifelse([$1], CC, [depcc="$CC" am_compiler_list=], [$1], CXX, [depcc="$CXX" am_compiler_list=], [$1], OBJC, [depcc="$OBJC" am_compiler_list='gcc3 gcc'], [$1], GCJ, [depcc="$GCJ" am_compiler_list='gcc3 gcc'], [depcc="$$1" am_compiler_list=]) AC_CACHE_CHECK([dependency style of $depcc], [am_cv_$1_dependencies_compiler_type], [if test -z "$AMDEP_TRUE" && test -f "$am_depcomp"; then # We make a subdir and do the tests there. Otherwise we can end up # making bogus files that we don't know about and never remove. For # instance it was reported that on HP-UX the gcc test will end up # making a dummy file named `D' -- because `-MD' means `put the output # in D'. mkdir conftest.dir # Copy depcomp to subdir because otherwise we won't find it if we're # using a relative directory. cp "$am_depcomp" conftest.dir cd conftest.dir # We will build objects and dependencies in a subdirectory because # it helps to detect inapplicable dependency modes. For instance # both Tru64's cc and ICC support -MD to output dependencies as a # side effect of compilation, but ICC will put the dependencies in # the current directory while Tru64 will put them in the object # directory. mkdir sub am_cv_$1_dependencies_compiler_type=none if test "$am_compiler_list" = ""; then am_compiler_list=`sed -n ['s/^#*\([a-zA-Z0-9]*\))$/\1/p'] < ./depcomp` fi for depmode in $am_compiler_list; do # Setup a source with many dependencies, because some compilers # like to wrap large dependency lists on column 80 (with \), and # we should not choose a depcomp mode which is confused by this. # # We need to recreate these files for each test, as the compiler may # overwrite some of them when testing with obscure command lines. # This happens at least with the AIX C compiler. : > sub/conftest.c for i in 1 2 3 4 5 6; do echo '#include "conftst'$i'.h"' >> sub/conftest.c # Using `: > sub/conftst$i.h' creates only sub/conftst1.h with # Solaris 8's {/usr,}/bin/sh. touch sub/conftst$i.h done echo "${am__include} ${am__quote}sub/conftest.Po${am__quote}" > confmf case $depmode in nosideeffect) # after this tag, mechanisms are not by side-effect, so they'll # only be used when explicitly requested if test "x$enable_dependency_tracking" = xyes; then continue else break fi ;; none) break ;; esac # We check with `-c' and `-o' for the sake of the "dashmstdout" # mode. It turns out that the SunPro C++ compiler does not properly # handle `-M -o', and we need to detect this. if depmode=$depmode \ source=sub/conftest.c object=sub/conftest.${OBJEXT-o} \ depfile=sub/conftest.Po tmpdepfile=sub/conftest.TPo \ $SHELL ./depcomp $depcc -c -o sub/conftest.${OBJEXT-o} sub/conftest.c \ >/dev/null 2>conftest.err && grep sub/conftst6.h sub/conftest.Po > /dev/null 2>&1 && grep sub/conftest.${OBJEXT-o} sub/conftest.Po > /dev/null 2>&1 && ${MAKE-make} -s -f confmf > /dev/null 2>&1; then # icc doesn't choke on unknown options, it will just issue warnings # or remarks (even with -Werror). So we grep stderr for any message # that says an option was ignored or not supported. # When given -MP, icc 7.0 and 7.1 complain thusly: # icc: Command line warning: ignoring option '-M'; no argument required # The diagnosis changed in icc 8.0: # icc: Command line remark: option '-MP' not supported if (grep 'ignoring option' conftest.err || grep 'not supported' conftest.err) >/dev/null 2>&1; then :; else am_cv_$1_dependencies_compiler_type=$depmode break fi fi done cd .. rm -rf conftest.dir else am_cv_$1_dependencies_compiler_type=none fi ]) AC_SUBST([$1DEPMODE], [depmode=$am_cv_$1_dependencies_compiler_type]) AM_CONDITIONAL([am__fastdep$1], [ test "x$enable_dependency_tracking" != xno \ && test "$am_cv_$1_dependencies_compiler_type" = gcc3]) ]) # AM_SET_DEPDIR # ------------- # Choose a directory name for dependency files. # This macro is AC_REQUIREd in _AM_DEPENDENCIES AC_DEFUN([AM_SET_DEPDIR], [AC_REQUIRE([AM_SET_LEADING_DOT])dnl AC_SUBST([DEPDIR], ["${am__leading_dot}deps"])dnl ]) # AM_DEP_TRACK # ------------ AC_DEFUN([AM_DEP_TRACK], [AC_ARG_ENABLE(dependency-tracking, [ --disable-dependency-tracking speeds up one-time build --enable-dependency-tracking do not reject slow dependency extractors]) if test "x$enable_dependency_tracking" != xno; then am_depcomp="$ac_aux_dir/depcomp" AMDEPBACKSLASH='\' fi AM_CONDITIONAL([AMDEP], [test "x$enable_dependency_tracking" != xno]) AC_SUBST([AMDEPBACKSLASH]) ]) # Generate code to set up dependency tracking. -*- Autoconf -*- # Copyright (C) 1999, 2000, 2001, 2002, 2003, 2004 # Free Software Foundation, Inc. # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2, or (at your option) # any later version. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA # 02111-1307, USA. #serial 2 # _AM_OUTPUT_DEPENDENCY_COMMANDS # ------------------------------ AC_DEFUN([_AM_OUTPUT_DEPENDENCY_COMMANDS], [for mf in $CONFIG_FILES; do # Strip MF so we end up with the name of the file. mf=`echo "$mf" | sed -e 's/:.*$//'` # Check whether this is an Automake generated Makefile or not. # We used to match only the files named `Makefile.in', but # some people rename them; so instead we look at the file content. # Grep'ing the first line is not enough: some people post-process # each Makefile.in and add a new line on top of each file to say so. # So let's grep whole file. if grep '^#.*generated by automake' $mf > /dev/null 2>&1; then dirpart=`AS_DIRNAME("$mf")` else continue fi # Extract the definition of DEPDIR, am__include, and am__quote # from the Makefile without running `make'. DEPDIR=`sed -n 's/^DEPDIR = //p' < "$mf"` test -z "$DEPDIR" && continue am__include=`sed -n 's/^am__include = //p' < "$mf"` test -z "am__include" && continue am__quote=`sed -n 's/^am__quote = //p' < "$mf"` # When using ansi2knr, U may be empty or an underscore; expand it U=`sed -n 's/^U = //p' < "$mf"` # Find all dependency output files, they are included files with # $(DEPDIR) in their names. We invoke sed twice because it is the # simplest approach to changing $(DEPDIR) to its actual value in the # expansion. for file in `sed -n " s/^$am__include $am__quote\(.*(DEPDIR).*\)$am__quote"'$/\1/p' <"$mf" | \ sed -e 's/\$(DEPDIR)/'"$DEPDIR"'/g' -e 's/\$U/'"$U"'/g'`; do # Make sure the directory exists. test -f "$dirpart/$file" && continue fdir=`AS_DIRNAME(["$file"])` AS_MKDIR_P([$dirpart/$fdir]) # echo "creating $dirpart/$file" echo '# dummy' > "$dirpart/$file" done done ])# _AM_OUTPUT_DEPENDENCY_COMMANDS # AM_OUTPUT_DEPENDENCY_COMMANDS # ----------------------------- # This macro should only be invoked once -- use via AC_REQUIRE. # # This code is only required when automatic dependency tracking # is enabled. FIXME. This creates each `.P' file that we will # need in order to bootstrap the dependency handling code. AC_DEFUN([AM_OUTPUT_DEPENDENCY_COMMANDS], [AC_CONFIG_COMMANDS([depfiles], [test x"$AMDEP_TRUE" != x"" || _AM_OUTPUT_DEPENDENCY_COMMANDS], [AMDEP_TRUE="$AMDEP_TRUE" ac_aux_dir="$ac_aux_dir"]) ]) # Like AC_CONFIG_HEADER, but automatically create stamp file. -*- Autoconf -*- # Copyright (C) 1996, 1997, 2000, 2001, 2003 Free Software Foundation, Inc. # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2, or (at your option) # any later version. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA # 02111-1307, USA. # serial 7 # AM_CONFIG_HEADER is obsolete. It has been replaced by AC_CONFIG_HEADERS. AU_DEFUN([AM_CONFIG_HEADER], [AC_CONFIG_HEADERS($@)]) # Do all the work for Automake. -*- Autoconf -*- # This macro actually does too much some checks are only needed if # your package does certain things. But this isn't really a big deal. # Copyright (C) 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004 # Free Software Foundation, Inc. # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2, or (at your option) # any later version. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA # 02111-1307, USA. # serial 11 # AM_INIT_AUTOMAKE(PACKAGE, VERSION, [NO-DEFINE]) # AM_INIT_AUTOMAKE([OPTIONS]) # ----------------------------------------------- # The call with PACKAGE and VERSION arguments is the old style # call (pre autoconf-2.50), which is being phased out. PACKAGE # and VERSION should now be passed to AC_INIT and removed from # the call to AM_INIT_AUTOMAKE. # We support both call styles for the transition. After # the next Automake release, Autoconf can make the AC_INIT # arguments mandatory, and then we can depend on a new Autoconf # release and drop the old call support. AC_DEFUN([AM_INIT_AUTOMAKE], [AC_PREREQ([2.58])dnl dnl Autoconf wants to disallow AM_ names. We explicitly allow dnl the ones we care about. m4_pattern_allow([^AM_[A-Z]+FLAGS$])dnl AC_REQUIRE([AM_SET_CURRENT_AUTOMAKE_VERSION])dnl AC_REQUIRE([AC_PROG_INSTALL])dnl # test to see if srcdir already configured if test "`cd $srcdir && pwd`" != "`pwd`" && test -f $srcdir/config.status; then AC_MSG_ERROR([source directory already configured; run "make distclean" there first]) fi # test whether we have cygpath if test -z "$CYGPATH_W"; then if (cygpath --version) >/dev/null 2>/dev/null; then CYGPATH_W='cygpath -w' else CYGPATH_W=echo fi fi AC_SUBST([CYGPATH_W]) # Define the identity of the package. dnl Distinguish between old-style and new-style calls. m4_ifval([$2], [m4_ifval([$3], [_AM_SET_OPTION([no-define])])dnl AC_SUBST([PACKAGE], [$1])dnl AC_SUBST([VERSION], [$2])], [_AM_SET_OPTIONS([$1])dnl AC_SUBST([PACKAGE], ['AC_PACKAGE_TARNAME'])dnl AC_SUBST([VERSION], ['AC_PACKAGE_VERSION'])])dnl _AM_IF_OPTION([no-define],, [AC_DEFINE_UNQUOTED(PACKAGE, "$PACKAGE", [Name of package]) AC_DEFINE_UNQUOTED(VERSION, "$VERSION", [Version number of package])])dnl # Some tools Automake needs. AC_REQUIRE([AM_SANITY_CHECK])dnl AC_REQUIRE([AC_ARG_PROGRAM])dnl AM_MISSING_PROG(ACLOCAL, aclocal-${am__api_version}) AM_MISSING_PROG(AUTOCONF, autoconf) AM_MISSING_PROG(AUTOMAKE, automake-${am__api_version}) AM_MISSING_PROG(AUTOHEADER, autoheader) AM_MISSING_PROG(MAKEINFO, makeinfo) AM_PROG_INSTALL_SH AM_PROG_INSTALL_STRIP AC_REQUIRE([AM_PROG_MKDIR_P])dnl # We need awk for the "check" target. The system "awk" is bad on # some platforms. AC_REQUIRE([AC_PROG_AWK])dnl AC_REQUIRE([AC_PROG_MAKE_SET])dnl AC_REQUIRE([AM_SET_LEADING_DOT])dnl _AM_IF_OPTION([tar-ustar], [_AM_PROG_TAR([ustar])], [_AM_IF_OPTION([tar-pax], [_AM_PROG_TAR([pax])], [_AM_PROG_TAR([v7])])]) _AM_IF_OPTION([no-dependencies],, [AC_PROVIDE_IFELSE([AC_PROG_CC], [_AM_DEPENDENCIES(CC)], [define([AC_PROG_CC], defn([AC_PROG_CC])[_AM_DEPENDENCIES(CC)])])dnl AC_PROVIDE_IFELSE([AC_PROG_CXX], [_AM_DEPENDENCIES(CXX)], [define([AC_PROG_CXX], defn([AC_PROG_CXX])[_AM_DEPENDENCIES(CXX)])])dnl ]) ]) # When config.status generates a header, we must update the stamp-h file. # This file resides in the same directory as the config header # that is generated. The stamp files are numbered to have different names. # Autoconf calls _AC_AM_CONFIG_HEADER_HOOK (when defined) in the # loop where config.status creates the headers, so we can generate # our stamp files there. AC_DEFUN([_AC_AM_CONFIG_HEADER_HOOK], [# Compute $1's index in $config_headers. _am_stamp_count=1 for _am_header in $config_headers :; do case $_am_header in $1 | $1:* ) break ;; * ) _am_stamp_count=`expr $_am_stamp_count + 1` ;; esac done echo "timestamp for $1" >`AS_DIRNAME([$1])`/stamp-h[]$_am_stamp_count]) # AM_PROG_INSTALL_SH # ------------------ # Define $install_sh. # Copyright (C) 2001, 2003 Free Software Foundation, Inc. # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2, or (at your option) # any later version. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA # 02111-1307, USA. AC_DEFUN([AM_PROG_INSTALL_SH], [AC_REQUIRE([AM_AUX_DIR_EXPAND])dnl install_sh=${install_sh-"$am_aux_dir/install-sh"} AC_SUBST(install_sh)]) # -*- Autoconf -*- # Copyright (C) 2003 Free Software Foundation, Inc. # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2, or (at your option) # any later version. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA # 02111-1307, USA. # serial 1 # Check whether the underlying file-system supports filenames # with a leading dot. For instance MS-DOS doesn't. AC_DEFUN([AM_SET_LEADING_DOT], [rm -rf .tst 2>/dev/null mkdir .tst 2>/dev/null if test -d .tst; then am__leading_dot=. else am__leading_dot=_ fi rmdir .tst 2>/dev/null AC_SUBST([am__leading_dot])]) # Add --enable-maintainer-mode option to configure. # From Jim Meyering # Copyright (C) 1996, 1998, 2000, 2001, 2002, 2003, 2004 # Free Software Foundation, Inc. # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2, or (at your option) # any later version. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA # 02111-1307, USA. # serial 3 AC_DEFUN([AM_MAINTAINER_MODE], [AC_MSG_CHECKING([whether to enable maintainer-specific portions of Makefiles]) dnl maintainer-mode is disabled by default AC_ARG_ENABLE(maintainer-mode, [ --enable-maintainer-mode enable make rules and dependencies not useful (and sometimes confusing) to the casual installer], USE_MAINTAINER_MODE=$enableval, USE_MAINTAINER_MODE=no) AC_MSG_RESULT([$USE_MAINTAINER_MODE]) AM_CONDITIONAL(MAINTAINER_MODE, [test $USE_MAINTAINER_MODE = yes]) MAINT=$MAINTAINER_MODE_TRUE AC_SUBST(MAINT)dnl ] ) AU_DEFUN([jm_MAINTAINER_MODE], [AM_MAINTAINER_MODE]) # Check to see how 'make' treats includes. -*- Autoconf -*- # Copyright (C) 2001, 2002, 2003 Free Software Foundation, Inc. # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2, or (at your option) # any later version. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA # 02111-1307, USA. # serial 2 # AM_MAKE_INCLUDE() # ----------------- # Check to see how make treats includes. AC_DEFUN([AM_MAKE_INCLUDE], [am_make=${MAKE-make} cat > confinc << 'END' am__doit: @echo done .PHONY: am__doit END # If we don't find an include directive, just comment out the code. AC_MSG_CHECKING([for style of include used by $am_make]) am__include="#" am__quote= _am_result=none # First try GNU make style include. echo "include confinc" > confmf # We grep out `Entering directory' and `Leaving directory' # messages which can occur if `w' ends up in MAKEFLAGS. # In particular we don't look at `^make:' because GNU make might # be invoked under some other name (usually "gmake"), in which # case it prints its new name instead of `make'. if test "`$am_make -s -f confmf 2> /dev/null | grep -v 'ing directory'`" = "done"; then am__include=include am__quote= _am_result=GNU fi # Now try BSD make style include. if test "$am__include" = "#"; then echo '.include "confinc"' > confmf if test "`$am_make -s -f confmf 2> /dev/null`" = "done"; then am__include=.include am__quote="\"" _am_result=BSD fi fi AC_SUBST([am__include]) AC_SUBST([am__quote]) AC_MSG_RESULT([$_am_result]) rm -f confinc confmf ]) # -*- Autoconf -*- # Copyright (C) 1997, 1999, 2000, 2001, 2003 Free Software Foundation, Inc. # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2, or (at your option) # any later version. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA # 02111-1307, USA. # serial 3 # AM_MISSING_PROG(NAME, PROGRAM) # ------------------------------ AC_DEFUN([AM_MISSING_PROG], [AC_REQUIRE([AM_MISSING_HAS_RUN]) $1=${$1-"${am_missing_run}$2"} AC_SUBST($1)]) # AM_MISSING_HAS_RUN # ------------------ # Define MISSING if not defined so far and test if it supports --run. # If it does, set am_missing_run to use it, otherwise, to nothing. AC_DEFUN([AM_MISSING_HAS_RUN], [AC_REQUIRE([AM_AUX_DIR_EXPAND])dnl test x"${MISSING+set}" = xset || MISSING="\${SHELL} $am_aux_dir/missing" # Use eval to expand $SHELL if eval "$MISSING --run true"; then am_missing_run="$MISSING --run " else am_missing_run= AC_MSG_WARN([`missing' script is too old or missing]) fi ]) # AM_PROG_MKDIR_P # --------------- # Check whether `mkdir -p' is supported, fallback to mkinstalldirs otherwise. # Copyright (C) 2003, 2004 Free Software Foundation, Inc. # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2, or (at your option) # any later version. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA # 02111-1307, USA. # Automake 1.8 used `mkdir -m 0755 -p --' to ensure that directories # created by `make install' are always world readable, even if the # installer happens to have an overly restrictive umask (e.g. 077). # This was a mistake. There are at least two reasons why we must not # use `-m 0755': # - it causes special bits like SGID to be ignored, # - it may be too restrictive (some setups expect 775 directories). # # Do not use -m 0755 and let people choose whatever they expect by # setting umask. # # We cannot accept any implementation of `mkdir' that recognizes `-p'. # Some implementations (such as Solaris 8's) are not thread-safe: if a # parallel make tries to run `mkdir -p a/b' and `mkdir -p a/c' # concurrently, both version can detect that a/ is missing, but only # one can create it and the other will error out. Consequently we # restrict ourselves to GNU make (using the --version option ensures # this.) AC_DEFUN([AM_PROG_MKDIR_P], [if mkdir -p --version . >/dev/null 2>&1 && test ! -d ./--version; then # We used to keeping the `.' as first argument, in order to # allow $(mkdir_p) to be used without argument. As in # $(mkdir_p) $(somedir) # where $(somedir) is conditionally defined. However this is wrong # for two reasons: # 1. if the package is installed by a user who cannot write `.' # make install will fail, # 2. the above comment should most certainly read # $(mkdir_p) $(DESTDIR)$(somedir) # so it does not work when $(somedir) is undefined and # $(DESTDIR) is not. # To support the latter case, we have to write # test -z "$(somedir)" || $(mkdir_p) $(DESTDIR)$(somedir), # so the `.' trick is pointless. mkdir_p='mkdir -p --' else # On NextStep and OpenStep, the `mkdir' command does not # recognize any option. It will interpret all options as # directories to create, and then abort because `.' already # exists. for d in ./-p ./--version; do test -d $d && rmdir $d done # $(mkinstalldirs) is defined by Automake if mkinstalldirs exists. if test -f "$ac_aux_dir/mkinstalldirs"; then mkdir_p='$(mkinstalldirs)' else mkdir_p='$(install_sh) -d' fi fi AC_SUBST([mkdir_p])]) # Helper functions for option handling. -*- Autoconf -*- # Copyright (C) 2001, 2002, 2003 Free Software Foundation, Inc. # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2, or (at your option) # any later version. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA # 02111-1307, USA. # serial 2 # _AM_MANGLE_OPTION(NAME) # ----------------------- AC_DEFUN([_AM_MANGLE_OPTION], [[_AM_OPTION_]m4_bpatsubst($1, [[^a-zA-Z0-9_]], [_])]) # _AM_SET_OPTION(NAME) # ------------------------------ # Set option NAME. Presently that only means defining a flag for this option. AC_DEFUN([_AM_SET_OPTION], [m4_define(_AM_MANGLE_OPTION([$1]), 1)]) # _AM_SET_OPTIONS(OPTIONS) # ---------------------------------- # OPTIONS is a space-separated list of Automake options. AC_DEFUN([_AM_SET_OPTIONS], [AC_FOREACH([_AM_Option], [$1], [_AM_SET_OPTION(_AM_Option)])]) # _AM_IF_OPTION(OPTION, IF-SET, [IF-NOT-SET]) # ------------------------------------------- # Execute IF-SET if OPTION is set, IF-NOT-SET otherwise. AC_DEFUN([_AM_IF_OPTION], [m4_ifset(_AM_MANGLE_OPTION([$1]), [$2], [$3])]) # # Check to make sure that the build environment is sane. # # Copyright (C) 1996, 1997, 2000, 2001, 2003 Free Software Foundation, Inc. # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2, or (at your option) # any later version. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA # 02111-1307, USA. # serial 3 # AM_SANITY_CHECK # --------------- AC_DEFUN([AM_SANITY_CHECK], [AC_MSG_CHECKING([whether build environment is sane]) # Just in case sleep 1 echo timestamp > conftest.file # Do `set' in a subshell so we don't clobber the current shell's # arguments. Must try -L first in case configure is actually a # symlink; some systems play weird games with the mod time of symlinks # (eg FreeBSD returns the mod time of the symlink's containing # directory). if ( set X `ls -Lt $srcdir/configure conftest.file 2> /dev/null` if test "$[*]" = "X"; then # -L didn't work. set X `ls -t $srcdir/configure conftest.file` fi rm -f conftest.file if test "$[*]" != "X $srcdir/configure conftest.file" \ && test "$[*]" != "X conftest.file $srcdir/configure"; then # If neither matched, then we have a broken ls. This can happen # if, for instance, CONFIG_SHELL is bash and it inherits a # broken ls alias from the environment. This has actually # happened. Such a system could not be considered "sane". AC_MSG_ERROR([ls -t appears to fail. Make sure there is not a broken alias in your environment]) fi test "$[2]" = conftest.file ) then # Ok. : else AC_MSG_ERROR([newly created file is older than distributed files! Check your system clock]) fi AC_MSG_RESULT(yes)]) # AM_PROG_INSTALL_STRIP # Copyright (C) 2001, 2003 Free Software Foundation, Inc. # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2, or (at your option) # any later version. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA # 02111-1307, USA. # One issue with vendor `install' (even GNU) is that you can't # specify the program used to strip binaries. This is especially # annoying in cross-compiling environments, where the build's strip # is unlikely to handle the host's binaries. # Fortunately install-sh will honor a STRIPPROG variable, so we # always use install-sh in `make install-strip', and initialize # STRIPPROG with the value of the STRIP variable (set by the user). AC_DEFUN([AM_PROG_INSTALL_STRIP], [AC_REQUIRE([AM_PROG_INSTALL_SH])dnl # Installed binaries are usually stripped using `strip' when the user # run `make install-strip'. However `strip' might not be the right # tool to use in cross-compilation environments, therefore Automake # will honor the `STRIP' environment variable to overrule this program. dnl Don't test for $cross_compiling = yes, because it might be `maybe'. if test "$cross_compiling" != no; then AC_CHECK_TOOL([STRIP], [strip], :) fi INSTALL_STRIP_PROGRAM="\${SHELL} \$(install_sh) -c -s" AC_SUBST([INSTALL_STRIP_PROGRAM])]) # Check how to create a tarball. -*- Autoconf -*- # Copyright (C) 2004 Free Software Foundation, Inc. # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2, or (at your option) # any later version. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA # 02111-1307, USA. # serial 1 # _AM_PROG_TAR(FORMAT) # -------------------- # Check how to create a tarball in format FORMAT. # FORMAT should be one of `v7', `ustar', or `pax'. # # Substitute a variable $(am__tar) that is a command # writing to stdout a FORMAT-tarball containing the directory # $tardir. # tardir=directory && $(am__tar) > result.tar # # Substitute a variable $(am__untar) that extract such # a tarball read from stdin. # $(am__untar) < result.tar AC_DEFUN([_AM_PROG_TAR], [# Always define AMTAR for backward compatibility. AM_MISSING_PROG([AMTAR], [tar]) m4_if([$1], [v7], [am__tar='${AMTAR} chof - "$$tardir"'; am__untar='${AMTAR} xf -'], [m4_case([$1], [ustar],, [pax],, [m4_fatal([Unknown tar format])]) AC_MSG_CHECKING([how to create a $1 tar archive]) # Loop over all known methods to create a tar archive until one works. _am_tools='gnutar m4_if([$1], [ustar], [plaintar]) pax cpio none' _am_tools=${am_cv_prog_tar_$1-$_am_tools} # Do not fold the above two line into one, because Tru64 sh and # Solaris sh will not grok spaces in the rhs of `-'. for _am_tool in $_am_tools do case $_am_tool in gnutar) for _am_tar in tar gnutar gtar; do AM_RUN_LOG([$_am_tar --version]) && break done am__tar="$_am_tar --format=m4_if([$1], [pax], [posix], [$1]) -chf - "'"$$tardir"' am__tar_="$_am_tar --format=m4_if([$1], [pax], [posix], [$1]) -chf - "'"$tardir"' am__untar="$_am_tar -xf -" ;; plaintar) # Must skip GNU tar: if it does not support --format= it doesn't create # ustar tarball either. (tar --version) >/dev/null 2>&1 && continue am__tar='tar chf - "$$tardir"' am__tar_='tar chf - "$tardir"' am__untar='tar xf -' ;; pax) am__tar='pax -L -x $1 -w "$$tardir"' am__tar_='pax -L -x $1 -w "$tardir"' am__untar='pax -r' ;; cpio) am__tar='find "$$tardir" -print | cpio -o -H $1 -L' am__tar_='find "$tardir" -print | cpio -o -H $1 -L' am__untar='cpio -i -H $1 -d' ;; none) am__tar=false am__tar_=false am__untar=false ;; esac # If the value was cached, stop now. We just wanted to have am__tar # and am__untar set. test -n "${am_cv_prog_tar_$1}" && break # tar/untar a dummy directory, and stop if the command works rm -rf conftest.dir mkdir conftest.dir echo GrepMe > conftest.dir/file AM_RUN_LOG([tardir=conftest.dir && eval $am__tar_ >conftest.tar]) rm -rf conftest.dir if test -s conftest.tar; then AM_RUN_LOG([$am__untar /dev/null 2>&1 && break fi done rm -rf conftest.dir AC_CACHE_VAL([am_cv_prog_tar_$1], [am_cv_prog_tar_$1=$_am_tool]) AC_MSG_RESULT([$am_cv_prog_tar_$1])]) AC_SUBST([am__tar]) AC_SUBST([am__untar]) ]) # _AM_PROG_TAR m4_include([m4/talkfilters.m4]) m4_include([acinclude.m4]) libtranslate-0.99/Makefile.am000644 001750 001750 00000000462 10172241333 017727 0ustar00jylefortjylefort000000 000000 # docs needs src SUBDIRS = data m4 po src docs EXTRA_DIST = \ autogen.sh \ autotools.conf \ intltool-extract.in \ intltool-merge.in \ intltool-update.in DISTCLEANFILES = \ intltool-extract \ intltool-merge \ intltool-update MAINTAINERCLEANFILES = \ config.guess \ config.sub \ ltmain.sh libtranslate-0.99/Makefile.in000644 001750 001750 00000052335 10176430642 017755 0ustar00jylefortjylefort000000 000000 # Makefile.in generated by automake 1.9.2 from Makefile.am. # @configure_input@ # Copyright (C) 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001, 2002, # 2003, 2004 Free Software Foundation, Inc. # This Makefile.in is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY, to the extent permitted by law; without # even the implied warranty of MERCHANTABILITY or FITNESS FOR A # PARTICULAR PURPOSE. @SET_MAKE@ srcdir = @srcdir@ top_srcdir = @top_srcdir@ VPATH = @srcdir@ pkgdatadir = $(datadir)/@PACKAGE@ pkglibdir = $(libdir)/@PACKAGE@ pkgincludedir = $(includedir)/@PACKAGE@ top_builddir = . am__cd = CDPATH="$${ZSH_VERSION+.}$(PATH_SEPARATOR)" && cd INSTALL = @INSTALL@ install_sh_DATA = $(install_sh) -c -m 644 install_sh_PROGRAM = $(install_sh) -c install_sh_SCRIPT = $(install_sh) -c INSTALL_HEADER = $(INSTALL_DATA) transform = $(program_transform_name) NORMAL_INSTALL = : PRE_INSTALL = : POST_INSTALL = : NORMAL_UNINSTALL = : PRE_UNINSTALL = : POST_UNINSTALL = : build_triplet = @build@ host_triplet = @host@ DIST_COMMON = README $(am__configure_deps) $(srcdir)/Makefile.am \ $(srcdir)/Makefile.in $(srcdir)/config.h.in \ $(top_srcdir)/configure AUTHORS COPYING INSTALL NEWS TODO \ compile config.guess config.sub depcomp install-sh ltmain.sh \ missing mkinstalldirs subdir = . ACLOCAL_M4 = $(top_srcdir)/aclocal.m4 am__aclocal_m4_deps = $(top_srcdir)/m4/talkfilters.m4 \ $(top_srcdir)/acinclude.m4 $(top_srcdir)/configure.ac am__configure_deps = $(am__aclocal_m4_deps) $(CONFIGURE_DEPENDENCIES) \ $(ACLOCAL_M4) am__CONFIG_DISTCLEAN_FILES = config.status config.cache config.log \ configure.lineno configure.status.lineno mkinstalldirs = $(SHELL) $(top_srcdir)/mkinstalldirs CONFIG_HEADER = config.h CONFIG_CLEAN_FILES = SOURCES = DIST_SOURCES = RECURSIVE_TARGETS = all-recursive check-recursive dvi-recursive \ html-recursive info-recursive install-data-recursive \ install-exec-recursive install-info-recursive \ install-recursive installcheck-recursive installdirs-recursive \ pdf-recursive ps-recursive uninstall-info-recursive \ uninstall-recursive ETAGS = etags CTAGS = ctags DIST_SUBDIRS = $(SUBDIRS) DISTFILES = $(DIST_COMMON) $(DIST_SOURCES) $(TEXINFOS) $(EXTRA_DIST) distdir = $(PACKAGE)-$(VERSION) top_distdir = $(distdir) am__remove_distdir = \ { test ! -d $(distdir) \ || { find $(distdir) -type d ! -perm -200 -exec chmod u+w {} ';' \ && rm -fr $(distdir); }; } DIST_ARCHIVES = $(distdir).tar.gz GZIP_ENV = --best distuninstallcheck_listfiles = find . -type f -print distcleancheck_listfiles = find . -type f -print ACLOCAL = @ACLOCAL@ AMDEP_FALSE = @AMDEP_FALSE@ AMDEP_TRUE = @AMDEP_TRUE@ AMTAR = @AMTAR@ AR = @AR@ AUTOCONF = @AUTOCONF@ AUTOHEADER = @AUTOHEADER@ AUTOMAKE = @AUTOMAKE@ AWK = @AWK@ CATALOGS = @CATALOGS@ CATOBJEXT = @CATOBJEXT@ CC = @CC@ CCDEPMODE = @CCDEPMODE@ CFLAGS = @CFLAGS@ CPP = @CPP@ CPPFLAGS = @CPPFLAGS@ CXX = @CXX@ CXXCPP = @CXXCPP@ CXXDEPMODE = @CXXDEPMODE@ CXXFLAGS = @CXXFLAGS@ CYGPATH_W = @CYGPATH_W@ DATADIRNAME = @DATADIRNAME@ DEFS = @DEFS@ DEPDIR = @DEPDIR@ ECHO = @ECHO@ ECHO_C = @ECHO_C@ ECHO_N = @ECHO_N@ ECHO_T = @ECHO_T@ EGREP = @EGREP@ ENABLE_GTK_DOC_FALSE = @ENABLE_GTK_DOC_FALSE@ ENABLE_GTK_DOC_TRUE = @ENABLE_GTK_DOC_TRUE@ EXEEXT = @EXEEXT@ F77 = @F77@ FFLAGS = @FFLAGS@ GETTEXT_PACKAGE = @GETTEXT_PACKAGE@ GLIB_CFLAGS = @GLIB_CFLAGS@ GLIB_LIBS = @GLIB_LIBS@ GMOFILES = @GMOFILES@ GMSGFMT = @GMSGFMT@ GTK_DOC_USE_LIBTOOL_FALSE = @GTK_DOC_USE_LIBTOOL_FALSE@ GTK_DOC_USE_LIBTOOL_TRUE = @GTK_DOC_USE_LIBTOOL_TRUE@ HTML_DIR = @HTML_DIR@ ICONV = @ICONV@ INSTALL_DATA = @INSTALL_DATA@ INSTALL_PROGRAM = @INSTALL_PROGRAM@ INSTALL_SCRIPT = @INSTALL_SCRIPT@ INSTALL_STRIP_PROGRAM = @INSTALL_STRIP_PROGRAM@ INSTOBJEXT = @INSTOBJEXT@ INTLLIBS = @INTLLIBS@ INTLTOOL_CAVES_RULE = @INTLTOOL_CAVES_RULE@ INTLTOOL_DESKTOP_RULE = @INTLTOOL_DESKTOP_RULE@ INTLTOOL_DIRECTORY_RULE = @INTLTOOL_DIRECTORY_RULE@ INTLTOOL_EXTRACT = @INTLTOOL_EXTRACT@ INTLTOOL_KBD_RULE = @INTLTOOL_KBD_RULE@ INTLTOOL_KEYS_RULE = @INTLTOOL_KEYS_RULE@ INTLTOOL_MERGE = @INTLTOOL_MERGE@ INTLTOOL_OAF_RULE = @INTLTOOL_OAF_RULE@ INTLTOOL_PERL = @INTLTOOL_PERL@ INTLTOOL_PONG_RULE = @INTLTOOL_PONG_RULE@ INTLTOOL_PROP_RULE = @INTLTOOL_PROP_RULE@ INTLTOOL_SCHEMAS_RULE = @INTLTOOL_SCHEMAS_RULE@ INTLTOOL_SERVER_RULE = @INTLTOOL_SERVER_RULE@ INTLTOOL_SHEET_RULE = @INTLTOOL_SHEET_RULE@ INTLTOOL_SOUNDLIST_RULE = @INTLTOOL_SOUNDLIST_RULE@ INTLTOOL_THEME_RULE = @INTLTOOL_THEME_RULE@ INTLTOOL_UI_RULE = @INTLTOOL_UI_RULE@ INTLTOOL_UPDATE = @INTLTOOL_UPDATE@ INTLTOOL_XAM_RULE = @INTLTOOL_XAM_RULE@ INTLTOOL_XML_NOMERGE_RULE = @INTLTOOL_XML_NOMERGE_RULE@ INTLTOOL_XML_RULE = @INTLTOOL_XML_RULE@ LDFLAGS = @LDFLAGS@ LIBOBJS = @LIBOBJS@ LIBS = @LIBS@ LIBTOOL = @LIBTOOL@ LIBXML_CFLAGS = @LIBXML_CFLAGS@ LIBXML_LIBS = @LIBXML_LIBS@ LN_S = @LN_S@ LTLIBOBJS = @LTLIBOBJS@ MAINT = @MAINT@ MAINTAINER_MODE_FALSE = @MAINTAINER_MODE_FALSE@ MAINTAINER_MODE_TRUE = @MAINTAINER_MODE_TRUE@ MAKEINFO = @MAKEINFO@ MKINSTALLDIRS = @MKINSTALLDIRS@ MSGFMT = @MSGFMT@ MSGMERGE = @MSGMERGE@ OBJEXT = @OBJEXT@ PACKAGE = @PACKAGE@ PACKAGE_BUGREPORT = @PACKAGE_BUGREPORT@ PACKAGE_NAME = @PACKAGE_NAME@ PACKAGE_STRING = @PACKAGE_STRING@ PACKAGE_TARNAME = @PACKAGE_TARNAME@ PACKAGE_VERSION = @PACKAGE_VERSION@ PATH_SEPARATOR = @PATH_SEPARATOR@ PKG_CONFIG = @PKG_CONFIG@ POFILES = @POFILES@ POSUB = @POSUB@ PO_IN_DATADIR_FALSE = @PO_IN_DATADIR_FALSE@ PO_IN_DATADIR_TRUE = @PO_IN_DATADIR_TRUE@ RANLIB = @RANLIB@ SET_MAKE = @SET_MAKE@ SHELL = @SHELL@ SOUP_CFLAGS = @SOUP_CFLAGS@ SOUP_LIBS = @SOUP_LIBS@ STRIP = @STRIP@ TALKFILTERS_CFLAGS = @TALKFILTERS_CFLAGS@ TALKFILTERS_LIBS = @TALKFILTERS_LIBS@ USE_NLS = @USE_NLS@ VERSION = @VERSION@ WARN_CFLAGS = @WARN_CFLAGS@ WITH_GENERIC_FALSE = @WITH_GENERIC_FALSE@ WITH_GENERIC_TRUE = @WITH_GENERIC_TRUE@ WITH_REGRESSION_TESTS_FALSE = @WITH_REGRESSION_TESTS_FALSE@ WITH_REGRESSION_TESTS_TRUE = @WITH_REGRESSION_TESTS_TRUE@ WITH_TALKFILTERS_FALSE = @WITH_TALKFILTERS_FALSE@ WITH_TALKFILTERS_TRUE = @WITH_TALKFILTERS_TRUE@ XGETTEXT = @XGETTEXT@ ac_ct_AR = @ac_ct_AR@ ac_ct_CC = @ac_ct_CC@ ac_ct_CXX = @ac_ct_CXX@ ac_ct_F77 = @ac_ct_F77@ ac_ct_RANLIB = @ac_ct_RANLIB@ ac_ct_STRIP = @ac_ct_STRIP@ am__fastdepCC_FALSE = @am__fastdepCC_FALSE@ am__fastdepCC_TRUE = @am__fastdepCC_TRUE@ am__fastdepCXX_FALSE = @am__fastdepCXX_FALSE@ am__fastdepCXX_TRUE = @am__fastdepCXX_TRUE@ am__include = @am__include@ am__leading_dot = @am__leading_dot@ am__quote = @am__quote@ am__tar = @am__tar@ am__untar = @am__untar@ bindir = @bindir@ build = @build@ build_alias = @build_alias@ build_cpu = @build_cpu@ build_os = @build_os@ build_vendor = @build_vendor@ datadir = @datadir@ exec_prefix = @exec_prefix@ host = @host@ host_alias = @host_alias@ host_cpu = @host_cpu@ host_os = @host_os@ host_vendor = @host_vendor@ includedir = @includedir@ infodir = @infodir@ install_sh = @install_sh@ libdir = @libdir@ libexecdir = @libexecdir@ localstatedir = @localstatedir@ mandir = @mandir@ mkdir_p = @mkdir_p@ oldincludedir = @oldincludedir@ prefix = @prefix@ program_transform_name = @program_transform_name@ sbindir = @sbindir@ sharedstatedir = @sharedstatedir@ sysconfdir = @sysconfdir@ target_alias = @target_alias@ # docs needs src SUBDIRS = data m4 po src docs EXTRA_DIST = \ autogen.sh \ autotools.conf \ intltool-extract.in \ intltool-merge.in \ intltool-update.in DISTCLEANFILES = \ intltool-extract \ intltool-merge \ intltool-update MAINTAINERCLEANFILES = \ config.guess \ config.sub \ ltmain.sh all: config.h $(MAKE) $(AM_MAKEFLAGS) all-recursive .SUFFIXES: am--refresh: @: $(srcdir)/Makefile.in: @MAINTAINER_MODE_TRUE@ $(srcdir)/Makefile.am $(am__configure_deps) @for dep in $?; do \ case '$(am__configure_deps)' in \ *$$dep*) \ echo ' cd $(srcdir) && $(AUTOMAKE) --foreign '; \ cd $(srcdir) && $(AUTOMAKE) --foreign \ && exit 0; \ exit 1;; \ esac; \ done; \ echo ' cd $(top_srcdir) && $(AUTOMAKE) --foreign Makefile'; \ cd $(top_srcdir) && \ $(AUTOMAKE) --foreign Makefile .PRECIOUS: Makefile Makefile: $(srcdir)/Makefile.in $(top_builddir)/config.status @case '$?' in \ *config.status*) \ echo ' $(SHELL) ./config.status'; \ $(SHELL) ./config.status;; \ *) \ echo ' cd $(top_builddir) && $(SHELL) ./config.status $@ $(am__depfiles_maybe)'; \ cd $(top_builddir) && $(SHELL) ./config.status $@ $(am__depfiles_maybe);; \ esac; $(top_builddir)/config.status: $(top_srcdir)/configure $(CONFIG_STATUS_DEPENDENCIES) $(SHELL) ./config.status --recheck $(top_srcdir)/configure: @MAINTAINER_MODE_TRUE@ $(am__configure_deps) cd $(srcdir) && $(AUTOCONF) $(ACLOCAL_M4): @MAINTAINER_MODE_TRUE@ $(am__aclocal_m4_deps) cd $(srcdir) && $(ACLOCAL) $(ACLOCAL_AMFLAGS) config.h: stamp-h1 @if test ! -f $@; then \ rm -f stamp-h1; \ $(MAKE) stamp-h1; \ else :; fi stamp-h1: $(srcdir)/config.h.in $(top_builddir)/config.status @rm -f stamp-h1 cd $(top_builddir) && $(SHELL) ./config.status config.h $(srcdir)/config.h.in: @MAINTAINER_MODE_TRUE@ $(am__configure_deps) cd $(top_srcdir) && $(AUTOHEADER) rm -f stamp-h1 touch $@ distclean-hdr: -rm -f config.h stamp-h1 mostlyclean-libtool: -rm -f *.lo clean-libtool: -rm -rf .libs _libs distclean-libtool: -rm -f libtool uninstall-info-am: # This directory's subdirectories are mostly independent; you can cd # into them and run `make' without going through this Makefile. # To change the values of `make' variables: instead of editing Makefiles, # (1) if the variable is set in `config.status', edit `config.status' # (which will cause the Makefiles to be regenerated when you run `make'); # (2) otherwise, pass the desired values on the `make' command line. $(RECURSIVE_TARGETS): @set fnord $$MAKEFLAGS; amf=$$2; \ dot_seen=no; \ target=`echo $@ | sed s/-recursive//`; \ list='$(SUBDIRS)'; for subdir in $$list; do \ echo "Making $$target in $$subdir"; \ if test "$$subdir" = "."; then \ dot_seen=yes; \ local_target="$$target-am"; \ else \ local_target="$$target"; \ fi; \ (cd $$subdir && $(MAKE) $(AM_MAKEFLAGS) $$local_target) \ || case "$$amf" in *=*) exit 1;; *k*) fail=yes;; *) exit 1;; esac; \ done; \ if test "$$dot_seen" = "no"; then \ $(MAKE) $(AM_MAKEFLAGS) "$$target-am" || exit 1; \ fi; test -z "$$fail" mostlyclean-recursive clean-recursive distclean-recursive \ maintainer-clean-recursive: @set fnord $$MAKEFLAGS; amf=$$2; \ dot_seen=no; \ case "$@" in \ distclean-* | maintainer-clean-*) list='$(DIST_SUBDIRS)' ;; \ *) list='$(SUBDIRS)' ;; \ esac; \ rev=''; for subdir in $$list; do \ if test "$$subdir" = "."; then :; else \ rev="$$subdir $$rev"; \ fi; \ done; \ rev="$$rev ."; \ target=`echo $@ | sed s/-recursive//`; \ for subdir in $$rev; do \ echo "Making $$target in $$subdir"; \ if test "$$subdir" = "."; then \ local_target="$$target-am"; \ else \ local_target="$$target"; \ fi; \ (cd $$subdir && $(MAKE) $(AM_MAKEFLAGS) $$local_target) \ || case "$$amf" in *=*) exit 1;; *k*) fail=yes;; *) exit 1;; esac; \ done && test -z "$$fail" tags-recursive: list='$(SUBDIRS)'; for subdir in $$list; do \ test "$$subdir" = . || (cd $$subdir && $(MAKE) $(AM_MAKEFLAGS) tags); \ done ctags-recursive: list='$(SUBDIRS)'; for subdir in $$list; do \ test "$$subdir" = . || (cd $$subdir && $(MAKE) $(AM_MAKEFLAGS) ctags); \ done ID: $(HEADERS) $(SOURCES) $(LISP) $(TAGS_FILES) list='$(SOURCES) $(HEADERS) $(LISP) $(TAGS_FILES)'; \ unique=`for i in $$list; do \ if test -f "$$i"; then echo $$i; else echo $(srcdir)/$$i; fi; \ done | \ $(AWK) ' { files[$$0] = 1; } \ END { for (i in files) print i; }'`; \ mkid -fID $$unique tags: TAGS TAGS: tags-recursive $(HEADERS) $(SOURCES) config.h.in $(TAGS_DEPENDENCIES) \ $(TAGS_FILES) $(LISP) tags=; \ here=`pwd`; \ if ($(ETAGS) --etags-include --version) >/dev/null 2>&1; then \ include_option=--etags-include; \ empty_fix=.; \ else \ include_option=--include; \ empty_fix=; \ fi; \ list='$(SUBDIRS)'; for subdir in $$list; do \ if test "$$subdir" = .; then :; else \ test ! -f $$subdir/TAGS || \ tags="$$tags $$include_option=$$here/$$subdir/TAGS"; \ fi; \ done; \ list='$(SOURCES) $(HEADERS) config.h.in $(LISP) $(TAGS_FILES)'; \ unique=`for i in $$list; do \ if test -f "$$i"; then echo $$i; else echo $(srcdir)/$$i; fi; \ done | \ $(AWK) ' { files[$$0] = 1; } \ END { for (i in files) print i; }'`; \ if test -z "$(ETAGS_ARGS)$$tags$$unique"; then :; else \ test -n "$$unique" || unique=$$empty_fix; \ $(ETAGS) $(ETAGSFLAGS) $(AM_ETAGSFLAGS) $(ETAGS_ARGS) \ $$tags $$unique; \ fi ctags: CTAGS CTAGS: ctags-recursive $(HEADERS) $(SOURCES) config.h.in $(TAGS_DEPENDENCIES) \ $(TAGS_FILES) $(LISP) tags=; \ here=`pwd`; \ list='$(SOURCES) $(HEADERS) config.h.in $(LISP) $(TAGS_FILES)'; \ unique=`for i in $$list; do \ if test -f "$$i"; then echo $$i; else echo $(srcdir)/$$i; fi; \ done | \ $(AWK) ' { files[$$0] = 1; } \ END { for (i in files) print i; }'`; \ test -z "$(CTAGS_ARGS)$$tags$$unique" \ || $(CTAGS) $(CTAGSFLAGS) $(AM_CTAGSFLAGS) $(CTAGS_ARGS) \ $$tags $$unique GTAGS: here=`$(am__cd) $(top_builddir) && pwd` \ && cd $(top_srcdir) \ && gtags -i $(GTAGS_ARGS) $$here distclean-tags: -rm -f TAGS ID GTAGS GRTAGS GSYMS GPATH tags distdir: $(DISTFILES) $(am__remove_distdir) mkdir $(distdir) $(mkdir_p) $(distdir)/data $(distdir)/docs/man $(distdir)/docs/reference $(distdir)/m4 $(distdir)/po @srcdirstrip=`echo "$(srcdir)" | sed 's|.|.|g'`; \ topsrcdirstrip=`echo "$(top_srcdir)" | sed 's|.|.|g'`; \ list='$(DISTFILES)'; for file in $$list; do \ case $$file in \ $(srcdir)/*) file=`echo "$$file" | sed "s|^$$srcdirstrip/||"`;; \ $(top_srcdir)/*) file=`echo "$$file" | sed "s|^$$topsrcdirstrip/|$(top_builddir)/|"`;; \ esac; \ if test -f $$file || test -d $$file; then d=.; else d=$(srcdir); fi; \ dir=`echo "$$file" | sed -e 's,/[^/]*$$,,'`; \ if test "$$dir" != "$$file" && test "$$dir" != "."; then \ dir="/$$dir"; \ $(mkdir_p) "$(distdir)$$dir"; \ else \ dir=''; \ fi; \ if test -d $$d/$$file; then \ if test -d $(srcdir)/$$file && test $$d != $(srcdir); then \ cp -pR $(srcdir)/$$file $(distdir)$$dir || exit 1; \ fi; \ cp -pR $$d/$$file $(distdir)$$dir || exit 1; \ else \ test -f $(distdir)/$$file \ || cp -p $$d/$$file $(distdir)/$$file \ || exit 1; \ fi; \ done list='$(DIST_SUBDIRS)'; for subdir in $$list; do \ if test "$$subdir" = .; then :; else \ test -d "$(distdir)/$$subdir" \ || $(mkdir_p) "$(distdir)/$$subdir" \ || exit 1; \ distdir=`$(am__cd) $(distdir) && pwd`; \ top_distdir=`$(am__cd) $(top_distdir) && pwd`; \ (cd $$subdir && \ $(MAKE) $(AM_MAKEFLAGS) \ top_distdir="$$top_distdir" \ distdir="$$distdir/$$subdir" \ distdir) \ || exit 1; \ fi; \ done -find $(distdir) -type d ! -perm -777 -exec chmod a+rwx {} \; -o \ ! -type d ! -perm -444 -links 1 -exec chmod a+r {} \; -o \ ! -type d ! -perm -400 -exec chmod a+r {} \; -o \ ! -type d ! -perm -444 -exec $(SHELL) $(install_sh) -c -m a+r {} {} \; \ || chmod -R a+r $(distdir) dist-gzip: distdir tardir=$(distdir) && $(am__tar) | GZIP=$(GZIP_ENV) gzip -c >$(distdir).tar.gz $(am__remove_distdir) dist-bzip2: distdir tardir=$(distdir) && $(am__tar) | bzip2 -9 -c >$(distdir).tar.bz2 $(am__remove_distdir) dist-tarZ: distdir tardir=$(distdir) && $(am__tar) | compress -c >$(distdir).tar.Z $(am__remove_distdir) dist-shar: distdir shar $(distdir) | GZIP=$(GZIP_ENV) gzip -c >$(distdir).shar.gz $(am__remove_distdir) dist-zip: distdir -rm -f $(distdir).zip zip -rq $(distdir).zip $(distdir) $(am__remove_distdir) dist dist-all: distdir tardir=$(distdir) && $(am__tar) | GZIP=$(GZIP_ENV) gzip -c >$(distdir).tar.gz $(am__remove_distdir) # This target untars the dist file and tries a VPATH configuration. Then # it guarantees that the distribution is self-contained by making another # tarfile. distcheck: dist case '$(DIST_ARCHIVES)' in \ *.tar.gz*) \ GZIP=$(GZIP_ENV) gunzip -c $(distdir).tar.gz | $(am__untar) ;;\ *.tar.bz2*) \ bunzip2 -c $(distdir).tar.bz2 | $(am__untar) ;;\ *.tar.Z*) \ uncompress -c $(distdir).tar.Z | $(am__untar) ;;\ *.shar.gz*) \ GZIP=$(GZIP_ENV) gunzip -c $(distdir).shar.gz | unshar ;;\ *.zip*) \ unzip $(distdir).zip ;;\ esac chmod -R a-w $(distdir); chmod a+w $(distdir) mkdir $(distdir)/_build mkdir $(distdir)/_inst chmod a-w $(distdir) dc_install_base=`$(am__cd) $(distdir)/_inst && pwd | sed -e 's,^[^:\\/]:[\\/],/,'` \ && dc_destdir="$${TMPDIR-/tmp}/am-dc-$$$$/" \ && cd $(distdir)/_build \ && ../configure --srcdir=.. --prefix="$$dc_install_base" \ $(DISTCHECK_CONFIGURE_FLAGS) \ && $(MAKE) $(AM_MAKEFLAGS) \ && $(MAKE) $(AM_MAKEFLAGS) dvi \ && $(MAKE) $(AM_MAKEFLAGS) check \ && $(MAKE) $(AM_MAKEFLAGS) install \ && $(MAKE) $(AM_MAKEFLAGS) installcheck \ && $(MAKE) $(AM_MAKEFLAGS) uninstall \ && $(MAKE) $(AM_MAKEFLAGS) distuninstallcheck_dir="$$dc_install_base" \ distuninstallcheck \ && chmod -R a-w "$$dc_install_base" \ && ({ \ (cd ../.. && umask 077 && mkdir "$$dc_destdir") \ && $(MAKE) $(AM_MAKEFLAGS) DESTDIR="$$dc_destdir" install \ && $(MAKE) $(AM_MAKEFLAGS) DESTDIR="$$dc_destdir" uninstall \ && $(MAKE) $(AM_MAKEFLAGS) DESTDIR="$$dc_destdir" \ distuninstallcheck_dir="$$dc_destdir" distuninstallcheck; \ } || { rm -rf "$$dc_destdir"; exit 1; }) \ && rm -rf "$$dc_destdir" \ && $(MAKE) $(AM_MAKEFLAGS) dist \ && rm -rf $(DIST_ARCHIVES) \ && $(MAKE) $(AM_MAKEFLAGS) distcleancheck $(am__remove_distdir) @(echo "$(distdir) archives ready for distribution: "; \ list='$(DIST_ARCHIVES)'; for i in $$list; do echo $$i; done) | \ sed -e '1{h;s/./=/g;p;x;}' -e '$${p;x;}' distuninstallcheck: @cd $(distuninstallcheck_dir) \ && test `$(distuninstallcheck_listfiles) | wc -l` -le 1 \ || { echo "ERROR: files left after uninstall:" ; \ if test -n "$(DESTDIR)"; then \ echo " (check DESTDIR support)"; \ fi ; \ $(distuninstallcheck_listfiles) ; \ exit 1; } >&2 distcleancheck: distclean @if test '$(srcdir)' = . ; then \ echo "ERROR: distcleancheck can only run from a VPATH build" ; \ exit 1 ; \ fi @test `$(distcleancheck_listfiles) | wc -l` -eq 0 \ || { echo "ERROR: files left in build directory after distclean:" ; \ $(distcleancheck_listfiles) ; \ exit 1; } >&2 check-am: all-am check: check-recursive all-am: Makefile config.h installdirs: installdirs-recursive installdirs-am: install: install-recursive install-exec: install-exec-recursive install-data: install-data-recursive uninstall: uninstall-recursive install-am: all-am @$(MAKE) $(AM_MAKEFLAGS) install-exec-am install-data-am installcheck: installcheck-recursive install-strip: $(MAKE) $(AM_MAKEFLAGS) INSTALL_PROGRAM="$(INSTALL_STRIP_PROGRAM)" \ install_sh_PROGRAM="$(INSTALL_STRIP_PROGRAM)" INSTALL_STRIP_FLAG=-s \ `test -z '$(STRIP)' || \ echo "INSTALL_PROGRAM_ENV=STRIPPROG='$(STRIP)'"` install mostlyclean-generic: clean-generic: distclean-generic: -test -z "$(CONFIG_CLEAN_FILES)" || rm -f $(CONFIG_CLEAN_FILES) -test -z "$(DISTCLEANFILES)" || rm -f $(DISTCLEANFILES) maintainer-clean-generic: @echo "This command is intended for maintainers to use" @echo "it deletes files that may require special tools to rebuild." -test -z "$(MAINTAINERCLEANFILES)" || rm -f $(MAINTAINERCLEANFILES) clean: clean-recursive clean-am: clean-generic clean-libtool mostlyclean-am distclean: distclean-recursive -rm -f $(am__CONFIG_DISTCLEAN_FILES) -rm -f Makefile distclean-am: clean-am distclean-generic distclean-hdr \ distclean-libtool distclean-tags dvi: dvi-recursive dvi-am: html: html-recursive info: info-recursive info-am: install-data-am: install-exec-am: install-info: install-info-recursive install-man: installcheck-am: maintainer-clean: maintainer-clean-recursive -rm -f $(am__CONFIG_DISTCLEAN_FILES) -rm -rf $(top_srcdir)/autom4te.cache -rm -f Makefile maintainer-clean-am: distclean-am maintainer-clean-generic mostlyclean: mostlyclean-recursive mostlyclean-am: mostlyclean-generic mostlyclean-libtool pdf: pdf-recursive pdf-am: ps: ps-recursive ps-am: uninstall-am: uninstall-info-am uninstall-info: uninstall-info-recursive .PHONY: $(RECURSIVE_TARGETS) CTAGS GTAGS all all-am am--refresh check \ check-am clean clean-generic clean-libtool clean-recursive \ ctags ctags-recursive dist dist-all dist-bzip2 dist-gzip \ dist-shar dist-tarZ dist-zip distcheck distclean \ distclean-generic distclean-hdr distclean-libtool \ distclean-recursive distclean-tags distcleancheck distdir \ distuninstallcheck dvi dvi-am html html-am info info-am \ install install-am install-data install-data-am install-exec \ install-exec-am install-info install-info-am install-man \ install-strip installcheck installcheck-am installdirs \ installdirs-am maintainer-clean maintainer-clean-generic \ maintainer-clean-recursive mostlyclean mostlyclean-generic \ mostlyclean-libtool mostlyclean-recursive pdf pdf-am ps ps-am \ tags tags-recursive uninstall uninstall-am uninstall-info-am # Tell versions [3.59,3.63) of GNU make to not export all variables. # Otherwise a system limit (for SysV at least) may be exceeded. .NOEXPORT: libtranslate-0.99/config.h.in000644 001750 001750 00000004354 10172770262 017732 0ustar00jylefortjylefort000000 000000 /* config.h.in. Generated from configure.ac by autoheader. */ /* always defined to indicate that i18n is enabled */ #undef ENABLE_NLS /* Define to the gettext package name */ #undef GETTEXT_PACKAGE /* Define to 1 if you have the `bind_textdomain_codeset' function. */ #undef HAVE_BIND_TEXTDOMAIN_CODESET /* Define to 1 if you have the `dcgettext' function. */ #undef HAVE_DCGETTEXT /* Define to 1 if you have the header file. */ #undef HAVE_DLFCN_H /* Define if the GNU gettext() function is already present or preinstalled. */ #undef HAVE_GETTEXT /* Define to 1 if you have the header file. */ #undef HAVE_INTTYPES_H /* Define if your file defines LC_MESSAGES. */ #undef HAVE_LC_MESSAGES /* Define to 1 if you have the header file. */ #undef HAVE_LOCALE_H /* Define to 1 if you have the header file. */ #undef HAVE_MEMORY_H /* Define to 1 if you have the header file. */ #undef HAVE_STDINT_H /* Define to 1 if you have the header file. */ #undef HAVE_STDLIB_H /* Define to 1 if you have the header file. */ #undef HAVE_STRINGS_H /* Define to 1 if you have the header file. */ #undef HAVE_STRING_H /* Define to 1 if you have the header file. */ #undef HAVE_SYS_STAT_H /* Define to 1 if you have the header file. */ #undef HAVE_SYS_TYPES_H /* Define to 1 if you have the header file. */ #undef HAVE_UNISTD_H /* Define the location where the catalogs will be installed */ #undef LOCALEDIR /* Name of package */ #undef PACKAGE /* Define to the address where bug reports for this package should be sent. */ #undef PACKAGE_BUGREPORT /* Define to the full name of this package. */ #undef PACKAGE_NAME /* Define to the full name and version of this package. */ #undef PACKAGE_STRING /* Define to the one symbol short name of this package. */ #undef PACKAGE_TARNAME /* Define to the version of this package. */ #undef PACKAGE_VERSION /* Define to 1 if you have the ANSI C header files. */ #undef STDC_HEADERS /* Version number of package */ #undef VERSION /* Number of bits in a file offset, on hosts where this is settable. */ #undef _FILE_OFFSET_BITS /* Define for large files, on AIX-style hosts. */ #undef _LARGE_FILES libtranslate-0.99/configure000755 001750 001750 00002713107 10176430630 017617 0ustar00jylefortjylefort000000 000000 #! /bin/sh # Guess values for system-dependent variables and create Makefiles. # Generated by GNU Autoconf 2.59 for libtranslate 0.99. # # Report bugs to . # # Copyright (C) 2003 Free Software Foundation, Inc. # This configure script is free software; the Free Software Foundation # gives unlimited permission to copy, distribute and modify it. ## --------------------- ## ## M4sh Initialization. ## ## --------------------- ## # Be Bourne compatible if test -n "${ZSH_VERSION+set}" && (emulate sh) >/dev/null 2>&1; then emulate sh NULLCMD=: # Zsh 3.x and 4.x performs word splitting on ${1+"$@"}, which # is contrary to our usage. Disable this feature. alias -g '${1+"$@"}'='"$@"' elif test -n "${BASH_VERSION+set}" && (set -o posix) >/dev/null 2>&1; then set -o posix fi DUALCASE=1; export DUALCASE # for MKS sh # Support unset when possible. if ( (MAIL=60; unset MAIL) || exit) >/dev/null 2>&1; then as_unset=unset else as_unset=false fi # Work around bugs in pre-3.0 UWIN ksh. $as_unset ENV MAIL MAILPATH PS1='$ ' PS2='> ' PS4='+ ' # NLS nuisances. for as_var in \ LANG LANGUAGE LC_ADDRESS LC_ALL LC_COLLATE LC_CTYPE LC_IDENTIFICATION \ LC_MEASUREMENT LC_MESSAGES LC_MONETARY LC_NAME LC_NUMERIC LC_PAPER \ LC_TELEPHONE LC_TIME do if (set +x; test -z "`(eval $as_var=C; export $as_var) 2>&1`"); then eval $as_var=C; export $as_var else $as_unset $as_var fi done # Required to use basename. if expr a : '\(a\)' >/dev/null 2>&1; then as_expr=expr else as_expr=false fi if (basename /) >/dev/null 2>&1 && test "X`basename / 2>&1`" = "X/"; then as_basename=basename else as_basename=false fi # Name of the executable. as_me=`$as_basename "$0" || $as_expr X/"$0" : '.*/\([^/][^/]*\)/*$' \| \ X"$0" : 'X\(//\)$' \| \ X"$0" : 'X\(/\)$' \| \ . : '\(.\)' 2>/dev/null || echo X/"$0" | sed '/^.*\/\([^/][^/]*\)\/*$/{ s//\1/; q; } /^X\/\(\/\/\)$/{ s//\1/; q; } /^X\/\(\/\).*/{ s//\1/; q; } s/.*/./; q'` # PATH needs CR, and LINENO needs CR and PATH. # Avoid depending upon Character Ranges. as_cr_letters='abcdefghijklmnopqrstuvwxyz' as_cr_LETTERS='ABCDEFGHIJKLMNOPQRSTUVWXYZ' as_cr_Letters=$as_cr_letters$as_cr_LETTERS as_cr_digits='0123456789' as_cr_alnum=$as_cr_Letters$as_cr_digits # The user is always right. if test "${PATH_SEPARATOR+set}" != set; then echo "#! /bin/sh" >conf$$.sh echo "exit 0" >>conf$$.sh chmod +x conf$$.sh if (PATH="/nonexistent;."; conf$$.sh) >/dev/null 2>&1; then PATH_SEPARATOR=';' else PATH_SEPARATOR=: fi rm -f conf$$.sh fi as_lineno_1=$LINENO as_lineno_2=$LINENO as_lineno_3=`(expr $as_lineno_1 + 1) 2>/dev/null` test "x$as_lineno_1" != "x$as_lineno_2" && test "x$as_lineno_3" = "x$as_lineno_2" || { # Find who we are. Look in the path if we contain no path at all # relative or not. case $0 in *[\\/]* ) as_myself=$0 ;; *) as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. test -r "$as_dir/$0" && as_myself=$as_dir/$0 && break done ;; esac # We did not find ourselves, most probably we were run as `sh COMMAND' # in which case we are not to be found in the path. if test "x$as_myself" = x; then as_myself=$0 fi if test ! -f "$as_myself"; then { echo "$as_me: error: cannot find myself; rerun with an absolute path" >&2 { (exit 1); exit 1; }; } fi case $CONFIG_SHELL in '') as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in /bin$PATH_SEPARATOR/usr/bin$PATH_SEPARATOR$PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for as_base in sh bash ksh sh5; do case $as_dir in /*) if ("$as_dir/$as_base" -c ' as_lineno_1=$LINENO as_lineno_2=$LINENO as_lineno_3=`(expr $as_lineno_1 + 1) 2>/dev/null` test "x$as_lineno_1" != "x$as_lineno_2" && test "x$as_lineno_3" = "x$as_lineno_2" ') 2>/dev/null; then $as_unset BASH_ENV || test "${BASH_ENV+set}" != set || { BASH_ENV=; export BASH_ENV; } $as_unset ENV || test "${ENV+set}" != set || { ENV=; export ENV; } CONFIG_SHELL=$as_dir/$as_base export CONFIG_SHELL exec "$CONFIG_SHELL" "$0" ${1+"$@"} fi;; esac done done ;; esac # Create $as_me.lineno as a copy of $as_myself, but with $LINENO # uniformly replaced by the line number. The first 'sed' inserts a # line-number line before each line; the second 'sed' does the real # work. The second script uses 'N' to pair each line-number line # with the numbered line, and appends trailing '-' during # substitution so that $LINENO is not a special case at line end. # (Raja R Harinath suggested sed '=', and Paul Eggert wrote the # second 'sed' script. Blame Lee E. McMahon for sed's syntax. :-) sed '=' <$as_myself | sed ' N s,$,-, : loop s,^\(['$as_cr_digits']*\)\(.*\)[$]LINENO\([^'$as_cr_alnum'_]\),\1\2\1\3, t loop s,-$,, s,^['$as_cr_digits']*\n,, ' >$as_me.lineno && chmod +x $as_me.lineno || { echo "$as_me: error: cannot create $as_me.lineno; rerun with a POSIX shell" >&2 { (exit 1); exit 1; }; } # Don't try to exec as it changes $[0], causing all sort of problems # (the dirname of $[0] is not the place where we might find the # original and so on. Autoconf is especially sensible to this). . ./$as_me.lineno # Exit status is that of the last command. exit } case `echo "testing\c"; echo 1,2,3`,`echo -n testing; echo 1,2,3` in *c*,-n*) ECHO_N= ECHO_C=' ' ECHO_T=' ' ;; *c*,* ) ECHO_N=-n ECHO_C= ECHO_T= ;; *) ECHO_N= ECHO_C='\c' ECHO_T= ;; esac if expr a : '\(a\)' >/dev/null 2>&1; then as_expr=expr else as_expr=false fi rm -f conf$$ conf$$.exe conf$$.file echo >conf$$.file if ln -s conf$$.file conf$$ 2>/dev/null; then # We could just check for DJGPP; but this test a) works b) is more generic # and c) will remain valid once DJGPP supports symlinks (DJGPP 2.04). if test -f conf$$.exe; then # Don't use ln at all; we don't have any links as_ln_s='cp -p' else as_ln_s='ln -s' fi elif ln conf$$.file conf$$ 2>/dev/null; then as_ln_s=ln else as_ln_s='cp -p' fi rm -f conf$$ conf$$.exe conf$$.file if mkdir -p . 2>/dev/null; then as_mkdir_p=: else test -d ./-p && rmdir ./-p as_mkdir_p=false fi as_executable_p="test -f" # Sed expression to map a string onto a valid CPP name. as_tr_cpp="eval sed 'y%*$as_cr_letters%P$as_cr_LETTERS%;s%[^_$as_cr_alnum]%_%g'" # Sed expression to map a string onto a valid variable name. as_tr_sh="eval sed 'y%*+%pp%;s%[^_$as_cr_alnum]%_%g'" # IFS # We need space, tab and new line, in precisely that order. as_nl=' ' IFS=" $as_nl" # CDPATH. $as_unset CDPATH # Check that we are running under the correct shell. SHELL=${CONFIG_SHELL-/bin/sh} case X$ECHO in X*--fallback-echo) # Remove one level of quotation (which was required for Make). ECHO=`echo "$ECHO" | sed 's,\\\\\$\\$0,'$0','` ;; esac echo=${ECHO-echo} if test "X$1" = X--no-reexec; then # Discard the --no-reexec flag, and continue. shift elif test "X$1" = X--fallback-echo; then # Avoid inline document here, it may be left over : elif test "X`($echo '\t') 2>/dev/null`" = 'X\t' ; then # Yippee, $echo works! : else # Restart under the correct shell. exec $SHELL "$0" --no-reexec ${1+"$@"} fi if test "X$1" = X--fallback-echo; then # used as fallback echo shift cat </dev/null 2>&1 && unset CDPATH if test -z "$ECHO"; then if test "X${echo_test_string+set}" != Xset; then # find a string as large as possible, as long as the shell can cope with it for cmd in 'sed 50q "$0"' 'sed 20q "$0"' 'sed 10q "$0"' 'sed 2q "$0"' 'echo test'; do # expected sizes: less than 2Kb, 1Kb, 512 bytes, 16 bytes, ... if (echo_test_string="`eval $cmd`") 2>/dev/null && echo_test_string="`eval $cmd`" && (test "X$echo_test_string" = "X$echo_test_string") 2>/dev/null then break fi done fi if test "X`($echo '\t') 2>/dev/null`" = 'X\t' && echo_testing_string=`($echo "$echo_test_string") 2>/dev/null` && test "X$echo_testing_string" = "X$echo_test_string"; then : else # The Solaris, AIX, and Digital Unix default echo programs unquote # backslashes. This makes it impossible to quote backslashes using # echo "$something" | sed 's/\\/\\\\/g' # # So, first we look for a working echo in the user's PATH. lt_save_ifs="$IFS"; IFS=$PATH_SEPARATOR for dir in $PATH /usr/ucb; do IFS="$lt_save_ifs" if (test -f $dir/echo || test -f $dir/echo$ac_exeext) && test "X`($dir/echo '\t') 2>/dev/null`" = 'X\t' && echo_testing_string=`($dir/echo "$echo_test_string") 2>/dev/null` && test "X$echo_testing_string" = "X$echo_test_string"; then echo="$dir/echo" break fi done IFS="$lt_save_ifs" if test "X$echo" = Xecho; then # We didn't find a better echo, so look for alternatives. if test "X`(print -r '\t') 2>/dev/null`" = 'X\t' && echo_testing_string=`(print -r "$echo_test_string") 2>/dev/null` && test "X$echo_testing_string" = "X$echo_test_string"; then # This shell has a builtin print -r that does the trick. echo='print -r' elif (test -f /bin/ksh || test -f /bin/ksh$ac_exeext) && test "X$CONFIG_SHELL" != X/bin/ksh; then # If we have ksh, try running configure again with it. ORIGINAL_CONFIG_SHELL=${CONFIG_SHELL-/bin/sh} export ORIGINAL_CONFIG_SHELL CONFIG_SHELL=/bin/ksh export CONFIG_SHELL exec $CONFIG_SHELL "$0" --no-reexec ${1+"$@"} else # Try using printf. echo='printf %s\n' if test "X`($echo '\t') 2>/dev/null`" = 'X\t' && echo_testing_string=`($echo "$echo_test_string") 2>/dev/null` && test "X$echo_testing_string" = "X$echo_test_string"; then # Cool, printf works : elif echo_testing_string=`($ORIGINAL_CONFIG_SHELL "$0" --fallback-echo '\t') 2>/dev/null` && test "X$echo_testing_string" = 'X\t' && echo_testing_string=`($ORIGINAL_CONFIG_SHELL "$0" --fallback-echo "$echo_test_string") 2>/dev/null` && test "X$echo_testing_string" = "X$echo_test_string"; then CONFIG_SHELL=$ORIGINAL_CONFIG_SHELL export CONFIG_SHELL SHELL="$CONFIG_SHELL" export SHELL echo="$CONFIG_SHELL $0 --fallback-echo" elif echo_testing_string=`($CONFIG_SHELL "$0" --fallback-echo '\t') 2>/dev/null` && test "X$echo_testing_string" = 'X\t' && echo_testing_string=`($CONFIG_SHELL "$0" --fallback-echo "$echo_test_string") 2>/dev/null` && test "X$echo_testing_string" = "X$echo_test_string"; then echo="$CONFIG_SHELL $0 --fallback-echo" else # maybe with a smaller string... prev=: for cmd in 'echo test' 'sed 2q "$0"' 'sed 10q "$0"' 'sed 20q "$0"' 'sed 50q "$0"'; do if (test "X$echo_test_string" = "X`eval $cmd`") 2>/dev/null then break fi prev="$cmd" done if test "$prev" != 'sed 50q "$0"'; then echo_test_string=`eval $prev` export echo_test_string exec ${ORIGINAL_CONFIG_SHELL-${CONFIG_SHELL-/bin/sh}} "$0" ${1+"$@"} else # Oops. We lost completely, so just stick with echo. echo=echo fi fi fi fi fi fi # Copy echo and quote the copy suitably for passing to libtool from # the Makefile, instead of quoting the original, which is used later. ECHO=$echo if test "X$ECHO" = "X$CONFIG_SHELL $0 --fallback-echo"; then ECHO="$CONFIG_SHELL \\\$\$0 --fallback-echo" fi tagnames=${tagnames+${tagnames},}CXX tagnames=${tagnames+${tagnames},}F77 # Name of the host. # hostname on some systems (SVR3.2, Linux) returns a bogus exit status, # so uname gets run too. ac_hostname=`(hostname || uname -n) 2>/dev/null | sed 1q` exec 6>&1 # # Initializations. # ac_default_prefix=/usr/local ac_config_libobj_dir=. cross_compiling=no subdirs= MFLAGS= MAKEFLAGS= SHELL=${CONFIG_SHELL-/bin/sh} # Maximum number of lines to put in a shell here document. # This variable seems obsolete. It should probably be removed, and # only ac_max_sed_lines should be used. : ${ac_max_here_lines=38} # Identity of this package. PACKAGE_NAME='libtranslate' PACKAGE_TARNAME='libtranslate' PACKAGE_VERSION='0.99' PACKAGE_STRING='libtranslate 0.99' PACKAGE_BUGREPORT='jylefort@brutele.be' ac_unique_file="src/translate.h" # Factoring default headers for most tests. ac_includes_default="\ #include #if HAVE_SYS_TYPES_H # include #endif #if HAVE_SYS_STAT_H # include #endif #if STDC_HEADERS # include # include #else # if HAVE_STDLIB_H # include # endif #endif #if HAVE_STRING_H # if !STDC_HEADERS && HAVE_MEMORY_H # include # endif # include #endif #if HAVE_STRINGS_H # include #endif #if HAVE_INTTYPES_H # include #else # if HAVE_STDINT_H # include # endif #endif #if HAVE_UNISTD_H # include #endif" ac_subst_vars='SHELL PATH_SEPARATOR PACKAGE_NAME PACKAGE_TARNAME PACKAGE_VERSION PACKAGE_STRING PACKAGE_BUGREPORT exec_prefix prefix program_transform_name bindir sbindir libexecdir datadir sysconfdir sharedstatedir localstatedir libdir includedir oldincludedir infodir mandir build_alias host_alias target_alias DEFS ECHO_C ECHO_N ECHO_T LIBS WARN_CFLAGS INSTALL_PROGRAM INSTALL_SCRIPT INSTALL_DATA CYGPATH_W PACKAGE VERSION ACLOCAL AUTOCONF AUTOMAKE AUTOHEADER MAKEINFO install_sh STRIP ac_ct_STRIP INSTALL_STRIP_PROGRAM mkdir_p AWK SET_MAKE am__leading_dot AMTAR am__tar am__untar MAINTAINER_MODE_TRUE MAINTAINER_MODE_FALSE MAINT build build_cpu build_vendor build_os host host_cpu host_vendor host_os CC CFLAGS LDFLAGS CPPFLAGS ac_ct_CC EXEEXT OBJEXT DEPDIR am__include am__quote AMDEP_TRUE AMDEP_FALSE AMDEPBACKSLASH CCDEPMODE am__fastdepCC_TRUE am__fastdepCC_FALSE EGREP LN_S ECHO AR ac_ct_AR RANLIB ac_ct_RANLIB CPP CXX CXXFLAGS ac_ct_CXX CXXDEPMODE am__fastdepCXX_TRUE am__fastdepCXX_FALSE CXXCPP F77 FFLAGS ac_ct_F77 LIBTOOL GETTEXT_PACKAGE USE_NLS MSGFMT GMSGFMT XGETTEXT CATALOGS CATOBJEXT DATADIRNAME GMOFILES INSTOBJEXT INTLLIBS PO_IN_DATADIR_TRUE PO_IN_DATADIR_FALSE POFILES POSUB MKINSTALLDIRS INTLTOOL_DESKTOP_RULE INTLTOOL_DIRECTORY_RULE INTLTOOL_KEYS_RULE INTLTOOL_PROP_RULE INTLTOOL_OAF_RULE INTLTOOL_PONG_RULE INTLTOOL_SERVER_RULE INTLTOOL_SHEET_RULE INTLTOOL_SOUNDLIST_RULE INTLTOOL_UI_RULE INTLTOOL_XAM_RULE INTLTOOL_KBD_RULE INTLTOOL_XML_RULE INTLTOOL_XML_NOMERGE_RULE INTLTOOL_CAVES_RULE INTLTOOL_SCHEMAS_RULE INTLTOOL_THEME_RULE INTLTOOL_EXTRACT INTLTOOL_MERGE INTLTOOL_UPDATE INTLTOOL_PERL ICONV MSGMERGE PKG_CONFIG GLIB_CFLAGS GLIB_LIBS HTML_DIR ENABLE_GTK_DOC_TRUE ENABLE_GTK_DOC_FALSE GTK_DOC_USE_LIBTOOL_TRUE GTK_DOC_USE_LIBTOOL_FALSE SOUP_CFLAGS SOUP_LIBS LIBXML_CFLAGS LIBXML_LIBS TALKFILTERS_CFLAGS TALKFILTERS_LIBS WITH_GENERIC_TRUE WITH_GENERIC_FALSE WITH_TALKFILTERS_TRUE WITH_TALKFILTERS_FALSE WITH_REGRESSION_TESTS_TRUE WITH_REGRESSION_TESTS_FALSE LIBOBJS LTLIBOBJS' ac_subst_files='' # Initialize some variables set by options. ac_init_help= ac_init_version=false # The variables have the same names as the options, with # dashes changed to underlines. cache_file=/dev/null exec_prefix=NONE no_create= no_recursion= prefix=NONE program_prefix=NONE program_suffix=NONE program_transform_name=s,x,x, silent= site= srcdir= verbose= x_includes=NONE x_libraries=NONE # Installation directory options. # These are left unexpanded so users can "make install exec_prefix=/foo" # and all the variables that are supposed to be based on exec_prefix # by default will actually change. # Use braces instead of parens because sh, perl, etc. also accept them. bindir='${exec_prefix}/bin' sbindir='${exec_prefix}/sbin' libexecdir='${exec_prefix}/libexec' datadir='${prefix}/share' sysconfdir='${prefix}/etc' sharedstatedir='${prefix}/com' localstatedir='${prefix}/var' libdir='${exec_prefix}/lib' includedir='${prefix}/include' oldincludedir='/usr/include' infodir='${prefix}/info' mandir='${prefix}/man' ac_prev= for ac_option do # If the previous option needs an argument, assign it. if test -n "$ac_prev"; then eval "$ac_prev=\$ac_option" ac_prev= continue fi ac_optarg=`expr "x$ac_option" : 'x[^=]*=\(.*\)'` # Accept the important Cygnus configure options, so we can diagnose typos. case $ac_option in -bindir | --bindir | --bindi | --bind | --bin | --bi) ac_prev=bindir ;; -bindir=* | --bindir=* | --bindi=* | --bind=* | --bin=* | --bi=*) bindir=$ac_optarg ;; -build | --build | --buil | --bui | --bu) ac_prev=build_alias ;; -build=* | --build=* | --buil=* | --bui=* | --bu=*) build_alias=$ac_optarg ;; -cache-file | --cache-file | --cache-fil | --cache-fi \ | --cache-f | --cache- | --cache | --cach | --cac | --ca | --c) ac_prev=cache_file ;; -cache-file=* | --cache-file=* | --cache-fil=* | --cache-fi=* \ | --cache-f=* | --cache-=* | --cache=* | --cach=* | --cac=* | --ca=* | --c=*) cache_file=$ac_optarg ;; --config-cache | -C) cache_file=config.cache ;; -datadir | --datadir | --datadi | --datad | --data | --dat | --da) ac_prev=datadir ;; -datadir=* | --datadir=* | --datadi=* | --datad=* | --data=* | --dat=* \ | --da=*) datadir=$ac_optarg ;; -disable-* | --disable-*) ac_feature=`expr "x$ac_option" : 'x-*disable-\(.*\)'` # Reject names that are not valid shell variable names. expr "x$ac_feature" : ".*[^-_$as_cr_alnum]" >/dev/null && { echo "$as_me: error: invalid feature name: $ac_feature" >&2 { (exit 1); exit 1; }; } ac_feature=`echo $ac_feature | sed 's/-/_/g'` eval "enable_$ac_feature=no" ;; -enable-* | --enable-*) ac_feature=`expr "x$ac_option" : 'x-*enable-\([^=]*\)'` # Reject names that are not valid shell variable names. expr "x$ac_feature" : ".*[^-_$as_cr_alnum]" >/dev/null && { echo "$as_me: error: invalid feature name: $ac_feature" >&2 { (exit 1); exit 1; }; } ac_feature=`echo $ac_feature | sed 's/-/_/g'` case $ac_option in *=*) ac_optarg=`echo "$ac_optarg" | sed "s/'/'\\\\\\\\''/g"`;; *) ac_optarg=yes ;; esac eval "enable_$ac_feature='$ac_optarg'" ;; -exec-prefix | --exec_prefix | --exec-prefix | --exec-prefi \ | --exec-pref | --exec-pre | --exec-pr | --exec-p | --exec- \ | --exec | --exe | --ex) ac_prev=exec_prefix ;; -exec-prefix=* | --exec_prefix=* | --exec-prefix=* | --exec-prefi=* \ | --exec-pref=* | --exec-pre=* | --exec-pr=* | --exec-p=* | --exec-=* \ | --exec=* | --exe=* | --ex=*) exec_prefix=$ac_optarg ;; -gas | --gas | --ga | --g) # Obsolete; use --with-gas. with_gas=yes ;; -help | --help | --hel | --he | -h) ac_init_help=long ;; -help=r* | --help=r* | --hel=r* | --he=r* | -hr*) ac_init_help=recursive ;; -help=s* | --help=s* | --hel=s* | --he=s* | -hs*) ac_init_help=short ;; -host | --host | --hos | --ho) ac_prev=host_alias ;; -host=* | --host=* | --hos=* | --ho=*) host_alias=$ac_optarg ;; -includedir | --includedir | --includedi | --included | --include \ | --includ | --inclu | --incl | --inc) ac_prev=includedir ;; -includedir=* | --includedir=* | --includedi=* | --included=* | --include=* \ | --includ=* | --inclu=* | --incl=* | --inc=*) includedir=$ac_optarg ;; -infodir | --infodir | --infodi | --infod | --info | --inf) ac_prev=infodir ;; -infodir=* | --infodir=* | --infodi=* | --infod=* | --info=* | --inf=*) infodir=$ac_optarg ;; -libdir | --libdir | --libdi | --libd) ac_prev=libdir ;; -libdir=* | --libdir=* | --libdi=* | --libd=*) libdir=$ac_optarg ;; -libexecdir | --libexecdir | --libexecdi | --libexecd | --libexec \ | --libexe | --libex | --libe) ac_prev=libexecdir ;; -libexecdir=* | --libexecdir=* | --libexecdi=* | --libexecd=* | --libexec=* \ | --libexe=* | --libex=* | --libe=*) libexecdir=$ac_optarg ;; -localstatedir | --localstatedir | --localstatedi | --localstated \ | --localstate | --localstat | --localsta | --localst \ | --locals | --local | --loca | --loc | --lo) ac_prev=localstatedir ;; -localstatedir=* | --localstatedir=* | --localstatedi=* | --localstated=* \ | --localstate=* | --localstat=* | --localsta=* | --localst=* \ | --locals=* | --local=* | --loca=* | --loc=* | --lo=*) localstatedir=$ac_optarg ;; -mandir | --mandir | --mandi | --mand | --man | --ma | --m) ac_prev=mandir ;; -mandir=* | --mandir=* | --mandi=* | --mand=* | --man=* | --ma=* | --m=*) mandir=$ac_optarg ;; -nfp | --nfp | --nf) # Obsolete; use --without-fp. with_fp=no ;; -no-create | --no-create | --no-creat | --no-crea | --no-cre \ | --no-cr | --no-c | -n) no_create=yes ;; -no-recursion | --no-recursion | --no-recursio | --no-recursi \ | --no-recurs | --no-recur | --no-recu | --no-rec | --no-re | --no-r) no_recursion=yes ;; -oldincludedir | --oldincludedir | --oldincludedi | --oldincluded \ | --oldinclude | --oldinclud | --oldinclu | --oldincl | --oldinc \ | --oldin | --oldi | --old | --ol | --o) ac_prev=oldincludedir ;; -oldincludedir=* | --oldincludedir=* | --oldincludedi=* | --oldincluded=* \ | --oldinclude=* | --oldinclud=* | --oldinclu=* | --oldincl=* | --oldinc=* \ | --oldin=* | --oldi=* | --old=* | --ol=* | --o=*) oldincludedir=$ac_optarg ;; -prefix | --prefix | --prefi | --pref | --pre | --pr | --p) ac_prev=prefix ;; -prefix=* | --prefix=* | --prefi=* | --pref=* | --pre=* | --pr=* | --p=*) prefix=$ac_optarg ;; -program-prefix | --program-prefix | --program-prefi | --program-pref \ | --program-pre | --program-pr | --program-p) ac_prev=program_prefix ;; -program-prefix=* | --program-prefix=* | --program-prefi=* \ | --program-pref=* | --program-pre=* | --program-pr=* | --program-p=*) program_prefix=$ac_optarg ;; -program-suffix | --program-suffix | --program-suffi | --program-suff \ | --program-suf | --program-su | --program-s) ac_prev=program_suffix ;; -program-suffix=* | --program-suffix=* | --program-suffi=* \ | --program-suff=* | --program-suf=* | --program-su=* | --program-s=*) program_suffix=$ac_optarg ;; -program-transform-name | --program-transform-name \ | --program-transform-nam | --program-transform-na \ | --program-transform-n | --program-transform- \ | --program-transform | --program-transfor \ | --program-transfo | --program-transf \ | --program-trans | --program-tran \ | --progr-tra | --program-tr | --program-t) ac_prev=program_transform_name ;; -program-transform-name=* | --program-transform-name=* \ | --program-transform-nam=* | --program-transform-na=* \ | --program-transform-n=* | --program-transform-=* \ | --program-transform=* | --program-transfor=* \ | --program-transfo=* | --program-transf=* \ | --program-trans=* | --program-tran=* \ | --progr-tra=* | --program-tr=* | --program-t=*) program_transform_name=$ac_optarg ;; -q | -quiet | --quiet | --quie | --qui | --qu | --q \ | -silent | --silent | --silen | --sile | --sil) silent=yes ;; -sbindir | --sbindir | --sbindi | --sbind | --sbin | --sbi | --sb) ac_prev=sbindir ;; -sbindir=* | --sbindir=* | --sbindi=* | --sbind=* | --sbin=* \ | --sbi=* | --sb=*) sbindir=$ac_optarg ;; -sharedstatedir | --sharedstatedir | --sharedstatedi \ | --sharedstated | --sharedstate | --sharedstat | --sharedsta \ | --sharedst | --shareds | --shared | --share | --shar \ | --sha | --sh) ac_prev=sharedstatedir ;; -sharedstatedir=* | --sharedstatedir=* | --sharedstatedi=* \ | --sharedstated=* | --sharedstate=* | --sharedstat=* | --sharedsta=* \ | --sharedst=* | --shareds=* | --shared=* | --share=* | --shar=* \ | --sha=* | --sh=*) sharedstatedir=$ac_optarg ;; -site | --site | --sit) ac_prev=site ;; -site=* | --site=* | --sit=*) site=$ac_optarg ;; -srcdir | --srcdir | --srcdi | --srcd | --src | --sr) ac_prev=srcdir ;; -srcdir=* | --srcdir=* | --srcdi=* | --srcd=* | --src=* | --sr=*) srcdir=$ac_optarg ;; -sysconfdir | --sysconfdir | --sysconfdi | --sysconfd | --sysconf \ | --syscon | --sysco | --sysc | --sys | --sy) ac_prev=sysconfdir ;; -sysconfdir=* | --sysconfdir=* | --sysconfdi=* | --sysconfd=* | --sysconf=* \ | --syscon=* | --sysco=* | --sysc=* | --sys=* | --sy=*) sysconfdir=$ac_optarg ;; -target | --target | --targe | --targ | --tar | --ta | --t) ac_prev=target_alias ;; -target=* | --target=* | --targe=* | --targ=* | --tar=* | --ta=* | --t=*) target_alias=$ac_optarg ;; -v | -verbose | --verbose | --verbos | --verbo | --verb) verbose=yes ;; -version | --version | --versio | --versi | --vers | -V) ac_init_version=: ;; -with-* | --with-*) ac_package=`expr "x$ac_option" : 'x-*with-\([^=]*\)'` # Reject names that are not valid shell variable names. expr "x$ac_package" : ".*[^-_$as_cr_alnum]" >/dev/null && { echo "$as_me: error: invalid package name: $ac_package" >&2 { (exit 1); exit 1; }; } ac_package=`echo $ac_package| sed 's/-/_/g'` case $ac_option in *=*) ac_optarg=`echo "$ac_optarg" | sed "s/'/'\\\\\\\\''/g"`;; *) ac_optarg=yes ;; esac eval "with_$ac_package='$ac_optarg'" ;; -without-* | --without-*) ac_package=`expr "x$ac_option" : 'x-*without-\(.*\)'` # Reject names that are not valid shell variable names. expr "x$ac_package" : ".*[^-_$as_cr_alnum]" >/dev/null && { echo "$as_me: error: invalid package name: $ac_package" >&2 { (exit 1); exit 1; }; } ac_package=`echo $ac_package | sed 's/-/_/g'` eval "with_$ac_package=no" ;; --x) # Obsolete; use --with-x. with_x=yes ;; -x-includes | --x-includes | --x-include | --x-includ | --x-inclu \ | --x-incl | --x-inc | --x-in | --x-i) ac_prev=x_includes ;; -x-includes=* | --x-includes=* | --x-include=* | --x-includ=* | --x-inclu=* \ | --x-incl=* | --x-inc=* | --x-in=* | --x-i=*) x_includes=$ac_optarg ;; -x-libraries | --x-libraries | --x-librarie | --x-librari \ | --x-librar | --x-libra | --x-libr | --x-lib | --x-li | --x-l) ac_prev=x_libraries ;; -x-libraries=* | --x-libraries=* | --x-librarie=* | --x-librari=* \ | --x-librar=* | --x-libra=* | --x-libr=* | --x-lib=* | --x-li=* | --x-l=*) x_libraries=$ac_optarg ;; -*) { echo "$as_me: error: unrecognized option: $ac_option Try \`$0 --help' for more information." >&2 { (exit 1); exit 1; }; } ;; *=*) ac_envvar=`expr "x$ac_option" : 'x\([^=]*\)='` # Reject names that are not valid shell variable names. expr "x$ac_envvar" : ".*[^_$as_cr_alnum]" >/dev/null && { echo "$as_me: error: invalid variable name: $ac_envvar" >&2 { (exit 1); exit 1; }; } ac_optarg=`echo "$ac_optarg" | sed "s/'/'\\\\\\\\''/g"` eval "$ac_envvar='$ac_optarg'" export $ac_envvar ;; *) # FIXME: should be removed in autoconf 3.0. echo "$as_me: WARNING: you should use --build, --host, --target" >&2 expr "x$ac_option" : ".*[^-._$as_cr_alnum]" >/dev/null && echo "$as_me: WARNING: invalid host type: $ac_option" >&2 : ${build_alias=$ac_option} ${host_alias=$ac_option} ${target_alias=$ac_option} ;; esac done if test -n "$ac_prev"; then ac_option=--`echo $ac_prev | sed 's/_/-/g'` { echo "$as_me: error: missing argument to $ac_option" >&2 { (exit 1); exit 1; }; } fi # Be sure to have absolute paths. for ac_var in exec_prefix prefix do eval ac_val=$`echo $ac_var` case $ac_val in [\\/$]* | ?:[\\/]* | NONE | '' ) ;; *) { echo "$as_me: error: expected an absolute directory name for --$ac_var: $ac_val" >&2 { (exit 1); exit 1; }; };; esac done # Be sure to have absolute paths. for ac_var in bindir sbindir libexecdir datadir sysconfdir sharedstatedir \ localstatedir libdir includedir oldincludedir infodir mandir do eval ac_val=$`echo $ac_var` case $ac_val in [\\/$]* | ?:[\\/]* ) ;; *) { echo "$as_me: error: expected an absolute directory name for --$ac_var: $ac_val" >&2 { (exit 1); exit 1; }; };; esac done # There might be people who depend on the old broken behavior: `$host' # used to hold the argument of --host etc. # FIXME: To remove some day. build=$build_alias host=$host_alias target=$target_alias # FIXME: To remove some day. if test "x$host_alias" != x; then if test "x$build_alias" = x; then cross_compiling=maybe echo "$as_me: WARNING: If you wanted to set the --build type, don't use --host. If a cross compiler is detected then cross compile mode will be used." >&2 elif test "x$build_alias" != "x$host_alias"; then cross_compiling=yes fi fi ac_tool_prefix= test -n "$host_alias" && ac_tool_prefix=$host_alias- test "$silent" = yes && exec 6>/dev/null # Find the source files, if location was not specified. if test -z "$srcdir"; then ac_srcdir_defaulted=yes # Try the directory containing this script, then its parent. ac_confdir=`(dirname "$0") 2>/dev/null || $as_expr X"$0" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$0" : 'X\(//\)[^/]' \| \ X"$0" : 'X\(//\)$' \| \ X"$0" : 'X\(/\)' \| \ . : '\(.\)' 2>/dev/null || echo X"$0" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/; q; } /^X\(\/\/\)[^/].*/{ s//\1/; q; } /^X\(\/\/\)$/{ s//\1/; q; } /^X\(\/\).*/{ s//\1/; q; } s/.*/./; q'` srcdir=$ac_confdir if test ! -r $srcdir/$ac_unique_file; then srcdir=.. fi else ac_srcdir_defaulted=no fi if test ! -r $srcdir/$ac_unique_file; then if test "$ac_srcdir_defaulted" = yes; then { echo "$as_me: error: cannot find sources ($ac_unique_file) in $ac_confdir or .." >&2 { (exit 1); exit 1; }; } else { echo "$as_me: error: cannot find sources ($ac_unique_file) in $srcdir" >&2 { (exit 1); exit 1; }; } fi fi (cd $srcdir && test -r ./$ac_unique_file) 2>/dev/null || { echo "$as_me: error: sources are in $srcdir, but \`cd $srcdir' does not work" >&2 { (exit 1); exit 1; }; } srcdir=`echo "$srcdir" | sed 's%\([^\\/]\)[\\/]*$%\1%'` ac_env_build_alias_set=${build_alias+set} ac_env_build_alias_value=$build_alias ac_cv_env_build_alias_set=${build_alias+set} ac_cv_env_build_alias_value=$build_alias ac_env_host_alias_set=${host_alias+set} ac_env_host_alias_value=$host_alias ac_cv_env_host_alias_set=${host_alias+set} ac_cv_env_host_alias_value=$host_alias ac_env_target_alias_set=${target_alias+set} ac_env_target_alias_value=$target_alias ac_cv_env_target_alias_set=${target_alias+set} ac_cv_env_target_alias_value=$target_alias ac_env_CC_set=${CC+set} ac_env_CC_value=$CC ac_cv_env_CC_set=${CC+set} ac_cv_env_CC_value=$CC ac_env_CFLAGS_set=${CFLAGS+set} ac_env_CFLAGS_value=$CFLAGS ac_cv_env_CFLAGS_set=${CFLAGS+set} ac_cv_env_CFLAGS_value=$CFLAGS ac_env_LDFLAGS_set=${LDFLAGS+set} ac_env_LDFLAGS_value=$LDFLAGS ac_cv_env_LDFLAGS_set=${LDFLAGS+set} ac_cv_env_LDFLAGS_value=$LDFLAGS ac_env_CPPFLAGS_set=${CPPFLAGS+set} ac_env_CPPFLAGS_value=$CPPFLAGS ac_cv_env_CPPFLAGS_set=${CPPFLAGS+set} ac_cv_env_CPPFLAGS_value=$CPPFLAGS ac_env_CPP_set=${CPP+set} ac_env_CPP_value=$CPP ac_cv_env_CPP_set=${CPP+set} ac_cv_env_CPP_value=$CPP ac_env_CXX_set=${CXX+set} ac_env_CXX_value=$CXX ac_cv_env_CXX_set=${CXX+set} ac_cv_env_CXX_value=$CXX ac_env_CXXFLAGS_set=${CXXFLAGS+set} ac_env_CXXFLAGS_value=$CXXFLAGS ac_cv_env_CXXFLAGS_set=${CXXFLAGS+set} ac_cv_env_CXXFLAGS_value=$CXXFLAGS ac_env_CXXCPP_set=${CXXCPP+set} ac_env_CXXCPP_value=$CXXCPP ac_cv_env_CXXCPP_set=${CXXCPP+set} ac_cv_env_CXXCPP_value=$CXXCPP ac_env_F77_set=${F77+set} ac_env_F77_value=$F77 ac_cv_env_F77_set=${F77+set} ac_cv_env_F77_value=$F77 ac_env_FFLAGS_set=${FFLAGS+set} ac_env_FFLAGS_value=$FFLAGS ac_cv_env_FFLAGS_set=${FFLAGS+set} ac_cv_env_FFLAGS_value=$FFLAGS # # Report the --help message. # if test "$ac_init_help" = "long"; then # Omit some internal or obsolete options to make the list less imposing. # This message is too long to be a string in the A/UX 3.1 sh. cat <<_ACEOF \`configure' configures libtranslate 0.99 to adapt to many kinds of systems. Usage: $0 [OPTION]... [VAR=VALUE]... To assign environment variables (e.g., CC, CFLAGS...), specify them as VAR=VALUE. See below for descriptions of some of the useful variables. Defaults for the options are specified in brackets. Configuration: -h, --help display this help and exit --help=short display options specific to this package --help=recursive display the short help of all the included packages -V, --version display version information and exit -q, --quiet, --silent do not print \`checking...' messages --cache-file=FILE cache test results in FILE [disabled] -C, --config-cache alias for \`--cache-file=config.cache' -n, --no-create do not create output files --srcdir=DIR find the sources in DIR [configure dir or \`..'] _ACEOF cat <<_ACEOF Installation directories: --prefix=PREFIX install architecture-independent files in PREFIX [$ac_default_prefix] --exec-prefix=EPREFIX install architecture-dependent files in EPREFIX [PREFIX] By default, \`make install' will install all the files in \`$ac_default_prefix/bin', \`$ac_default_prefix/lib' etc. You can specify an installation prefix other than \`$ac_default_prefix' using \`--prefix', for instance \`--prefix=\$HOME'. For better control, use the options below. Fine tuning of the installation directories: --bindir=DIR user executables [EPREFIX/bin] --sbindir=DIR system admin executables [EPREFIX/sbin] --libexecdir=DIR program executables [EPREFIX/libexec] --datadir=DIR read-only architecture-independent data [PREFIX/share] --sysconfdir=DIR read-only single-machine data [PREFIX/etc] --sharedstatedir=DIR modifiable architecture-independent data [PREFIX/com] --localstatedir=DIR modifiable single-machine data [PREFIX/var] --libdir=DIR object code libraries [EPREFIX/lib] --includedir=DIR C header files [PREFIX/include] --oldincludedir=DIR C header files for non-gcc [/usr/include] --infodir=DIR info documentation [PREFIX/info] --mandir=DIR man documentation [PREFIX/man] _ACEOF cat <<\_ACEOF Program names: --program-prefix=PREFIX prepend PREFIX to installed program names --program-suffix=SUFFIX append SUFFIX to installed program names --program-transform-name=PROGRAM run sed PROGRAM on installed program names System types: --build=BUILD configure for building on BUILD [guessed] --host=HOST cross-compile to build programs to run on HOST [BUILD] _ACEOF fi if test -n "$ac_init_help"; then case $ac_init_help in short | recursive ) echo "Configuration of libtranslate 0.99:";; esac cat <<\_ACEOF Optional Features: --disable-FEATURE do not include FEATURE (same as --enable-FEATURE=no) --enable-FEATURE[=ARG] include FEATURE [ARG=yes] --disable-generic do not build the generic module --disable-talkfilters do not build the talkfilters module --enable-compile-warnings=no|yes|error enable compiler warnings [no] --enable-regression-tests build and run regression tests --enable-maintainer-mode enable make rules and dependencies not useful (and sometimes confusing) to the casual installer --enable-shared[=PKGS] build shared libraries [default=yes] --enable-static[=PKGS] build static libraries [default=yes] --enable-fast-install[=PKGS] optimize for fast installation [default=yes] --disable-dependency-tracking speeds up one-time build --enable-dependency-tracking do not reject slow dependency extractors --disable-libtool-lock avoid locking (might break parallel builds) --disable-largefile omit support for large files --enable-gtk-doc use gtk-doc to build documentation default=no Optional Packages: --with-PACKAGE[=ARG] use PACKAGE [ARG=yes] --without-PACKAGE do not use PACKAGE (same as --with-PACKAGE=no) --with-gnu-ld assume the C compiler uses GNU ld [default=no] --with-pic try to use only PIC/non-PIC objects [default=use both] --with-tags[=TAGS] include additional configurations [automatic] --with-html-dir=PATH path to installed docs Some influential environment variables: CC C compiler command CFLAGS C compiler flags LDFLAGS linker flags, e.g. -L if you have libraries in a nonstandard directory CPPFLAGS C/C++ preprocessor flags, e.g. -I if you have headers in a nonstandard directory CPP C preprocessor CXX C++ compiler command CXXFLAGS C++ compiler flags CXXCPP C++ preprocessor F77 Fortran 77 compiler command FFLAGS Fortran 77 compiler flags Use these variables to override the choices made by `configure' or to help it to find libraries and programs with nonstandard names/locations. Report bugs to . _ACEOF fi if test "$ac_init_help" = "recursive"; then # If there are subdirs, report their specific --help. ac_popdir=`pwd` for ac_dir in : $ac_subdirs_all; do test "x$ac_dir" = x: && continue test -d $ac_dir || continue ac_builddir=. if test "$ac_dir" != .; then ac_dir_suffix=/`echo "$ac_dir" | sed 's,^\.[\\/],,'` # A "../" for each directory in $ac_dir_suffix. ac_top_builddir=`echo "$ac_dir_suffix" | sed 's,/[^\\/]*,../,g'` else ac_dir_suffix= ac_top_builddir= fi case $srcdir in .) # No --srcdir option. We are building in place. ac_srcdir=. if test -z "$ac_top_builddir"; then ac_top_srcdir=. else ac_top_srcdir=`echo $ac_top_builddir | sed 's,/$,,'` fi ;; [\\/]* | ?:[\\/]* ) # Absolute path. ac_srcdir=$srcdir$ac_dir_suffix; ac_top_srcdir=$srcdir ;; *) # Relative path. ac_srcdir=$ac_top_builddir$srcdir$ac_dir_suffix ac_top_srcdir=$ac_top_builddir$srcdir ;; esac # Do not use `cd foo && pwd` to compute absolute paths, because # the directories may not exist. case `pwd` in .) ac_abs_builddir="$ac_dir";; *) case "$ac_dir" in .) ac_abs_builddir=`pwd`;; [\\/]* | ?:[\\/]* ) ac_abs_builddir="$ac_dir";; *) ac_abs_builddir=`pwd`/"$ac_dir";; esac;; esac case $ac_abs_builddir in .) ac_abs_top_builddir=${ac_top_builddir}.;; *) case ${ac_top_builddir}. in .) ac_abs_top_builddir=$ac_abs_builddir;; [\\/]* | ?:[\\/]* ) ac_abs_top_builddir=${ac_top_builddir}.;; *) ac_abs_top_builddir=$ac_abs_builddir/${ac_top_builddir}.;; esac;; esac case $ac_abs_builddir in .) ac_abs_srcdir=$ac_srcdir;; *) case $ac_srcdir in .) ac_abs_srcdir=$ac_abs_builddir;; [\\/]* | ?:[\\/]* ) ac_abs_srcdir=$ac_srcdir;; *) ac_abs_srcdir=$ac_abs_builddir/$ac_srcdir;; esac;; esac case $ac_abs_builddir in .) ac_abs_top_srcdir=$ac_top_srcdir;; *) case $ac_top_srcdir in .) ac_abs_top_srcdir=$ac_abs_builddir;; [\\/]* | ?:[\\/]* ) ac_abs_top_srcdir=$ac_top_srcdir;; *) ac_abs_top_srcdir=$ac_abs_builddir/$ac_top_srcdir;; esac;; esac cd $ac_dir # Check for guested configure; otherwise get Cygnus style configure. if test -f $ac_srcdir/configure.gnu; then echo $SHELL $ac_srcdir/configure.gnu --help=recursive elif test -f $ac_srcdir/configure; then echo $SHELL $ac_srcdir/configure --help=recursive elif test -f $ac_srcdir/configure.ac || test -f $ac_srcdir/configure.in; then echo $ac_configure --help else echo "$as_me: WARNING: no configuration information is in $ac_dir" >&2 fi cd $ac_popdir done fi test -n "$ac_init_help" && exit 0 if $ac_init_version; then cat <<\_ACEOF libtranslate configure 0.99 generated by GNU Autoconf 2.59 Copyright (C) 2003 Free Software Foundation, Inc. This configure script is free software; the Free Software Foundation gives unlimited permission to copy, distribute and modify it. _ACEOF exit 0 fi exec 5>config.log cat >&5 <<_ACEOF This file contains any messages produced by compilers while running configure, to aid debugging if configure makes a mistake. It was created by libtranslate $as_me 0.99, which was generated by GNU Autoconf 2.59. Invocation command line was $ $0 $@ _ACEOF { cat <<_ASUNAME ## --------- ## ## Platform. ## ## --------- ## hostname = `(hostname || uname -n) 2>/dev/null | sed 1q` uname -m = `(uname -m) 2>/dev/null || echo unknown` uname -r = `(uname -r) 2>/dev/null || echo unknown` uname -s = `(uname -s) 2>/dev/null || echo unknown` uname -v = `(uname -v) 2>/dev/null || echo unknown` /usr/bin/uname -p = `(/usr/bin/uname -p) 2>/dev/null || echo unknown` /bin/uname -X = `(/bin/uname -X) 2>/dev/null || echo unknown` /bin/arch = `(/bin/arch) 2>/dev/null || echo unknown` /usr/bin/arch -k = `(/usr/bin/arch -k) 2>/dev/null || echo unknown` /usr/convex/getsysinfo = `(/usr/convex/getsysinfo) 2>/dev/null || echo unknown` hostinfo = `(hostinfo) 2>/dev/null || echo unknown` /bin/machine = `(/bin/machine) 2>/dev/null || echo unknown` /usr/bin/oslevel = `(/usr/bin/oslevel) 2>/dev/null || echo unknown` /bin/universe = `(/bin/universe) 2>/dev/null || echo unknown` _ASUNAME as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. echo "PATH: $as_dir" done } >&5 cat >&5 <<_ACEOF ## ----------- ## ## Core tests. ## ## ----------- ## _ACEOF # Keep a trace of the command line. # Strip out --no-create and --no-recursion so they do not pile up. # Strip out --silent because we don't want to record it for future runs. # Also quote any args containing shell meta-characters. # Make two passes to allow for proper duplicate-argument suppression. ac_configure_args= ac_configure_args0= ac_configure_args1= ac_sep= ac_must_keep_next=false for ac_pass in 1 2 do for ac_arg do case $ac_arg in -no-create | --no-c* | -n | -no-recursion | --no-r*) continue ;; -q | -quiet | --quiet | --quie | --qui | --qu | --q \ | -silent | --silent | --silen | --sile | --sil) continue ;; *" "*|*" "*|*[\[\]\~\#\$\^\&\*\(\)\{\}\\\|\;\<\>\?\"\']*) ac_arg=`echo "$ac_arg" | sed "s/'/'\\\\\\\\''/g"` ;; esac case $ac_pass in 1) ac_configure_args0="$ac_configure_args0 '$ac_arg'" ;; 2) ac_configure_args1="$ac_configure_args1 '$ac_arg'" if test $ac_must_keep_next = true; then ac_must_keep_next=false # Got value, back to normal. else case $ac_arg in *=* | --config-cache | -C | -disable-* | --disable-* \ | -enable-* | --enable-* | -gas | --g* | -nfp | --nf* \ | -q | -quiet | --q* | -silent | --sil* | -v | -verb* \ | -with-* | --with-* | -without-* | --without-* | --x) case "$ac_configure_args0 " in "$ac_configure_args1"*" '$ac_arg' "* ) continue ;; esac ;; -* ) ac_must_keep_next=true ;; esac fi ac_configure_args="$ac_configure_args$ac_sep'$ac_arg'" # Get rid of the leading space. ac_sep=" " ;; esac done done $as_unset ac_configure_args0 || test "${ac_configure_args0+set}" != set || { ac_configure_args0=; export ac_configure_args0; } $as_unset ac_configure_args1 || test "${ac_configure_args1+set}" != set || { ac_configure_args1=; export ac_configure_args1; } # When interrupted or exit'd, cleanup temporary files, and complete # config.log. We remove comments because anyway the quotes in there # would cause problems or look ugly. # WARNING: Be sure not to use single quotes in there, as some shells, # such as our DU 5.0 friend, will then `close' the trap. trap 'exit_status=$? # Save into config.log some information that might help in debugging. { echo cat <<\_ASBOX ## ---------------- ## ## Cache variables. ## ## ---------------- ## _ASBOX echo # The following way of writing the cache mishandles newlines in values, { (set) 2>&1 | case `(ac_space='"'"' '"'"'; set | grep ac_space) 2>&1` in *ac_space=\ *) sed -n \ "s/'"'"'/'"'"'\\\\'"'"''"'"'/g; s/^\\([_$as_cr_alnum]*_cv_[_$as_cr_alnum]*\\)=\\(.*\\)/\\1='"'"'\\2'"'"'/p" ;; *) sed -n \ "s/^\\([_$as_cr_alnum]*_cv_[_$as_cr_alnum]*\\)=\\(.*\\)/\\1=\\2/p" ;; esac; } echo cat <<\_ASBOX ## ----------------- ## ## Output variables. ## ## ----------------- ## _ASBOX echo for ac_var in $ac_subst_vars do eval ac_val=$`echo $ac_var` echo "$ac_var='"'"'$ac_val'"'"'" done | sort echo if test -n "$ac_subst_files"; then cat <<\_ASBOX ## ------------- ## ## Output files. ## ## ------------- ## _ASBOX echo for ac_var in $ac_subst_files do eval ac_val=$`echo $ac_var` echo "$ac_var='"'"'$ac_val'"'"'" done | sort echo fi if test -s confdefs.h; then cat <<\_ASBOX ## ----------- ## ## confdefs.h. ## ## ----------- ## _ASBOX echo sed "/^$/d" confdefs.h | sort echo fi test "$ac_signal" != 0 && echo "$as_me: caught signal $ac_signal" echo "$as_me: exit $exit_status" } >&5 rm -f core *.core && rm -rf conftest* confdefs* conf$$* $ac_clean_files && exit $exit_status ' 0 for ac_signal in 1 2 13 15; do trap 'ac_signal='$ac_signal'; { (exit 1); exit 1; }' $ac_signal done ac_signal=0 # confdefs.h avoids OS command line length limits that DEFS can exceed. rm -rf conftest* confdefs.h # AIX cpp loses on an empty file, so make sure it contains at least a newline. echo >confdefs.h # Predefined preprocessor variables. cat >>confdefs.h <<_ACEOF #define PACKAGE_NAME "$PACKAGE_NAME" _ACEOF cat >>confdefs.h <<_ACEOF #define PACKAGE_TARNAME "$PACKAGE_TARNAME" _ACEOF cat >>confdefs.h <<_ACEOF #define PACKAGE_VERSION "$PACKAGE_VERSION" _ACEOF cat >>confdefs.h <<_ACEOF #define PACKAGE_STRING "$PACKAGE_STRING" _ACEOF cat >>confdefs.h <<_ACEOF #define PACKAGE_BUGREPORT "$PACKAGE_BUGREPORT" _ACEOF # Let the site file select an alternate cache file if it wants to. # Prefer explicitly selected file to automatically selected ones. if test -z "$CONFIG_SITE"; then if test "x$prefix" != xNONE; then CONFIG_SITE="$prefix/share/config.site $prefix/etc/config.site" else CONFIG_SITE="$ac_default_prefix/share/config.site $ac_default_prefix/etc/config.site" fi fi for ac_site_file in $CONFIG_SITE; do if test -r "$ac_site_file"; then { echo "$as_me:$LINENO: loading site script $ac_site_file" >&5 echo "$as_me: loading site script $ac_site_file" >&6;} sed 's/^/| /' "$ac_site_file" >&5 . "$ac_site_file" fi done if test -r "$cache_file"; then # Some versions of bash will fail to source /dev/null (special # files actually), so we avoid doing that. if test -f "$cache_file"; then { echo "$as_me:$LINENO: loading cache $cache_file" >&5 echo "$as_me: loading cache $cache_file" >&6;} case $cache_file in [\\/]* | ?:[\\/]* ) . $cache_file;; *) . ./$cache_file;; esac fi else { echo "$as_me:$LINENO: creating cache $cache_file" >&5 echo "$as_me: creating cache $cache_file" >&6;} >$cache_file fi # Check that the precious variables saved in the cache have kept the same # value. ac_cache_corrupted=false for ac_var in `(set) 2>&1 | sed -n 's/^ac_env_\([a-zA-Z_0-9]*\)_set=.*/\1/p'`; do eval ac_old_set=\$ac_cv_env_${ac_var}_set eval ac_new_set=\$ac_env_${ac_var}_set eval ac_old_val="\$ac_cv_env_${ac_var}_value" eval ac_new_val="\$ac_env_${ac_var}_value" case $ac_old_set,$ac_new_set in set,) { echo "$as_me:$LINENO: error: \`$ac_var' was set to \`$ac_old_val' in the previous run" >&5 echo "$as_me: error: \`$ac_var' was set to \`$ac_old_val' in the previous run" >&2;} ac_cache_corrupted=: ;; ,set) { echo "$as_me:$LINENO: error: \`$ac_var' was not set in the previous run" >&5 echo "$as_me: error: \`$ac_var' was not set in the previous run" >&2;} ac_cache_corrupted=: ;; ,);; *) if test "x$ac_old_val" != "x$ac_new_val"; then { echo "$as_me:$LINENO: error: \`$ac_var' has changed since the previous run:" >&5 echo "$as_me: error: \`$ac_var' has changed since the previous run:" >&2;} { echo "$as_me:$LINENO: former value: $ac_old_val" >&5 echo "$as_me: former value: $ac_old_val" >&2;} { echo "$as_me:$LINENO: current value: $ac_new_val" >&5 echo "$as_me: current value: $ac_new_val" >&2;} ac_cache_corrupted=: fi;; esac # Pass precious variables to config.status. if test "$ac_new_set" = set; then case $ac_new_val in *" "*|*" "*|*[\[\]\~\#\$\^\&\*\(\)\{\}\\\|\;\<\>\?\"\']*) ac_arg=$ac_var=`echo "$ac_new_val" | sed "s/'/'\\\\\\\\''/g"` ;; *) ac_arg=$ac_var=$ac_new_val ;; esac case " $ac_configure_args " in *" '$ac_arg' "*) ;; # Avoid dups. Use of quotes ensures accuracy. *) ac_configure_args="$ac_configure_args '$ac_arg'" ;; esac fi done if $ac_cache_corrupted; then { echo "$as_me:$LINENO: error: changes in the environment can compromise the build" >&5 echo "$as_me: error: changes in the environment can compromise the build" >&2;} { { echo "$as_me:$LINENO: error: run \`make distclean' and/or \`rm $cache_file' and start over" >&5 echo "$as_me: error: run \`make distclean' and/or \`rm $cache_file' and start over" >&2;} { (exit 1); exit 1; }; } fi ac_ext=c ac_cpp='$CPP $CPPFLAGS' ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' ac_compiler_gnu=$ac_cv_c_compiler_gnu ### command line arguments # Check whether --enable-generic or --disable-generic was given. if test "${enable_generic+set}" = set; then enableval="$enable_generic" case "$enableval" in yes|no) enable_generic=$enableval ;; *) { { echo "$as_me:$LINENO: error: bad value $enableval for --enable-generic" >&5 echo "$as_me: error: bad value $enableval for --enable-generic" >&2;} { (exit 1); exit 1; }; } ;; esac else enable_generic=yes fi; # Check whether --enable-talkfilters or --disable-talkfilters was given. if test "${enable_talkfilters+set}" = set; then enableval="$enable_talkfilters" case "$enableval" in yes|no) enable_talkfilters=$enableval ;; *) { { echo "$as_me:$LINENO: error: bad value $enableval for --enable-talkfilters" >&5 echo "$as_me: error: bad value $enableval for --enable-talkfilters" >&2;} { (exit 1); exit 1; }; } ;; esac else enable_talkfilters=yes fi; # Check whether --enable-compile-warnings or --disable-compile-warnings was given. if test "${enable_compile_warnings+set}" = set; then enableval="$enable_compile_warnings" case "$enableval" in yes|no|error) enable_compile_warnings=$enableval ;; *) { { echo "$as_me:$LINENO: error: bad value $enableval for --enable-compile-warnings" >&5 echo "$as_me: error: bad value $enableval for --enable-compile-warnings" >&2;} { (exit 1); exit 1; }; } ;; esac else enable_compile_warnings=no fi; if test $enable_compile_warnings = no; then WARN_CFLAGS= else # some flags are specific to GCC WARN_CFLAGS="-Wall \ -Wformat-y2k \ -Wformat-security \ -Wno-unused-parameter \ -Wfloat-equal \ -Wdeclaration-after-statement \ -Wendif-labels \ -Wpointer-arith \ -Wcast-align \ -Waggregate-return \ -Wmissing-noreturn \ -Wmissing-format-attribute \ -Wpacked \ -Wredundant-decls \ -Wnested-externs \ -Winline" test $enable_compile_warnings = error && WARN_CFLAGS="$WARN_CFLAGS -Werror" fi # Check whether --enable-regression-tests or --disable-regression-tests was given. if test "${enable_regression_tests+set}" = set; then enableval="$enable_regression_tests" case "$enableval" in yes|no) enable_regression_tests=$enableval ;; *) { { echo "$as_me:$LINENO: error: bad value $enableval for --enable-regression-tests" >&5 echo "$as_me: error: bad value $enableval for --enable-regression-tests" >&2;} { (exit 1); exit 1; }; } ;; esac else enable_regression_tests=no fi; ### initialization am__api_version="1.9" ac_aux_dir= for ac_dir in $srcdir $srcdir/.. $srcdir/../..; do if test -f $ac_dir/install-sh; then ac_aux_dir=$ac_dir ac_install_sh="$ac_aux_dir/install-sh -c" break elif test -f $ac_dir/install.sh; then ac_aux_dir=$ac_dir ac_install_sh="$ac_aux_dir/install.sh -c" break elif test -f $ac_dir/shtool; then ac_aux_dir=$ac_dir ac_install_sh="$ac_aux_dir/shtool install -c" break fi done if test -z "$ac_aux_dir"; then { { echo "$as_me:$LINENO: error: cannot find install-sh or install.sh in $srcdir $srcdir/.. $srcdir/../.." >&5 echo "$as_me: error: cannot find install-sh or install.sh in $srcdir $srcdir/.. $srcdir/../.." >&2;} { (exit 1); exit 1; }; } fi ac_config_guess="$SHELL $ac_aux_dir/config.guess" ac_config_sub="$SHELL $ac_aux_dir/config.sub" ac_configure="$SHELL $ac_aux_dir/configure" # This should be Cygnus configure. # Find a good install program. We prefer a C program (faster), # so one script is as good as another. But avoid the broken or # incompatible versions: # SysV /etc/install, /usr/sbin/install # SunOS /usr/etc/install # IRIX /sbin/install # AIX /bin/install # AmigaOS /C/install, which installs bootblocks on floppy discs # AIX 4 /usr/bin/installbsd, which doesn't work without a -g flag # AFS /usr/afsws/bin/install, which mishandles nonexistent args # SVR4 /usr/ucb/install, which tries to use the nonexistent group "staff" # OS/2's system install, which has a completely different semantic # ./install, which can be erroneously created by make from ./install.sh. echo "$as_me:$LINENO: checking for a BSD-compatible install" >&5 echo $ECHO_N "checking for a BSD-compatible install... $ECHO_C" >&6 if test -z "$INSTALL"; then if test "${ac_cv_path_install+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. # Account for people who put trailing slashes in PATH elements. case $as_dir/ in ./ | .// | /cC/* | \ /etc/* | /usr/sbin/* | /usr/etc/* | /sbin/* | /usr/afsws/bin/* | \ ?:\\/os2\\/install\\/* | ?:\\/OS2\\/INSTALL\\/* | \ /usr/ucb/* ) ;; *) # OSF1 and SCO ODT 3.0 have their own names for install. # Don't use installbsd from OSF since it installs stuff as root # by default. for ac_prog in ginstall scoinst install; do for ac_exec_ext in '' $ac_executable_extensions; do if $as_executable_p "$as_dir/$ac_prog$ac_exec_ext"; then if test $ac_prog = install && grep dspmsg "$as_dir/$ac_prog$ac_exec_ext" >/dev/null 2>&1; then # AIX install. It has an incompatible calling convention. : elif test $ac_prog = install && grep pwplus "$as_dir/$ac_prog$ac_exec_ext" >/dev/null 2>&1; then # program-specific install script used by HP pwplus--don't use. : else ac_cv_path_install="$as_dir/$ac_prog$ac_exec_ext -c" break 3 fi fi done done ;; esac done fi if test "${ac_cv_path_install+set}" = set; then INSTALL=$ac_cv_path_install else # As a last resort, use the slow shell script. We don't cache a # path for INSTALL within a source directory, because that will # break other packages using the cache if that directory is # removed, or if the path is relative. INSTALL=$ac_install_sh fi fi echo "$as_me:$LINENO: result: $INSTALL" >&5 echo "${ECHO_T}$INSTALL" >&6 # Use test -z because SunOS4 sh mishandles braces in ${var-val}. # It thinks the first close brace ends the variable substitution. test -z "$INSTALL_PROGRAM" && INSTALL_PROGRAM='${INSTALL}' test -z "$INSTALL_SCRIPT" && INSTALL_SCRIPT='${INSTALL}' test -z "$INSTALL_DATA" && INSTALL_DATA='${INSTALL} -m 644' echo "$as_me:$LINENO: checking whether build environment is sane" >&5 echo $ECHO_N "checking whether build environment is sane... $ECHO_C" >&6 # Just in case sleep 1 echo timestamp > conftest.file # Do `set' in a subshell so we don't clobber the current shell's # arguments. Must try -L first in case configure is actually a # symlink; some systems play weird games with the mod time of symlinks # (eg FreeBSD returns the mod time of the symlink's containing # directory). if ( set X `ls -Lt $srcdir/configure conftest.file 2> /dev/null` if test "$*" = "X"; then # -L didn't work. set X `ls -t $srcdir/configure conftest.file` fi rm -f conftest.file if test "$*" != "X $srcdir/configure conftest.file" \ && test "$*" != "X conftest.file $srcdir/configure"; then # If neither matched, then we have a broken ls. This can happen # if, for instance, CONFIG_SHELL is bash and it inherits a # broken ls alias from the environment. This has actually # happened. Such a system could not be considered "sane". { { echo "$as_me:$LINENO: error: ls -t appears to fail. Make sure there is not a broken alias in your environment" >&5 echo "$as_me: error: ls -t appears to fail. Make sure there is not a broken alias in your environment" >&2;} { (exit 1); exit 1; }; } fi test "$2" = conftest.file ) then # Ok. : else { { echo "$as_me:$LINENO: error: newly created file is older than distributed files! Check your system clock" >&5 echo "$as_me: error: newly created file is older than distributed files! Check your system clock" >&2;} { (exit 1); exit 1; }; } fi echo "$as_me:$LINENO: result: yes" >&5 echo "${ECHO_T}yes" >&6 test "$program_prefix" != NONE && program_transform_name="s,^,$program_prefix,;$program_transform_name" # Use a double $ so make ignores it. test "$program_suffix" != NONE && program_transform_name="s,\$,$program_suffix,;$program_transform_name" # Double any \ or $. echo might interpret backslashes. # By default was `s,x,x', remove it if useless. cat <<\_ACEOF >conftest.sed s/[\\$]/&&/g;s/;s,x,x,$// _ACEOF program_transform_name=`echo $program_transform_name | sed -f conftest.sed` rm conftest.sed # expand $ac_aux_dir to an absolute path am_aux_dir=`cd $ac_aux_dir && pwd` test x"${MISSING+set}" = xset || MISSING="\${SHELL} $am_aux_dir/missing" # Use eval to expand $SHELL if eval "$MISSING --run true"; then am_missing_run="$MISSING --run " else am_missing_run= { echo "$as_me:$LINENO: WARNING: \`missing' script is too old or missing" >&5 echo "$as_me: WARNING: \`missing' script is too old or missing" >&2;} fi if mkdir -p --version . >/dev/null 2>&1 && test ! -d ./--version; then # We used to keeping the `.' as first argument, in order to # allow $(mkdir_p) to be used without argument. As in # $(mkdir_p) $(somedir) # where $(somedir) is conditionally defined. However this is wrong # for two reasons: # 1. if the package is installed by a user who cannot write `.' # make install will fail, # 2. the above comment should most certainly read # $(mkdir_p) $(DESTDIR)$(somedir) # so it does not work when $(somedir) is undefined and # $(DESTDIR) is not. # To support the latter case, we have to write # test -z "$(somedir)" || $(mkdir_p) $(DESTDIR)$(somedir), # so the `.' trick is pointless. mkdir_p='mkdir -p --' else # On NextStep and OpenStep, the `mkdir' command does not # recognize any option. It will interpret all options as # directories to create, and then abort because `.' already # exists. for d in ./-p ./--version; do test -d $d && rmdir $d done # $(mkinstalldirs) is defined by Automake if mkinstalldirs exists. if test -f "$ac_aux_dir/mkinstalldirs"; then mkdir_p='$(mkinstalldirs)' else mkdir_p='$(install_sh) -d' fi fi for ac_prog in gawk mawk nawk awk do # Extract the first word of "$ac_prog", so it can be a program name with args. set dummy $ac_prog; ac_word=$2 echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6 if test "${ac_cv_prog_AWK+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test -n "$AWK"; then ac_cv_prog_AWK="$AWK" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then ac_cv_prog_AWK="$ac_prog" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done fi fi AWK=$ac_cv_prog_AWK if test -n "$AWK"; then echo "$as_me:$LINENO: result: $AWK" >&5 echo "${ECHO_T}$AWK" >&6 else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 fi test -n "$AWK" && break done echo "$as_me:$LINENO: checking whether ${MAKE-make} sets \$(MAKE)" >&5 echo $ECHO_N "checking whether ${MAKE-make} sets \$(MAKE)... $ECHO_C" >&6 set dummy ${MAKE-make}; ac_make=`echo "$2" | sed 'y,:./+-,___p_,'` if eval "test \"\${ac_cv_prog_make_${ac_make}_set+set}\" = set"; then echo $ECHO_N "(cached) $ECHO_C" >&6 else cat >conftest.make <<\_ACEOF all: @echo 'ac_maketemp="$(MAKE)"' _ACEOF # GNU make sometimes prints "make[1]: Entering...", which would confuse us. eval `${MAKE-make} -f conftest.make 2>/dev/null | grep temp=` if test -n "$ac_maketemp"; then eval ac_cv_prog_make_${ac_make}_set=yes else eval ac_cv_prog_make_${ac_make}_set=no fi rm -f conftest.make fi if eval "test \"`echo '$ac_cv_prog_make_'${ac_make}_set`\" = yes"; then echo "$as_me:$LINENO: result: yes" >&5 echo "${ECHO_T}yes" >&6 SET_MAKE= else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 SET_MAKE="MAKE=${MAKE-make}" fi rm -rf .tst 2>/dev/null mkdir .tst 2>/dev/null if test -d .tst; then am__leading_dot=. else am__leading_dot=_ fi rmdir .tst 2>/dev/null # test to see if srcdir already configured if test "`cd $srcdir && pwd`" != "`pwd`" && test -f $srcdir/config.status; then { { echo "$as_me:$LINENO: error: source directory already configured; run \"make distclean\" there first" >&5 echo "$as_me: error: source directory already configured; run \"make distclean\" there first" >&2;} { (exit 1); exit 1; }; } fi # test whether we have cygpath if test -z "$CYGPATH_W"; then if (cygpath --version) >/dev/null 2>/dev/null; then CYGPATH_W='cygpath -w' else CYGPATH_W=echo fi fi # Define the identity of the package. PACKAGE='libtranslate' VERSION='0.99' cat >>confdefs.h <<_ACEOF #define PACKAGE "$PACKAGE" _ACEOF cat >>confdefs.h <<_ACEOF #define VERSION "$VERSION" _ACEOF # Some tools Automake needs. ACLOCAL=${ACLOCAL-"${am_missing_run}aclocal-${am__api_version}"} AUTOCONF=${AUTOCONF-"${am_missing_run}autoconf"} AUTOMAKE=${AUTOMAKE-"${am_missing_run}automake-${am__api_version}"} AUTOHEADER=${AUTOHEADER-"${am_missing_run}autoheader"} MAKEINFO=${MAKEINFO-"${am_missing_run}makeinfo"} install_sh=${install_sh-"$am_aux_dir/install-sh"} # Installed binaries are usually stripped using `strip' when the user # run `make install-strip'. However `strip' might not be the right # tool to use in cross-compilation environments, therefore Automake # will honor the `STRIP' environment variable to overrule this program. if test "$cross_compiling" != no; then if test -n "$ac_tool_prefix"; then # Extract the first word of "${ac_tool_prefix}strip", so it can be a program name with args. set dummy ${ac_tool_prefix}strip; ac_word=$2 echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6 if test "${ac_cv_prog_STRIP+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test -n "$STRIP"; then ac_cv_prog_STRIP="$STRIP" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then ac_cv_prog_STRIP="${ac_tool_prefix}strip" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done fi fi STRIP=$ac_cv_prog_STRIP if test -n "$STRIP"; then echo "$as_me:$LINENO: result: $STRIP" >&5 echo "${ECHO_T}$STRIP" >&6 else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 fi fi if test -z "$ac_cv_prog_STRIP"; then ac_ct_STRIP=$STRIP # Extract the first word of "strip", so it can be a program name with args. set dummy strip; ac_word=$2 echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6 if test "${ac_cv_prog_ac_ct_STRIP+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test -n "$ac_ct_STRIP"; then ac_cv_prog_ac_ct_STRIP="$ac_ct_STRIP" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then ac_cv_prog_ac_ct_STRIP="strip" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done test -z "$ac_cv_prog_ac_ct_STRIP" && ac_cv_prog_ac_ct_STRIP=":" fi fi ac_ct_STRIP=$ac_cv_prog_ac_ct_STRIP if test -n "$ac_ct_STRIP"; then echo "$as_me:$LINENO: result: $ac_ct_STRIP" >&5 echo "${ECHO_T}$ac_ct_STRIP" >&6 else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 fi STRIP=$ac_ct_STRIP else STRIP="$ac_cv_prog_STRIP" fi fi INSTALL_STRIP_PROGRAM="\${SHELL} \$(install_sh) -c -s" # We need awk for the "check" target. The system "awk" is bad on # some platforms. # Always define AMTAR for backward compatibility. AMTAR=${AMTAR-"${am_missing_run}tar"} am__tar='${AMTAR} chof - "$$tardir"'; am__untar='${AMTAR} xf -' echo "$as_me:$LINENO: checking whether to enable maintainer-specific portions of Makefiles" >&5 echo $ECHO_N "checking whether to enable maintainer-specific portions of Makefiles... $ECHO_C" >&6 # Check whether --enable-maintainer-mode or --disable-maintainer-mode was given. if test "${enable_maintainer_mode+set}" = set; then enableval="$enable_maintainer_mode" USE_MAINTAINER_MODE=$enableval else USE_MAINTAINER_MODE=no fi; echo "$as_me:$LINENO: result: $USE_MAINTAINER_MODE" >&5 echo "${ECHO_T}$USE_MAINTAINER_MODE" >&6 if test $USE_MAINTAINER_MODE = yes; then MAINTAINER_MODE_TRUE= MAINTAINER_MODE_FALSE='#' else MAINTAINER_MODE_TRUE='#' MAINTAINER_MODE_FALSE= fi MAINT=$MAINTAINER_MODE_TRUE ac_config_headers="$ac_config_headers config.h" # Check whether --enable-shared or --disable-shared was given. if test "${enable_shared+set}" = set; then enableval="$enable_shared" p=${PACKAGE-default} case $enableval in yes) enable_shared=yes ;; no) enable_shared=no ;; *) enable_shared=no # Look at the argument we got. We use all the common list separators. lt_save_ifs="$IFS"; IFS="${IFS}$PATH_SEPARATOR," for pkg in $enableval; do IFS="$lt_save_ifs" if test "X$pkg" = "X$p"; then enable_shared=yes fi done IFS="$lt_save_ifs" ;; esac else enable_shared=yes fi; # Check whether --enable-static or --disable-static was given. if test "${enable_static+set}" = set; then enableval="$enable_static" p=${PACKAGE-default} case $enableval in yes) enable_static=yes ;; no) enable_static=no ;; *) enable_static=no # Look at the argument we got. We use all the common list separators. lt_save_ifs="$IFS"; IFS="${IFS}$PATH_SEPARATOR," for pkg in $enableval; do IFS="$lt_save_ifs" if test "X$pkg" = "X$p"; then enable_static=yes fi done IFS="$lt_save_ifs" ;; esac else enable_static=yes fi; # Check whether --enable-fast-install or --disable-fast-install was given. if test "${enable_fast_install+set}" = set; then enableval="$enable_fast_install" p=${PACKAGE-default} case $enableval in yes) enable_fast_install=yes ;; no) enable_fast_install=no ;; *) enable_fast_install=no # Look at the argument we got. We use all the common list separators. lt_save_ifs="$IFS"; IFS="${IFS}$PATH_SEPARATOR," for pkg in $enableval; do IFS="$lt_save_ifs" if test "X$pkg" = "X$p"; then enable_fast_install=yes fi done IFS="$lt_save_ifs" ;; esac else enable_fast_install=yes fi; # Make sure we can run config.sub. $ac_config_sub sun4 >/dev/null 2>&1 || { { echo "$as_me:$LINENO: error: cannot run $ac_config_sub" >&5 echo "$as_me: error: cannot run $ac_config_sub" >&2;} { (exit 1); exit 1; }; } echo "$as_me:$LINENO: checking build system type" >&5 echo $ECHO_N "checking build system type... $ECHO_C" >&6 if test "${ac_cv_build+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else ac_cv_build_alias=$build_alias test -z "$ac_cv_build_alias" && ac_cv_build_alias=`$ac_config_guess` test -z "$ac_cv_build_alias" && { { echo "$as_me:$LINENO: error: cannot guess build type; you must specify one" >&5 echo "$as_me: error: cannot guess build type; you must specify one" >&2;} { (exit 1); exit 1; }; } ac_cv_build=`$ac_config_sub $ac_cv_build_alias` || { { echo "$as_me:$LINENO: error: $ac_config_sub $ac_cv_build_alias failed" >&5 echo "$as_me: error: $ac_config_sub $ac_cv_build_alias failed" >&2;} { (exit 1); exit 1; }; } fi echo "$as_me:$LINENO: result: $ac_cv_build" >&5 echo "${ECHO_T}$ac_cv_build" >&6 build=$ac_cv_build build_cpu=`echo $ac_cv_build | sed 's/^\([^-]*\)-\([^-]*\)-\(.*\)$/\1/'` build_vendor=`echo $ac_cv_build | sed 's/^\([^-]*\)-\([^-]*\)-\(.*\)$/\2/'` build_os=`echo $ac_cv_build | sed 's/^\([^-]*\)-\([^-]*\)-\(.*\)$/\3/'` echo "$as_me:$LINENO: checking host system type" >&5 echo $ECHO_N "checking host system type... $ECHO_C" >&6 if test "${ac_cv_host+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else ac_cv_host_alias=$host_alias test -z "$ac_cv_host_alias" && ac_cv_host_alias=$ac_cv_build_alias ac_cv_host=`$ac_config_sub $ac_cv_host_alias` || { { echo "$as_me:$LINENO: error: $ac_config_sub $ac_cv_host_alias failed" >&5 echo "$as_me: error: $ac_config_sub $ac_cv_host_alias failed" >&2;} { (exit 1); exit 1; }; } fi echo "$as_me:$LINENO: result: $ac_cv_host" >&5 echo "${ECHO_T}$ac_cv_host" >&6 host=$ac_cv_host host_cpu=`echo $ac_cv_host | sed 's/^\([^-]*\)-\([^-]*\)-\(.*\)$/\1/'` host_vendor=`echo $ac_cv_host | sed 's/^\([^-]*\)-\([^-]*\)-\(.*\)$/\2/'` host_os=`echo $ac_cv_host | sed 's/^\([^-]*\)-\([^-]*\)-\(.*\)$/\3/'` DEPDIR="${am__leading_dot}deps" ac_config_commands="$ac_config_commands depfiles" am_make=${MAKE-make} cat > confinc << 'END' am__doit: @echo done .PHONY: am__doit END # If we don't find an include directive, just comment out the code. echo "$as_me:$LINENO: checking for style of include used by $am_make" >&5 echo $ECHO_N "checking for style of include used by $am_make... $ECHO_C" >&6 am__include="#" am__quote= _am_result=none # First try GNU make style include. echo "include confinc" > confmf # We grep out `Entering directory' and `Leaving directory' # messages which can occur if `w' ends up in MAKEFLAGS. # In particular we don't look at `^make:' because GNU make might # be invoked under some other name (usually "gmake"), in which # case it prints its new name instead of `make'. if test "`$am_make -s -f confmf 2> /dev/null | grep -v 'ing directory'`" = "done"; then am__include=include am__quote= _am_result=GNU fi # Now try BSD make style include. if test "$am__include" = "#"; then echo '.include "confinc"' > confmf if test "`$am_make -s -f confmf 2> /dev/null`" = "done"; then am__include=.include am__quote="\"" _am_result=BSD fi fi echo "$as_me:$LINENO: result: $_am_result" >&5 echo "${ECHO_T}$_am_result" >&6 rm -f confinc confmf # Check whether --enable-dependency-tracking or --disable-dependency-tracking was given. if test "${enable_dependency_tracking+set}" = set; then enableval="$enable_dependency_tracking" fi; if test "x$enable_dependency_tracking" != xno; then am_depcomp="$ac_aux_dir/depcomp" AMDEPBACKSLASH='\' fi if test "x$enable_dependency_tracking" != xno; then AMDEP_TRUE= AMDEP_FALSE='#' else AMDEP_TRUE='#' AMDEP_FALSE= fi ac_ext=c ac_cpp='$CPP $CPPFLAGS' ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' ac_compiler_gnu=$ac_cv_c_compiler_gnu if test -n "$ac_tool_prefix"; then # Extract the first word of "${ac_tool_prefix}gcc", so it can be a program name with args. set dummy ${ac_tool_prefix}gcc; ac_word=$2 echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6 if test "${ac_cv_prog_CC+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test -n "$CC"; then ac_cv_prog_CC="$CC" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then ac_cv_prog_CC="${ac_tool_prefix}gcc" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done fi fi CC=$ac_cv_prog_CC if test -n "$CC"; then echo "$as_me:$LINENO: result: $CC" >&5 echo "${ECHO_T}$CC" >&6 else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 fi fi if test -z "$ac_cv_prog_CC"; then ac_ct_CC=$CC # Extract the first word of "gcc", so it can be a program name with args. set dummy gcc; ac_word=$2 echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6 if test "${ac_cv_prog_ac_ct_CC+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test -n "$ac_ct_CC"; then ac_cv_prog_ac_ct_CC="$ac_ct_CC" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then ac_cv_prog_ac_ct_CC="gcc" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done fi fi ac_ct_CC=$ac_cv_prog_ac_ct_CC if test -n "$ac_ct_CC"; then echo "$as_me:$LINENO: result: $ac_ct_CC" >&5 echo "${ECHO_T}$ac_ct_CC" >&6 else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 fi CC=$ac_ct_CC else CC="$ac_cv_prog_CC" fi if test -z "$CC"; then if test -n "$ac_tool_prefix"; then # Extract the first word of "${ac_tool_prefix}cc", so it can be a program name with args. set dummy ${ac_tool_prefix}cc; ac_word=$2 echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6 if test "${ac_cv_prog_CC+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test -n "$CC"; then ac_cv_prog_CC="$CC" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then ac_cv_prog_CC="${ac_tool_prefix}cc" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done fi fi CC=$ac_cv_prog_CC if test -n "$CC"; then echo "$as_me:$LINENO: result: $CC" >&5 echo "${ECHO_T}$CC" >&6 else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 fi fi if test -z "$ac_cv_prog_CC"; then ac_ct_CC=$CC # Extract the first word of "cc", so it can be a program name with args. set dummy cc; ac_word=$2 echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6 if test "${ac_cv_prog_ac_ct_CC+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test -n "$ac_ct_CC"; then ac_cv_prog_ac_ct_CC="$ac_ct_CC" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then ac_cv_prog_ac_ct_CC="cc" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done fi fi ac_ct_CC=$ac_cv_prog_ac_ct_CC if test -n "$ac_ct_CC"; then echo "$as_me:$LINENO: result: $ac_ct_CC" >&5 echo "${ECHO_T}$ac_ct_CC" >&6 else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 fi CC=$ac_ct_CC else CC="$ac_cv_prog_CC" fi fi if test -z "$CC"; then # Extract the first word of "cc", so it can be a program name with args. set dummy cc; ac_word=$2 echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6 if test "${ac_cv_prog_CC+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test -n "$CC"; then ac_cv_prog_CC="$CC" # Let the user override the test. else ac_prog_rejected=no as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then if test "$as_dir/$ac_word$ac_exec_ext" = "/usr/ucb/cc"; then ac_prog_rejected=yes continue fi ac_cv_prog_CC="cc" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done if test $ac_prog_rejected = yes; then # We found a bogon in the path, so make sure we never use it. set dummy $ac_cv_prog_CC shift if test $# != 0; then # We chose a different compiler from the bogus one. # However, it has the same basename, so the bogon will be chosen # first if we set CC to just the basename; use the full file name. shift ac_cv_prog_CC="$as_dir/$ac_word${1+' '}$@" fi fi fi fi CC=$ac_cv_prog_CC if test -n "$CC"; then echo "$as_me:$LINENO: result: $CC" >&5 echo "${ECHO_T}$CC" >&6 else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 fi fi if test -z "$CC"; then if test -n "$ac_tool_prefix"; then for ac_prog in cl do # Extract the first word of "$ac_tool_prefix$ac_prog", so it can be a program name with args. set dummy $ac_tool_prefix$ac_prog; ac_word=$2 echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6 if test "${ac_cv_prog_CC+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test -n "$CC"; then ac_cv_prog_CC="$CC" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then ac_cv_prog_CC="$ac_tool_prefix$ac_prog" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done fi fi CC=$ac_cv_prog_CC if test -n "$CC"; then echo "$as_me:$LINENO: result: $CC" >&5 echo "${ECHO_T}$CC" >&6 else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 fi test -n "$CC" && break done fi if test -z "$CC"; then ac_ct_CC=$CC for ac_prog in cl do # Extract the first word of "$ac_prog", so it can be a program name with args. set dummy $ac_prog; ac_word=$2 echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6 if test "${ac_cv_prog_ac_ct_CC+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test -n "$ac_ct_CC"; then ac_cv_prog_ac_ct_CC="$ac_ct_CC" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then ac_cv_prog_ac_ct_CC="$ac_prog" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done fi fi ac_ct_CC=$ac_cv_prog_ac_ct_CC if test -n "$ac_ct_CC"; then echo "$as_me:$LINENO: result: $ac_ct_CC" >&5 echo "${ECHO_T}$ac_ct_CC" >&6 else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 fi test -n "$ac_ct_CC" && break done CC=$ac_ct_CC fi fi test -z "$CC" && { { echo "$as_me:$LINENO: error: no acceptable C compiler found in \$PATH See \`config.log' for more details." >&5 echo "$as_me: error: no acceptable C compiler found in \$PATH See \`config.log' for more details." >&2;} { (exit 1); exit 1; }; } # Provide some information about the compiler. echo "$as_me:$LINENO:" \ "checking for C compiler version" >&5 ac_compiler=`set X $ac_compile; echo $2` { (eval echo "$as_me:$LINENO: \"$ac_compiler --version &5\"") >&5 (eval $ac_compiler --version &5) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } { (eval echo "$as_me:$LINENO: \"$ac_compiler -v &5\"") >&5 (eval $ac_compiler -v &5) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } { (eval echo "$as_me:$LINENO: \"$ac_compiler -V &5\"") >&5 (eval $ac_compiler -V &5) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ int main () { ; return 0; } _ACEOF ac_clean_files_save=$ac_clean_files ac_clean_files="$ac_clean_files a.out a.exe b.out" # Try to create an executable without -o first, disregard a.out. # It will help us diagnose broken compilers, and finding out an intuition # of exeext. echo "$as_me:$LINENO: checking for C compiler default output file name" >&5 echo $ECHO_N "checking for C compiler default output file name... $ECHO_C" >&6 ac_link_default=`echo "$ac_link" | sed 's/ -o *conftest[^ ]*//'` if { (eval echo "$as_me:$LINENO: \"$ac_link_default\"") >&5 (eval $ac_link_default) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; then # Find the output, starting from the most likely. This scheme is # not robust to junk in `.', hence go to wildcards (a.*) only as a last # resort. # Be careful to initialize this variable, since it used to be cached. # Otherwise an old cache value of `no' led to `EXEEXT = no' in a Makefile. ac_cv_exeext= # b.out is created by i960 compilers. for ac_file in a_out.exe a.exe conftest.exe a.out conftest a.* conftest.* b.out do test -f "$ac_file" || continue case $ac_file in *.$ac_ext | *.xcoff | *.tds | *.d | *.pdb | *.xSYM | *.bb | *.bbg | *.o | *.obj ) ;; conftest.$ac_ext ) # This is the source file. ;; [ab].out ) # We found the default executable, but exeext='' is most # certainly right. break;; *.* ) ac_cv_exeext=`expr "$ac_file" : '[^.]*\(\..*\)'` # FIXME: I believe we export ac_cv_exeext for Libtool, # but it would be cool to find out if it's true. Does anybody # maintain Libtool? --akim. export ac_cv_exeext break;; * ) break;; esac done else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 { { echo "$as_me:$LINENO: error: C compiler cannot create executables See \`config.log' for more details." >&5 echo "$as_me: error: C compiler cannot create executables See \`config.log' for more details." >&2;} { (exit 77); exit 77; }; } fi ac_exeext=$ac_cv_exeext echo "$as_me:$LINENO: result: $ac_file" >&5 echo "${ECHO_T}$ac_file" >&6 # Check the compiler produces executables we can run. If not, either # the compiler is broken, or we cross compile. echo "$as_me:$LINENO: checking whether the C compiler works" >&5 echo $ECHO_N "checking whether the C compiler works... $ECHO_C" >&6 # FIXME: These cross compiler hacks should be removed for Autoconf 3.0 # If not cross compiling, check that we can run a simple program. if test "$cross_compiling" != yes; then if { ac_try='./$ac_file' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then cross_compiling=no else if test "$cross_compiling" = maybe; then cross_compiling=yes else { { echo "$as_me:$LINENO: error: cannot run C compiled programs. If you meant to cross compile, use \`--host'. See \`config.log' for more details." >&5 echo "$as_me: error: cannot run C compiled programs. If you meant to cross compile, use \`--host'. See \`config.log' for more details." >&2;} { (exit 1); exit 1; }; } fi fi fi echo "$as_me:$LINENO: result: yes" >&5 echo "${ECHO_T}yes" >&6 rm -f a.out a.exe conftest$ac_cv_exeext b.out ac_clean_files=$ac_clean_files_save # Check the compiler produces executables we can run. If not, either # the compiler is broken, or we cross compile. echo "$as_me:$LINENO: checking whether we are cross compiling" >&5 echo $ECHO_N "checking whether we are cross compiling... $ECHO_C" >&6 echo "$as_me:$LINENO: result: $cross_compiling" >&5 echo "${ECHO_T}$cross_compiling" >&6 echo "$as_me:$LINENO: checking for suffix of executables" >&5 echo $ECHO_N "checking for suffix of executables... $ECHO_C" >&6 if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; then # If both `conftest.exe' and `conftest' are `present' (well, observable) # catch `conftest.exe'. For instance with Cygwin, `ls conftest' will # work properly (i.e., refer to `conftest.exe'), while it won't with # `rm'. for ac_file in conftest.exe conftest conftest.*; do test -f "$ac_file" || continue case $ac_file in *.$ac_ext | *.xcoff | *.tds | *.d | *.pdb | *.xSYM | *.bb | *.bbg | *.o | *.obj ) ;; *.* ) ac_cv_exeext=`expr "$ac_file" : '[^.]*\(\..*\)'` export ac_cv_exeext break;; * ) break;; esac done else { { echo "$as_me:$LINENO: error: cannot compute suffix of executables: cannot compile and link See \`config.log' for more details." >&5 echo "$as_me: error: cannot compute suffix of executables: cannot compile and link See \`config.log' for more details." >&2;} { (exit 1); exit 1; }; } fi rm -f conftest$ac_cv_exeext echo "$as_me:$LINENO: result: $ac_cv_exeext" >&5 echo "${ECHO_T}$ac_cv_exeext" >&6 rm -f conftest.$ac_ext EXEEXT=$ac_cv_exeext ac_exeext=$EXEEXT echo "$as_me:$LINENO: checking for suffix of object files" >&5 echo $ECHO_N "checking for suffix of object files... $ECHO_C" >&6 if test "${ac_cv_objext+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ int main () { ; return 0; } _ACEOF rm -f conftest.o conftest.obj if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5 (eval $ac_compile) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; then for ac_file in `(ls conftest.o conftest.obj; ls conftest.*) 2>/dev/null`; do case $ac_file in *.$ac_ext | *.xcoff | *.tds | *.d | *.pdb | *.xSYM | *.bb | *.bbg ) ;; *) ac_cv_objext=`expr "$ac_file" : '.*\.\(.*\)'` break;; esac done else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 { { echo "$as_me:$LINENO: error: cannot compute suffix of object files: cannot compile See \`config.log' for more details." >&5 echo "$as_me: error: cannot compute suffix of object files: cannot compile See \`config.log' for more details." >&2;} { (exit 1); exit 1; }; } fi rm -f conftest.$ac_cv_objext conftest.$ac_ext fi echo "$as_me:$LINENO: result: $ac_cv_objext" >&5 echo "${ECHO_T}$ac_cv_objext" >&6 OBJEXT=$ac_cv_objext ac_objext=$OBJEXT echo "$as_me:$LINENO: checking whether we are using the GNU C compiler" >&5 echo $ECHO_N "checking whether we are using the GNU C compiler... $ECHO_C" >&6 if test "${ac_cv_c_compiler_gnu+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ int main () { #ifndef __GNUC__ choke me #endif ; return 0; } _ACEOF rm -f conftest.$ac_objext if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5 (eval $ac_compile) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest.$ac_objext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then ac_compiler_gnu=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_compiler_gnu=no fi rm -f conftest.err conftest.$ac_objext conftest.$ac_ext ac_cv_c_compiler_gnu=$ac_compiler_gnu fi echo "$as_me:$LINENO: result: $ac_cv_c_compiler_gnu" >&5 echo "${ECHO_T}$ac_cv_c_compiler_gnu" >&6 GCC=`test $ac_compiler_gnu = yes && echo yes` ac_test_CFLAGS=${CFLAGS+set} ac_save_CFLAGS=$CFLAGS CFLAGS="-g" echo "$as_me:$LINENO: checking whether $CC accepts -g" >&5 echo $ECHO_N "checking whether $CC accepts -g... $ECHO_C" >&6 if test "${ac_cv_prog_cc_g+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ int main () { ; return 0; } _ACEOF rm -f conftest.$ac_objext if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5 (eval $ac_compile) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest.$ac_objext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then ac_cv_prog_cc_g=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_cv_prog_cc_g=no fi rm -f conftest.err conftest.$ac_objext conftest.$ac_ext fi echo "$as_me:$LINENO: result: $ac_cv_prog_cc_g" >&5 echo "${ECHO_T}$ac_cv_prog_cc_g" >&6 if test "$ac_test_CFLAGS" = set; then CFLAGS=$ac_save_CFLAGS elif test $ac_cv_prog_cc_g = yes; then if test "$GCC" = yes; then CFLAGS="-g -O2" else CFLAGS="-g" fi else if test "$GCC" = yes; then CFLAGS="-O2" else CFLAGS= fi fi echo "$as_me:$LINENO: checking for $CC option to accept ANSI C" >&5 echo $ECHO_N "checking for $CC option to accept ANSI C... $ECHO_C" >&6 if test "${ac_cv_prog_cc_stdc+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else ac_cv_prog_cc_stdc=no ac_save_CC=$CC cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #include #include #include #include /* Most of the following tests are stolen from RCS 5.7's src/conf.sh. */ struct buf { int x; }; FILE * (*rcsopen) (struct buf *, struct stat *, int); static char *e (p, i) char **p; int i; { return p[i]; } static char *f (char * (*g) (char **, int), char **p, ...) { char *s; va_list v; va_start (v,p); s = g (p, va_arg (v,int)); va_end (v); return s; } /* OSF 4.0 Compaq cc is some sort of almost-ANSI by default. It has function prototypes and stuff, but not '\xHH' hex character constants. These don't provoke an error unfortunately, instead are silently treated as 'x'. The following induces an error, until -std1 is added to get proper ANSI mode. Curiously '\x00'!='x' always comes out true, for an array size at least. It's necessary to write '\x00'==0 to get something that's true only with -std1. */ int osf4_cc_array ['\x00' == 0 ? 1 : -1]; int test (int i, double x); struct s1 {int (*f) (int a);}; struct s2 {int (*f) (double a);}; int pairnames (int, char **, FILE *(*)(struct buf *, struct stat *, int), int, int); int argc; char **argv; int main () { return f (e, argv, 0) != argv[0] || f (e, argv, 1) != argv[1]; ; return 0; } _ACEOF # Don't try gcc -ansi; that turns off useful extensions and # breaks some systems' header files. # AIX -qlanglvl=ansi # Ultrix and OSF/1 -std1 # HP-UX 10.20 and later -Ae # HP-UX older versions -Aa -D_HPUX_SOURCE # SVR4 -Xc -D__EXTENSIONS__ for ac_arg in "" -qlanglvl=ansi -std1 -Ae "-Aa -D_HPUX_SOURCE" "-Xc -D__EXTENSIONS__" do CC="$ac_save_CC $ac_arg" rm -f conftest.$ac_objext if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5 (eval $ac_compile) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest.$ac_objext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then ac_cv_prog_cc_stdc=$ac_arg break else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 fi rm -f conftest.err conftest.$ac_objext done rm -f conftest.$ac_ext conftest.$ac_objext CC=$ac_save_CC fi case "x$ac_cv_prog_cc_stdc" in x|xno) echo "$as_me:$LINENO: result: none needed" >&5 echo "${ECHO_T}none needed" >&6 ;; *) echo "$as_me:$LINENO: result: $ac_cv_prog_cc_stdc" >&5 echo "${ECHO_T}$ac_cv_prog_cc_stdc" >&6 CC="$CC $ac_cv_prog_cc_stdc" ;; esac # Some people use a C++ compiler to compile C. Since we use `exit', # in C++ we need to declare it. In case someone uses the same compiler # for both compiling C and C++ we need to have the C++ compiler decide # the declaration of exit, since it's the most demanding environment. cat >conftest.$ac_ext <<_ACEOF #ifndef __cplusplus choke me #endif _ACEOF rm -f conftest.$ac_objext if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5 (eval $ac_compile) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest.$ac_objext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then for ac_declaration in \ '' \ 'extern "C" void std::exit (int) throw (); using std::exit;' \ 'extern "C" void std::exit (int); using std::exit;' \ 'extern "C" void exit (int) throw ();' \ 'extern "C" void exit (int);' \ 'void exit (int);' do cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ $ac_declaration #include int main () { exit (42); ; return 0; } _ACEOF rm -f conftest.$ac_objext if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5 (eval $ac_compile) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest.$ac_objext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then : else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 continue fi rm -f conftest.err conftest.$ac_objext conftest.$ac_ext cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ $ac_declaration int main () { exit (42); ; return 0; } _ACEOF rm -f conftest.$ac_objext if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5 (eval $ac_compile) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest.$ac_objext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then break else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 fi rm -f conftest.err conftest.$ac_objext conftest.$ac_ext done rm -f conftest* if test -n "$ac_declaration"; then echo '#ifdef __cplusplus' >>confdefs.h echo $ac_declaration >>confdefs.h echo '#endif' >>confdefs.h fi else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 fi rm -f conftest.err conftest.$ac_objext conftest.$ac_ext ac_ext=c ac_cpp='$CPP $CPPFLAGS' ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' ac_compiler_gnu=$ac_cv_c_compiler_gnu depcc="$CC" am_compiler_list= echo "$as_me:$LINENO: checking dependency style of $depcc" >&5 echo $ECHO_N "checking dependency style of $depcc... $ECHO_C" >&6 if test "${am_cv_CC_dependencies_compiler_type+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test -z "$AMDEP_TRUE" && test -f "$am_depcomp"; then # We make a subdir and do the tests there. Otherwise we can end up # making bogus files that we don't know about and never remove. For # instance it was reported that on HP-UX the gcc test will end up # making a dummy file named `D' -- because `-MD' means `put the output # in D'. mkdir conftest.dir # Copy depcomp to subdir because otherwise we won't find it if we're # using a relative directory. cp "$am_depcomp" conftest.dir cd conftest.dir # We will build objects and dependencies in a subdirectory because # it helps to detect inapplicable dependency modes. For instance # both Tru64's cc and ICC support -MD to output dependencies as a # side effect of compilation, but ICC will put the dependencies in # the current directory while Tru64 will put them in the object # directory. mkdir sub am_cv_CC_dependencies_compiler_type=none if test "$am_compiler_list" = ""; then am_compiler_list=`sed -n 's/^#*\([a-zA-Z0-9]*\))$/\1/p' < ./depcomp` fi for depmode in $am_compiler_list; do # Setup a source with many dependencies, because some compilers # like to wrap large dependency lists on column 80 (with \), and # we should not choose a depcomp mode which is confused by this. # # We need to recreate these files for each test, as the compiler may # overwrite some of them when testing with obscure command lines. # This happens at least with the AIX C compiler. : > sub/conftest.c for i in 1 2 3 4 5 6; do echo '#include "conftst'$i'.h"' >> sub/conftest.c # Using `: > sub/conftst$i.h' creates only sub/conftst1.h with # Solaris 8's {/usr,}/bin/sh. touch sub/conftst$i.h done echo "${am__include} ${am__quote}sub/conftest.Po${am__quote}" > confmf case $depmode in nosideeffect) # after this tag, mechanisms are not by side-effect, so they'll # only be used when explicitly requested if test "x$enable_dependency_tracking" = xyes; then continue else break fi ;; none) break ;; esac # We check with `-c' and `-o' for the sake of the "dashmstdout" # mode. It turns out that the SunPro C++ compiler does not properly # handle `-M -o', and we need to detect this. if depmode=$depmode \ source=sub/conftest.c object=sub/conftest.${OBJEXT-o} \ depfile=sub/conftest.Po tmpdepfile=sub/conftest.TPo \ $SHELL ./depcomp $depcc -c -o sub/conftest.${OBJEXT-o} sub/conftest.c \ >/dev/null 2>conftest.err && grep sub/conftst6.h sub/conftest.Po > /dev/null 2>&1 && grep sub/conftest.${OBJEXT-o} sub/conftest.Po > /dev/null 2>&1 && ${MAKE-make} -s -f confmf > /dev/null 2>&1; then # icc doesn't choke on unknown options, it will just issue warnings # or remarks (even with -Werror). So we grep stderr for any message # that says an option was ignored or not supported. # When given -MP, icc 7.0 and 7.1 complain thusly: # icc: Command line warning: ignoring option '-M'; no argument required # The diagnosis changed in icc 8.0: # icc: Command line remark: option '-MP' not supported if (grep 'ignoring option' conftest.err || grep 'not supported' conftest.err) >/dev/null 2>&1; then :; else am_cv_CC_dependencies_compiler_type=$depmode break fi fi done cd .. rm -rf conftest.dir else am_cv_CC_dependencies_compiler_type=none fi fi echo "$as_me:$LINENO: result: $am_cv_CC_dependencies_compiler_type" >&5 echo "${ECHO_T}$am_cv_CC_dependencies_compiler_type" >&6 CCDEPMODE=depmode=$am_cv_CC_dependencies_compiler_type if test "x$enable_dependency_tracking" != xno \ && test "$am_cv_CC_dependencies_compiler_type" = gcc3; then am__fastdepCC_TRUE= am__fastdepCC_FALSE='#' else am__fastdepCC_TRUE='#' am__fastdepCC_FALSE= fi echo "$as_me:$LINENO: checking for a sed that does not truncate output" >&5 echo $ECHO_N "checking for a sed that does not truncate output... $ECHO_C" >&6 if test "${lt_cv_path_SED+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else # Loop through the user's path and test for sed and gsed. # Then use that list of sed's as ones to test for truncation. as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for lt_ac_prog in sed gsed; do for ac_exec_ext in '' $ac_executable_extensions; do if $as_executable_p "$as_dir/$lt_ac_prog$ac_exec_ext"; then lt_ac_sed_list="$lt_ac_sed_list $as_dir/$lt_ac_prog$ac_exec_ext" fi done done done lt_ac_max=0 lt_ac_count=0 # Add /usr/xpg4/bin/sed as it is typically found on Solaris # along with /bin/sed that truncates output. for lt_ac_sed in $lt_ac_sed_list /usr/xpg4/bin/sed; do test ! -f $lt_ac_sed && break cat /dev/null > conftest.in lt_ac_count=0 echo $ECHO_N "0123456789$ECHO_C" >conftest.in # Check for GNU sed and select it if it is found. if "$lt_ac_sed" --version 2>&1 < /dev/null | grep 'GNU' > /dev/null; then lt_cv_path_SED=$lt_ac_sed break fi while true; do cat conftest.in conftest.in >conftest.tmp mv conftest.tmp conftest.in cp conftest.in conftest.nl echo >>conftest.nl $lt_ac_sed -e 's/a$//' < conftest.nl >conftest.out || break cmp -s conftest.out conftest.nl || break # 10000 chars as input seems more than enough test $lt_ac_count -gt 10 && break lt_ac_count=`expr $lt_ac_count + 1` if test $lt_ac_count -gt $lt_ac_max; then lt_ac_max=$lt_ac_count lt_cv_path_SED=$lt_ac_sed fi done done fi SED=$lt_cv_path_SED echo "$as_me:$LINENO: result: $SED" >&5 echo "${ECHO_T}$SED" >&6 echo "$as_me:$LINENO: checking for egrep" >&5 echo $ECHO_N "checking for egrep... $ECHO_C" >&6 if test "${ac_cv_prog_egrep+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if echo a | (grep -E '(a|b)') >/dev/null 2>&1 then ac_cv_prog_egrep='grep -E' else ac_cv_prog_egrep='egrep' fi fi echo "$as_me:$LINENO: result: $ac_cv_prog_egrep" >&5 echo "${ECHO_T}$ac_cv_prog_egrep" >&6 EGREP=$ac_cv_prog_egrep # Check whether --with-gnu-ld or --without-gnu-ld was given. if test "${with_gnu_ld+set}" = set; then withval="$with_gnu_ld" test "$withval" = no || with_gnu_ld=yes else with_gnu_ld=no fi; ac_prog=ld if test "$GCC" = yes; then # Check if gcc -print-prog-name=ld gives a path. echo "$as_me:$LINENO: checking for ld used by $CC" >&5 echo $ECHO_N "checking for ld used by $CC... $ECHO_C" >&6 case $host in *-*-mingw*) # gcc leaves a trailing carriage return which upsets mingw ac_prog=`($CC -print-prog-name=ld) 2>&5 | tr -d '\015'` ;; *) ac_prog=`($CC -print-prog-name=ld) 2>&5` ;; esac case $ac_prog in # Accept absolute paths. [\\/]* | ?:[\\/]*) re_direlt='/[^/][^/]*/\.\./' # Canonicalize the pathname of ld ac_prog=`echo $ac_prog| $SED 's%\\\\%/%g'` while echo $ac_prog | grep "$re_direlt" > /dev/null 2>&1; do ac_prog=`echo $ac_prog| $SED "s%$re_direlt%/%"` done test -z "$LD" && LD="$ac_prog" ;; "") # If it fails, then pretend we aren't using GCC. ac_prog=ld ;; *) # If it is relative, then search for the first ld in PATH. with_gnu_ld=unknown ;; esac elif test "$with_gnu_ld" = yes; then echo "$as_me:$LINENO: checking for GNU ld" >&5 echo $ECHO_N "checking for GNU ld... $ECHO_C" >&6 else echo "$as_me:$LINENO: checking for non-GNU ld" >&5 echo $ECHO_N "checking for non-GNU ld... $ECHO_C" >&6 fi if test "${lt_cv_path_LD+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test -z "$LD"; then lt_save_ifs="$IFS"; IFS=$PATH_SEPARATOR for ac_dir in $PATH; do IFS="$lt_save_ifs" test -z "$ac_dir" && ac_dir=. if test -f "$ac_dir/$ac_prog" || test -f "$ac_dir/$ac_prog$ac_exeext"; then lt_cv_path_LD="$ac_dir/$ac_prog" # Check to see if the program is GNU ld. I'd rather use --version, # but apparently some GNU ld's only accept -v. # Break only if it was the GNU/non-GNU ld that we prefer. case `"$lt_cv_path_LD" -v 2>&1 &5 echo "${ECHO_T}$LD" >&6 else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 fi test -z "$LD" && { { echo "$as_me:$LINENO: error: no acceptable ld found in \$PATH" >&5 echo "$as_me: error: no acceptable ld found in \$PATH" >&2;} { (exit 1); exit 1; }; } echo "$as_me:$LINENO: checking if the linker ($LD) is GNU ld" >&5 echo $ECHO_N "checking if the linker ($LD) is GNU ld... $ECHO_C" >&6 if test "${lt_cv_prog_gnu_ld+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else # I'd rather use --version here, but apparently some GNU ld's only accept -v. case `$LD -v 2>&1 &5 echo "${ECHO_T}$lt_cv_prog_gnu_ld" >&6 with_gnu_ld=$lt_cv_prog_gnu_ld echo "$as_me:$LINENO: checking for $LD option to reload object files" >&5 echo $ECHO_N "checking for $LD option to reload object files... $ECHO_C" >&6 if test "${lt_cv_ld_reload_flag+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else lt_cv_ld_reload_flag='-r' fi echo "$as_me:$LINENO: result: $lt_cv_ld_reload_flag" >&5 echo "${ECHO_T}$lt_cv_ld_reload_flag" >&6 reload_flag=$lt_cv_ld_reload_flag case $reload_flag in "" | " "*) ;; *) reload_flag=" $reload_flag" ;; esac reload_cmds='$LD$reload_flag -o $output$reload_objs' case $host_os in darwin*) if test "$GCC" = yes; then reload_cmds='$CC -nostdlib ${wl}-r -o $output$reload_objs' else reload_cmds='$LD$reload_flag -o $output$reload_objs' fi ;; esac echo "$as_me:$LINENO: checking for BSD-compatible nm" >&5 echo $ECHO_N "checking for BSD-compatible nm... $ECHO_C" >&6 if test "${lt_cv_path_NM+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test -n "$NM"; then # Let the user override the test. lt_cv_path_NM="$NM" else lt_save_ifs="$IFS"; IFS=$PATH_SEPARATOR for ac_dir in $PATH /usr/ccs/bin /usr/ucb /bin; do IFS="$lt_save_ifs" test -z "$ac_dir" && ac_dir=. tmp_nm="$ac_dir/${ac_tool_prefix}nm" if test -f "$tmp_nm" || test -f "$tmp_nm$ac_exeext" ; then # Check to see if the nm accepts a BSD-compat flag. # Adding the `sed 1q' prevents false positives on HP-UX, which says: # nm: unknown option "B" ignored # Tru64's nm complains that /dev/null is an invalid object file case `"$tmp_nm" -B /dev/null 2>&1 | sed '1q'` in */dev/null* | *'Invalid file or object type'*) lt_cv_path_NM="$tmp_nm -B" break ;; *) case `"$tmp_nm" -p /dev/null 2>&1 | sed '1q'` in */dev/null*) lt_cv_path_NM="$tmp_nm -p" break ;; *) lt_cv_path_NM=${lt_cv_path_NM="$tmp_nm"} # keep the first match, but continue # so that we can try to find one that supports BSD flags ;; esac esac fi done IFS="$lt_save_ifs" test -z "$lt_cv_path_NM" && lt_cv_path_NM=nm fi fi echo "$as_me:$LINENO: result: $lt_cv_path_NM" >&5 echo "${ECHO_T}$lt_cv_path_NM" >&6 NM="$lt_cv_path_NM" echo "$as_me:$LINENO: checking whether ln -s works" >&5 echo $ECHO_N "checking whether ln -s works... $ECHO_C" >&6 LN_S=$as_ln_s if test "$LN_S" = "ln -s"; then echo "$as_me:$LINENO: result: yes" >&5 echo "${ECHO_T}yes" >&6 else echo "$as_me:$LINENO: result: no, using $LN_S" >&5 echo "${ECHO_T}no, using $LN_S" >&6 fi echo "$as_me:$LINENO: checking how to recognise dependent libraries" >&5 echo $ECHO_N "checking how to recognise dependent libraries... $ECHO_C" >&6 if test "${lt_cv_deplibs_check_method+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else lt_cv_file_magic_cmd='$MAGIC_CMD' lt_cv_file_magic_test_file= lt_cv_deplibs_check_method='unknown' # Need to set the preceding variable on all platforms that support # interlibrary dependencies. # 'none' -- dependencies not supported. # `unknown' -- same as none, but documents that we really don't know. # 'pass_all' -- all dependencies passed with no checks. # 'test_compile' -- check by making test program. # 'file_magic [[regex]]' -- check by looking for files in library path # which responds to the $file_magic_cmd with a given extended regex. # If you have `file' or equivalent on your system and you're not sure # whether `pass_all' will *always* work, you probably want this one. case $host_os in aix4* | aix5*) lt_cv_deplibs_check_method=pass_all ;; beos*) lt_cv_deplibs_check_method=pass_all ;; bsdi[45]*) lt_cv_deplibs_check_method='file_magic ELF [0-9][0-9]*-bit [ML]SB (shared object|dynamic lib)' lt_cv_file_magic_cmd='/usr/bin/file -L' lt_cv_file_magic_test_file=/shlib/libc.so ;; cygwin*) # func_win32_libid is a shell function defined in ltmain.sh lt_cv_deplibs_check_method='file_magic ^x86 archive import|^x86 DLL' lt_cv_file_magic_cmd='func_win32_libid' ;; mingw* | pw32*) # Base MSYS/MinGW do not provide the 'file' command needed by # func_win32_libid shell function, so use a weaker test based on 'objdump'. lt_cv_deplibs_check_method='file_magic file format pei*-i386(.*architecture: i386)?' lt_cv_file_magic_cmd='$OBJDUMP -f' ;; darwin* | rhapsody*) lt_cv_deplibs_check_method=pass_all ;; freebsd* | kfreebsd*-gnu) if echo __ELF__ | $CC -E - | grep __ELF__ > /dev/null; then case $host_cpu in i*86 ) # Not sure whether the presence of OpenBSD here was a mistake. # Let's accept both of them until this is cleared up. lt_cv_deplibs_check_method='file_magic (FreeBSD|OpenBSD)/i[3-9]86 (compact )?demand paged shared library' lt_cv_file_magic_cmd=/usr/bin/file lt_cv_file_magic_test_file=`echo /usr/lib/libc.so.*` ;; esac else lt_cv_deplibs_check_method=pass_all fi ;; gnu*) lt_cv_deplibs_check_method=pass_all ;; hpux10.20* | hpux11*) lt_cv_file_magic_cmd=/usr/bin/file case "$host_cpu" in ia64*) lt_cv_deplibs_check_method='file_magic (s[0-9][0-9][0-9]|ELF-[0-9][0-9]) shared object file - IA64' lt_cv_file_magic_test_file=/usr/lib/hpux32/libc.so ;; hppa*64*) lt_cv_deplibs_check_method='file_magic (s[0-9][0-9][0-9]|ELF-[0-9][0-9]) shared object file - PA-RISC [0-9].[0-9]' lt_cv_file_magic_test_file=/usr/lib/pa20_64/libc.sl ;; *) lt_cv_deplibs_check_method='file_magic (s[0-9][0-9][0-9]|PA-RISC[0-9].[0-9]) shared library' lt_cv_file_magic_test_file=/usr/lib/libc.sl ;; esac ;; irix5* | irix6* | nonstopux*) case $LD in *-32|*"-32 ") libmagic=32-bit;; *-n32|*"-n32 ") libmagic=N32;; *-64|*"-64 ") libmagic=64-bit;; *) libmagic=never-match;; esac lt_cv_deplibs_check_method=pass_all ;; # This must be Linux ELF. linux*) lt_cv_deplibs_check_method=pass_all ;; netbsd*) if echo __ELF__ | $CC -E - | grep __ELF__ > /dev/null; then lt_cv_deplibs_check_method='match_pattern /lib[^/]+(\.so\.[0-9]+\.[0-9]+|_pic\.a)$' else lt_cv_deplibs_check_method='match_pattern /lib[^/]+(\.so|_pic\.a)$' fi ;; newos6*) lt_cv_deplibs_check_method='file_magic ELF [0-9][0-9]*-bit [ML]SB (executable|dynamic lib)' lt_cv_file_magic_cmd=/usr/bin/file lt_cv_file_magic_test_file=/usr/lib/libnls.so ;; nto-qnx*) lt_cv_deplibs_check_method=unknown ;; openbsd*) if test -z "`echo __ELF__ | $CC -E - | grep __ELF__`" || test "$host_os-$host_cpu" = "openbsd2.8-powerpc"; then lt_cv_deplibs_check_method='match_pattern /lib[^/]+(\.so\.[0-9]+\.[0-9]+|\.so|_pic\.a)$' else lt_cv_deplibs_check_method='match_pattern /lib[^/]+(\.so\.[0-9]+\.[0-9]+|_pic\.a)$' fi ;; osf3* | osf4* | osf5*) lt_cv_deplibs_check_method=pass_all ;; sco3.2v5*) lt_cv_deplibs_check_method=pass_all ;; solaris*) lt_cv_deplibs_check_method=pass_all ;; sysv4 | sysv4.2uw2* | sysv4.3* | sysv5*) case $host_vendor in motorola) lt_cv_deplibs_check_method='file_magic ELF [0-9][0-9]*-bit [ML]SB (shared object|dynamic lib) M[0-9][0-9]* Version [0-9]' lt_cv_file_magic_test_file=`echo /usr/lib/libc.so*` ;; ncr) lt_cv_deplibs_check_method=pass_all ;; sequent) lt_cv_file_magic_cmd='/bin/file' lt_cv_deplibs_check_method='file_magic ELF [0-9][0-9]*-bit [LM]SB (shared object|dynamic lib )' ;; sni) lt_cv_file_magic_cmd='/bin/file' lt_cv_deplibs_check_method="file_magic ELF [0-9][0-9]*-bit [LM]SB dynamic lib" lt_cv_file_magic_test_file=/lib/libc.so ;; siemens) lt_cv_deplibs_check_method=pass_all ;; esac ;; sysv5OpenUNIX8* | sysv5UnixWare7* | sysv5uw[78]* | unixware7* | sysv4*uw2*) lt_cv_deplibs_check_method=pass_all ;; esac fi echo "$as_me:$LINENO: result: $lt_cv_deplibs_check_method" >&5 echo "${ECHO_T}$lt_cv_deplibs_check_method" >&6 file_magic_cmd=$lt_cv_file_magic_cmd deplibs_check_method=$lt_cv_deplibs_check_method test -z "$deplibs_check_method" && deplibs_check_method=unknown # If no C compiler was specified, use CC. LTCC=${LTCC-"$CC"} # Allow CC to be a program name with arguments. compiler=$CC # Check whether --enable-libtool-lock or --disable-libtool-lock was given. if test "${enable_libtool_lock+set}" = set; then enableval="$enable_libtool_lock" fi; test "x$enable_libtool_lock" != xno && enable_libtool_lock=yes # Some flags need to be propagated to the compiler or linker for good # libtool support. case $host in ia64-*-hpux*) # Find out which ABI we are using. echo 'int i;' > conftest.$ac_ext if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5 (eval $ac_compile) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; then case `/usr/bin/file conftest.$ac_objext` in *ELF-32*) HPUX_IA64_MODE="32" ;; *ELF-64*) HPUX_IA64_MODE="64" ;; esac fi rm -rf conftest* ;; *-*-irix6*) # Find out which ABI we are using. echo '#line 3779 "configure"' > conftest.$ac_ext if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5 (eval $ac_compile) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; then if test "$lt_cv_prog_gnu_ld" = yes; then case `/usr/bin/file conftest.$ac_objext` in *32-bit*) LD="${LD-ld} -melf32bsmip" ;; *N32*) LD="${LD-ld} -melf32bmipn32" ;; *64-bit*) LD="${LD-ld} -melf64bmip" ;; esac else case `/usr/bin/file conftest.$ac_objext` in *32-bit*) LD="${LD-ld} -32" ;; *N32*) LD="${LD-ld} -n32" ;; *64-bit*) LD="${LD-ld} -64" ;; esac fi fi rm -rf conftest* ;; x86_64-*linux*|ppc*-*linux*|powerpc*-*linux*|s390*-*linux*|sparc*-*linux*) # Find out which ABI we are using. echo 'int i;' > conftest.$ac_ext if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5 (eval $ac_compile) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; then case "`/usr/bin/file conftest.o`" in *32-bit*) case $host in x86_64-*linux*) LD="${LD-ld} -m elf_i386" ;; ppc64-*linux*|powerpc64-*linux*) LD="${LD-ld} -m elf32ppclinux" ;; s390x-*linux*) LD="${LD-ld} -m elf_s390" ;; sparc64-*linux*) LD="${LD-ld} -m elf32_sparc" ;; esac ;; *64-bit*) case $host in x86_64-*linux*) LD="${LD-ld} -m elf_x86_64" ;; ppc*-*linux*|powerpc*-*linux*) LD="${LD-ld} -m elf64ppc" ;; s390*-*linux*) LD="${LD-ld} -m elf64_s390" ;; sparc*-*linux*) LD="${LD-ld} -m elf64_sparc" ;; esac ;; esac fi rm -rf conftest* ;; *-*-sco3.2v5*) # On SCO OpenServer 5, we need -belf to get full-featured binaries. SAVE_CFLAGS="$CFLAGS" CFLAGS="$CFLAGS -belf" echo "$as_me:$LINENO: checking whether the C compiler needs -belf" >&5 echo $ECHO_N "checking whether the C compiler needs -belf... $ECHO_C" >&6 if test "${lt_cv_cc_needs_belf+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else ac_ext=c ac_cpp='$CPP $CPPFLAGS' ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' ac_compiler_gnu=$ac_cv_c_compiler_gnu cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ int main () { ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then lt_cv_cc_needs_belf=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 lt_cv_cc_needs_belf=no fi rm -f conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext ac_ext=c ac_cpp='$CPP $CPPFLAGS' ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' ac_compiler_gnu=$ac_cv_c_compiler_gnu fi echo "$as_me:$LINENO: result: $lt_cv_cc_needs_belf" >&5 echo "${ECHO_T}$lt_cv_cc_needs_belf" >&6 if test x"$lt_cv_cc_needs_belf" != x"yes"; then # this is probably gcc 2.8.0, egcs 1.0 or newer; no need for -belf CFLAGS="$SAVE_CFLAGS" fi ;; esac need_locks="$enable_libtool_lock" ac_ext=c ac_cpp='$CPP $CPPFLAGS' ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' ac_compiler_gnu=$ac_cv_c_compiler_gnu echo "$as_me:$LINENO: checking how to run the C preprocessor" >&5 echo $ECHO_N "checking how to run the C preprocessor... $ECHO_C" >&6 # On Suns, sometimes $CPP names a directory. if test -n "$CPP" && test -d "$CPP"; then CPP= fi if test -z "$CPP"; then if test "${ac_cv_prog_CPP+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else # Double quotes because CPP needs to be expanded for CPP in "$CC -E" "$CC -E -traditional-cpp" "/lib/cpp" do ac_preproc_ok=false for ac_c_preproc_warn_flag in '' yes do # Use a header file that comes with gcc, so configuring glibc # with a fresh cross-compiler works. # Prefer to if __STDC__ is defined, since # exists even on freestanding compilers. # On the NeXT, cc -E runs the code through the compiler's parser, # not just through cpp. "Syntax error" is here to catch this case. cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #ifdef __STDC__ # include #else # include #endif Syntax error _ACEOF if { (eval echo "$as_me:$LINENO: \"$ac_cpp conftest.$ac_ext\"") >&5 (eval $ac_cpp conftest.$ac_ext) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } >/dev/null; then if test -s conftest.err; then ac_cpp_err=$ac_c_preproc_warn_flag ac_cpp_err=$ac_cpp_err$ac_c_werror_flag else ac_cpp_err= fi else ac_cpp_err=yes fi if test -z "$ac_cpp_err"; then : else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 # Broken: fails on valid input. continue fi rm -f conftest.err conftest.$ac_ext # OK, works on sane cases. Now check whether non-existent headers # can be detected and how. cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #include _ACEOF if { (eval echo "$as_me:$LINENO: \"$ac_cpp conftest.$ac_ext\"") >&5 (eval $ac_cpp conftest.$ac_ext) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } >/dev/null; then if test -s conftest.err; then ac_cpp_err=$ac_c_preproc_warn_flag ac_cpp_err=$ac_cpp_err$ac_c_werror_flag else ac_cpp_err= fi else ac_cpp_err=yes fi if test -z "$ac_cpp_err"; then # Broken: success on invalid input. continue else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 # Passes both tests. ac_preproc_ok=: break fi rm -f conftest.err conftest.$ac_ext done # Because of `break', _AC_PREPROC_IFELSE's cleaning code was skipped. rm -f conftest.err conftest.$ac_ext if $ac_preproc_ok; then break fi done ac_cv_prog_CPP=$CPP fi CPP=$ac_cv_prog_CPP else ac_cv_prog_CPP=$CPP fi echo "$as_me:$LINENO: result: $CPP" >&5 echo "${ECHO_T}$CPP" >&6 ac_preproc_ok=false for ac_c_preproc_warn_flag in '' yes do # Use a header file that comes with gcc, so configuring glibc # with a fresh cross-compiler works. # Prefer to if __STDC__ is defined, since # exists even on freestanding compilers. # On the NeXT, cc -E runs the code through the compiler's parser, # not just through cpp. "Syntax error" is here to catch this case. cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #ifdef __STDC__ # include #else # include #endif Syntax error _ACEOF if { (eval echo "$as_me:$LINENO: \"$ac_cpp conftest.$ac_ext\"") >&5 (eval $ac_cpp conftest.$ac_ext) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } >/dev/null; then if test -s conftest.err; then ac_cpp_err=$ac_c_preproc_warn_flag ac_cpp_err=$ac_cpp_err$ac_c_werror_flag else ac_cpp_err= fi else ac_cpp_err=yes fi if test -z "$ac_cpp_err"; then : else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 # Broken: fails on valid input. continue fi rm -f conftest.err conftest.$ac_ext # OK, works on sane cases. Now check whether non-existent headers # can be detected and how. cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #include _ACEOF if { (eval echo "$as_me:$LINENO: \"$ac_cpp conftest.$ac_ext\"") >&5 (eval $ac_cpp conftest.$ac_ext) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } >/dev/null; then if test -s conftest.err; then ac_cpp_err=$ac_c_preproc_warn_flag ac_cpp_err=$ac_cpp_err$ac_c_werror_flag else ac_cpp_err= fi else ac_cpp_err=yes fi if test -z "$ac_cpp_err"; then # Broken: success on invalid input. continue else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 # Passes both tests. ac_preproc_ok=: break fi rm -f conftest.err conftest.$ac_ext done # Because of `break', _AC_PREPROC_IFELSE's cleaning code was skipped. rm -f conftest.err conftest.$ac_ext if $ac_preproc_ok; then : else { { echo "$as_me:$LINENO: error: C preprocessor \"$CPP\" fails sanity check See \`config.log' for more details." >&5 echo "$as_me: error: C preprocessor \"$CPP\" fails sanity check See \`config.log' for more details." >&2;} { (exit 1); exit 1; }; } fi ac_ext=c ac_cpp='$CPP $CPPFLAGS' ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' ac_compiler_gnu=$ac_cv_c_compiler_gnu echo "$as_me:$LINENO: checking for ANSI C header files" >&5 echo $ECHO_N "checking for ANSI C header files... $ECHO_C" >&6 if test "${ac_cv_header_stdc+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #include #include #include #include int main () { ; return 0; } _ACEOF rm -f conftest.$ac_objext if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5 (eval $ac_compile) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest.$ac_objext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then ac_cv_header_stdc=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_cv_header_stdc=no fi rm -f conftest.err conftest.$ac_objext conftest.$ac_ext if test $ac_cv_header_stdc = yes; then # SunOS 4.x string.h does not declare mem*, contrary to ANSI. cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #include _ACEOF if (eval "$ac_cpp conftest.$ac_ext") 2>&5 | $EGREP "memchr" >/dev/null 2>&1; then : else ac_cv_header_stdc=no fi rm -f conftest* fi if test $ac_cv_header_stdc = yes; then # ISC 2.0.2 stdlib.h does not declare free, contrary to ANSI. cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #include _ACEOF if (eval "$ac_cpp conftest.$ac_ext") 2>&5 | $EGREP "free" >/dev/null 2>&1; then : else ac_cv_header_stdc=no fi rm -f conftest* fi if test $ac_cv_header_stdc = yes; then # /bin/cc in Irix-4.0.5 gets non-ANSI ctype macros unless using -ansi. if test "$cross_compiling" = yes; then : else cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #include #if ((' ' & 0x0FF) == 0x020) # define ISLOWER(c) ('a' <= (c) && (c) <= 'z') # define TOUPPER(c) (ISLOWER(c) ? 'A' + ((c) - 'a') : (c)) #else # define ISLOWER(c) \ (('a' <= (c) && (c) <= 'i') \ || ('j' <= (c) && (c) <= 'r') \ || ('s' <= (c) && (c) <= 'z')) # define TOUPPER(c) (ISLOWER(c) ? ((c) | 0x40) : (c)) #endif #define XOR(e, f) (((e) && !(f)) || (!(e) && (f))) int main () { int i; for (i = 0; i < 256; i++) if (XOR (islower (i), ISLOWER (i)) || toupper (i) != TOUPPER (i)) exit(2); exit (0); } _ACEOF rm -f conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='./conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then : else echo "$as_me: program exited with status $ac_status" >&5 echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ( exit $ac_status ) ac_cv_header_stdc=no fi rm -f core *.core gmon.out bb.out conftest$ac_exeext conftest.$ac_objext conftest.$ac_ext fi fi fi echo "$as_me:$LINENO: result: $ac_cv_header_stdc" >&5 echo "${ECHO_T}$ac_cv_header_stdc" >&6 if test $ac_cv_header_stdc = yes; then cat >>confdefs.h <<\_ACEOF #define STDC_HEADERS 1 _ACEOF fi # On IRIX 5.3, sys/types and inttypes.h are conflicting. for ac_header in sys/types.h sys/stat.h stdlib.h string.h memory.h strings.h \ inttypes.h stdint.h unistd.h do as_ac_Header=`echo "ac_cv_header_$ac_header" | $as_tr_sh` echo "$as_me:$LINENO: checking for $ac_header" >&5 echo $ECHO_N "checking for $ac_header... $ECHO_C" >&6 if eval "test \"\${$as_ac_Header+set}\" = set"; then echo $ECHO_N "(cached) $ECHO_C" >&6 else cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ $ac_includes_default #include <$ac_header> _ACEOF rm -f conftest.$ac_objext if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5 (eval $ac_compile) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest.$ac_objext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then eval "$as_ac_Header=yes" else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 eval "$as_ac_Header=no" fi rm -f conftest.err conftest.$ac_objext conftest.$ac_ext fi echo "$as_me:$LINENO: result: `eval echo '${'$as_ac_Header'}'`" >&5 echo "${ECHO_T}`eval echo '${'$as_ac_Header'}'`" >&6 if test `eval echo '${'$as_ac_Header'}'` = yes; then cat >>confdefs.h <<_ACEOF #define `echo "HAVE_$ac_header" | $as_tr_cpp` 1 _ACEOF fi done for ac_header in dlfcn.h do as_ac_Header=`echo "ac_cv_header_$ac_header" | $as_tr_sh` if eval "test \"\${$as_ac_Header+set}\" = set"; then echo "$as_me:$LINENO: checking for $ac_header" >&5 echo $ECHO_N "checking for $ac_header... $ECHO_C" >&6 if eval "test \"\${$as_ac_Header+set}\" = set"; then echo $ECHO_N "(cached) $ECHO_C" >&6 fi echo "$as_me:$LINENO: result: `eval echo '${'$as_ac_Header'}'`" >&5 echo "${ECHO_T}`eval echo '${'$as_ac_Header'}'`" >&6 else # Is the header compilable? echo "$as_me:$LINENO: checking $ac_header usability" >&5 echo $ECHO_N "checking $ac_header usability... $ECHO_C" >&6 cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ $ac_includes_default #include <$ac_header> _ACEOF rm -f conftest.$ac_objext if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5 (eval $ac_compile) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest.$ac_objext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then ac_header_compiler=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_header_compiler=no fi rm -f conftest.err conftest.$ac_objext conftest.$ac_ext echo "$as_me:$LINENO: result: $ac_header_compiler" >&5 echo "${ECHO_T}$ac_header_compiler" >&6 # Is the header present? echo "$as_me:$LINENO: checking $ac_header presence" >&5 echo $ECHO_N "checking $ac_header presence... $ECHO_C" >&6 cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #include <$ac_header> _ACEOF if { (eval echo "$as_me:$LINENO: \"$ac_cpp conftest.$ac_ext\"") >&5 (eval $ac_cpp conftest.$ac_ext) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } >/dev/null; then if test -s conftest.err; then ac_cpp_err=$ac_c_preproc_warn_flag ac_cpp_err=$ac_cpp_err$ac_c_werror_flag else ac_cpp_err= fi else ac_cpp_err=yes fi if test -z "$ac_cpp_err"; then ac_header_preproc=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_header_preproc=no fi rm -f conftest.err conftest.$ac_ext echo "$as_me:$LINENO: result: $ac_header_preproc" >&5 echo "${ECHO_T}$ac_header_preproc" >&6 # So? What about this header? case $ac_header_compiler:$ac_header_preproc:$ac_c_preproc_warn_flag in yes:no: ) { echo "$as_me:$LINENO: WARNING: $ac_header: accepted by the compiler, rejected by the preprocessor!" >&5 echo "$as_me: WARNING: $ac_header: accepted by the compiler, rejected by the preprocessor!" >&2;} { echo "$as_me:$LINENO: WARNING: $ac_header: proceeding with the compiler's result" >&5 echo "$as_me: WARNING: $ac_header: proceeding with the compiler's result" >&2;} ac_header_preproc=yes ;; no:yes:* ) { echo "$as_me:$LINENO: WARNING: $ac_header: present but cannot be compiled" >&5 echo "$as_me: WARNING: $ac_header: present but cannot be compiled" >&2;} { echo "$as_me:$LINENO: WARNING: $ac_header: check for missing prerequisite headers?" >&5 echo "$as_me: WARNING: $ac_header: check for missing prerequisite headers?" >&2;} { echo "$as_me:$LINENO: WARNING: $ac_header: see the Autoconf documentation" >&5 echo "$as_me: WARNING: $ac_header: see the Autoconf documentation" >&2;} { echo "$as_me:$LINENO: WARNING: $ac_header: section \"Present But Cannot Be Compiled\"" >&5 echo "$as_me: WARNING: $ac_header: section \"Present But Cannot Be Compiled\"" >&2;} { echo "$as_me:$LINENO: WARNING: $ac_header: proceeding with the preprocessor's result" >&5 echo "$as_me: WARNING: $ac_header: proceeding with the preprocessor's result" >&2;} { echo "$as_me:$LINENO: WARNING: $ac_header: in the future, the compiler will take precedence" >&5 echo "$as_me: WARNING: $ac_header: in the future, the compiler will take precedence" >&2;} ( cat <<\_ASBOX ## ---------------------------------- ## ## Report this to jylefort@brutele.be ## ## ---------------------------------- ## _ASBOX ) | sed "s/^/$as_me: WARNING: /" >&2 ;; esac echo "$as_me:$LINENO: checking for $ac_header" >&5 echo $ECHO_N "checking for $ac_header... $ECHO_C" >&6 if eval "test \"\${$as_ac_Header+set}\" = set"; then echo $ECHO_N "(cached) $ECHO_C" >&6 else eval "$as_ac_Header=\$ac_header_preproc" fi echo "$as_me:$LINENO: result: `eval echo '${'$as_ac_Header'}'`" >&5 echo "${ECHO_T}`eval echo '${'$as_ac_Header'}'`" >&6 fi if test `eval echo '${'$as_ac_Header'}'` = yes; then cat >>confdefs.h <<_ACEOF #define `echo "HAVE_$ac_header" | $as_tr_cpp` 1 _ACEOF fi done ac_ext=cc ac_cpp='$CXXCPP $CPPFLAGS' ac_compile='$CXX -c $CXXFLAGS $CPPFLAGS conftest.$ac_ext >&5' ac_link='$CXX -o conftest$ac_exeext $CXXFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' ac_compiler_gnu=$ac_cv_cxx_compiler_gnu if test -n "$ac_tool_prefix"; then for ac_prog in $CCC g++ c++ gpp aCC CC cxx cc++ cl FCC KCC RCC xlC_r xlC do # Extract the first word of "$ac_tool_prefix$ac_prog", so it can be a program name with args. set dummy $ac_tool_prefix$ac_prog; ac_word=$2 echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6 if test "${ac_cv_prog_CXX+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test -n "$CXX"; then ac_cv_prog_CXX="$CXX" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then ac_cv_prog_CXX="$ac_tool_prefix$ac_prog" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done fi fi CXX=$ac_cv_prog_CXX if test -n "$CXX"; then echo "$as_me:$LINENO: result: $CXX" >&5 echo "${ECHO_T}$CXX" >&6 else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 fi test -n "$CXX" && break done fi if test -z "$CXX"; then ac_ct_CXX=$CXX for ac_prog in $CCC g++ c++ gpp aCC CC cxx cc++ cl FCC KCC RCC xlC_r xlC do # Extract the first word of "$ac_prog", so it can be a program name with args. set dummy $ac_prog; ac_word=$2 echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6 if test "${ac_cv_prog_ac_ct_CXX+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test -n "$ac_ct_CXX"; then ac_cv_prog_ac_ct_CXX="$ac_ct_CXX" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then ac_cv_prog_ac_ct_CXX="$ac_prog" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done fi fi ac_ct_CXX=$ac_cv_prog_ac_ct_CXX if test -n "$ac_ct_CXX"; then echo "$as_me:$LINENO: result: $ac_ct_CXX" >&5 echo "${ECHO_T}$ac_ct_CXX" >&6 else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 fi test -n "$ac_ct_CXX" && break done test -n "$ac_ct_CXX" || ac_ct_CXX="g++" CXX=$ac_ct_CXX fi # Provide some information about the compiler. echo "$as_me:$LINENO:" \ "checking for C++ compiler version" >&5 ac_compiler=`set X $ac_compile; echo $2` { (eval echo "$as_me:$LINENO: \"$ac_compiler --version &5\"") >&5 (eval $ac_compiler --version &5) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } { (eval echo "$as_me:$LINENO: \"$ac_compiler -v &5\"") >&5 (eval $ac_compiler -v &5) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } { (eval echo "$as_me:$LINENO: \"$ac_compiler -V &5\"") >&5 (eval $ac_compiler -V &5) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } echo "$as_me:$LINENO: checking whether we are using the GNU C++ compiler" >&5 echo $ECHO_N "checking whether we are using the GNU C++ compiler... $ECHO_C" >&6 if test "${ac_cv_cxx_compiler_gnu+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ int main () { #ifndef __GNUC__ choke me #endif ; return 0; } _ACEOF rm -f conftest.$ac_objext if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5 (eval $ac_compile) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_cxx_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest.$ac_objext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then ac_compiler_gnu=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_compiler_gnu=no fi rm -f conftest.err conftest.$ac_objext conftest.$ac_ext ac_cv_cxx_compiler_gnu=$ac_compiler_gnu fi echo "$as_me:$LINENO: result: $ac_cv_cxx_compiler_gnu" >&5 echo "${ECHO_T}$ac_cv_cxx_compiler_gnu" >&6 GXX=`test $ac_compiler_gnu = yes && echo yes` ac_test_CXXFLAGS=${CXXFLAGS+set} ac_save_CXXFLAGS=$CXXFLAGS CXXFLAGS="-g" echo "$as_me:$LINENO: checking whether $CXX accepts -g" >&5 echo $ECHO_N "checking whether $CXX accepts -g... $ECHO_C" >&6 if test "${ac_cv_prog_cxx_g+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ int main () { ; return 0; } _ACEOF rm -f conftest.$ac_objext if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5 (eval $ac_compile) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_cxx_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest.$ac_objext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then ac_cv_prog_cxx_g=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_cv_prog_cxx_g=no fi rm -f conftest.err conftest.$ac_objext conftest.$ac_ext fi echo "$as_me:$LINENO: result: $ac_cv_prog_cxx_g" >&5 echo "${ECHO_T}$ac_cv_prog_cxx_g" >&6 if test "$ac_test_CXXFLAGS" = set; then CXXFLAGS=$ac_save_CXXFLAGS elif test $ac_cv_prog_cxx_g = yes; then if test "$GXX" = yes; then CXXFLAGS="-g -O2" else CXXFLAGS="-g" fi else if test "$GXX" = yes; then CXXFLAGS="-O2" else CXXFLAGS= fi fi for ac_declaration in \ '' \ 'extern "C" void std::exit (int) throw (); using std::exit;' \ 'extern "C" void std::exit (int); using std::exit;' \ 'extern "C" void exit (int) throw ();' \ 'extern "C" void exit (int);' \ 'void exit (int);' do cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ $ac_declaration #include int main () { exit (42); ; return 0; } _ACEOF rm -f conftest.$ac_objext if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5 (eval $ac_compile) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_cxx_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest.$ac_objext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then : else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 continue fi rm -f conftest.err conftest.$ac_objext conftest.$ac_ext cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ $ac_declaration int main () { exit (42); ; return 0; } _ACEOF rm -f conftest.$ac_objext if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5 (eval $ac_compile) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_cxx_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest.$ac_objext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then break else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 fi rm -f conftest.err conftest.$ac_objext conftest.$ac_ext done rm -f conftest* if test -n "$ac_declaration"; then echo '#ifdef __cplusplus' >>confdefs.h echo $ac_declaration >>confdefs.h echo '#endif' >>confdefs.h fi ac_ext=cc ac_cpp='$CXXCPP $CPPFLAGS' ac_compile='$CXX -c $CXXFLAGS $CPPFLAGS conftest.$ac_ext >&5' ac_link='$CXX -o conftest$ac_exeext $CXXFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' ac_compiler_gnu=$ac_cv_cxx_compiler_gnu depcc="$CXX" am_compiler_list= echo "$as_me:$LINENO: checking dependency style of $depcc" >&5 echo $ECHO_N "checking dependency style of $depcc... $ECHO_C" >&6 if test "${am_cv_CXX_dependencies_compiler_type+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test -z "$AMDEP_TRUE" && test -f "$am_depcomp"; then # We make a subdir and do the tests there. Otherwise we can end up # making bogus files that we don't know about and never remove. For # instance it was reported that on HP-UX the gcc test will end up # making a dummy file named `D' -- because `-MD' means `put the output # in D'. mkdir conftest.dir # Copy depcomp to subdir because otherwise we won't find it if we're # using a relative directory. cp "$am_depcomp" conftest.dir cd conftest.dir # We will build objects and dependencies in a subdirectory because # it helps to detect inapplicable dependency modes. For instance # both Tru64's cc and ICC support -MD to output dependencies as a # side effect of compilation, but ICC will put the dependencies in # the current directory while Tru64 will put them in the object # directory. mkdir sub am_cv_CXX_dependencies_compiler_type=none if test "$am_compiler_list" = ""; then am_compiler_list=`sed -n 's/^#*\([a-zA-Z0-9]*\))$/\1/p' < ./depcomp` fi for depmode in $am_compiler_list; do # Setup a source with many dependencies, because some compilers # like to wrap large dependency lists on column 80 (with \), and # we should not choose a depcomp mode which is confused by this. # # We need to recreate these files for each test, as the compiler may # overwrite some of them when testing with obscure command lines. # This happens at least with the AIX C compiler. : > sub/conftest.c for i in 1 2 3 4 5 6; do echo '#include "conftst'$i'.h"' >> sub/conftest.c # Using `: > sub/conftst$i.h' creates only sub/conftst1.h with # Solaris 8's {/usr,}/bin/sh. touch sub/conftst$i.h done echo "${am__include} ${am__quote}sub/conftest.Po${am__quote}" > confmf case $depmode in nosideeffect) # after this tag, mechanisms are not by side-effect, so they'll # only be used when explicitly requested if test "x$enable_dependency_tracking" = xyes; then continue else break fi ;; none) break ;; esac # We check with `-c' and `-o' for the sake of the "dashmstdout" # mode. It turns out that the SunPro C++ compiler does not properly # handle `-M -o', and we need to detect this. if depmode=$depmode \ source=sub/conftest.c object=sub/conftest.${OBJEXT-o} \ depfile=sub/conftest.Po tmpdepfile=sub/conftest.TPo \ $SHELL ./depcomp $depcc -c -o sub/conftest.${OBJEXT-o} sub/conftest.c \ >/dev/null 2>conftest.err && grep sub/conftst6.h sub/conftest.Po > /dev/null 2>&1 && grep sub/conftest.${OBJEXT-o} sub/conftest.Po > /dev/null 2>&1 && ${MAKE-make} -s -f confmf > /dev/null 2>&1; then # icc doesn't choke on unknown options, it will just issue warnings # or remarks (even with -Werror). So we grep stderr for any message # that says an option was ignored or not supported. # When given -MP, icc 7.0 and 7.1 complain thusly: # icc: Command line warning: ignoring option '-M'; no argument required # The diagnosis changed in icc 8.0: # icc: Command line remark: option '-MP' not supported if (grep 'ignoring option' conftest.err || grep 'not supported' conftest.err) >/dev/null 2>&1; then :; else am_cv_CXX_dependencies_compiler_type=$depmode break fi fi done cd .. rm -rf conftest.dir else am_cv_CXX_dependencies_compiler_type=none fi fi echo "$as_me:$LINENO: result: $am_cv_CXX_dependencies_compiler_type" >&5 echo "${ECHO_T}$am_cv_CXX_dependencies_compiler_type" >&6 CXXDEPMODE=depmode=$am_cv_CXX_dependencies_compiler_type if test "x$enable_dependency_tracking" != xno \ && test "$am_cv_CXX_dependencies_compiler_type" = gcc3; then am__fastdepCXX_TRUE= am__fastdepCXX_FALSE='#' else am__fastdepCXX_TRUE='#' am__fastdepCXX_FALSE= fi if test -n "$CXX" && ( test "X$CXX" != "Xno" && ( (test "X$CXX" = "Xg++" && `g++ -v >/dev/null 2>&1` ) || (test "X$CXX" != "Xg++"))) ; then ac_ext=cc ac_cpp='$CXXCPP $CPPFLAGS' ac_compile='$CXX -c $CXXFLAGS $CPPFLAGS conftest.$ac_ext >&5' ac_link='$CXX -o conftest$ac_exeext $CXXFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' ac_compiler_gnu=$ac_cv_cxx_compiler_gnu echo "$as_me:$LINENO: checking how to run the C++ preprocessor" >&5 echo $ECHO_N "checking how to run the C++ preprocessor... $ECHO_C" >&6 if test -z "$CXXCPP"; then if test "${ac_cv_prog_CXXCPP+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else # Double quotes because CXXCPP needs to be expanded for CXXCPP in "$CXX -E" "/lib/cpp" do ac_preproc_ok=false for ac_cxx_preproc_warn_flag in '' yes do # Use a header file that comes with gcc, so configuring glibc # with a fresh cross-compiler works. # Prefer to if __STDC__ is defined, since # exists even on freestanding compilers. # On the NeXT, cc -E runs the code through the compiler's parser, # not just through cpp. "Syntax error" is here to catch this case. cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #ifdef __STDC__ # include #else # include #endif Syntax error _ACEOF if { (eval echo "$as_me:$LINENO: \"$ac_cpp conftest.$ac_ext\"") >&5 (eval $ac_cpp conftest.$ac_ext) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } >/dev/null; then if test -s conftest.err; then ac_cpp_err=$ac_cxx_preproc_warn_flag ac_cpp_err=$ac_cpp_err$ac_cxx_werror_flag else ac_cpp_err= fi else ac_cpp_err=yes fi if test -z "$ac_cpp_err"; then : else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 # Broken: fails on valid input. continue fi rm -f conftest.err conftest.$ac_ext # OK, works on sane cases. Now check whether non-existent headers # can be detected and how. cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #include _ACEOF if { (eval echo "$as_me:$LINENO: \"$ac_cpp conftest.$ac_ext\"") >&5 (eval $ac_cpp conftest.$ac_ext) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } >/dev/null; then if test -s conftest.err; then ac_cpp_err=$ac_cxx_preproc_warn_flag ac_cpp_err=$ac_cpp_err$ac_cxx_werror_flag else ac_cpp_err= fi else ac_cpp_err=yes fi if test -z "$ac_cpp_err"; then # Broken: success on invalid input. continue else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 # Passes both tests. ac_preproc_ok=: break fi rm -f conftest.err conftest.$ac_ext done # Because of `break', _AC_PREPROC_IFELSE's cleaning code was skipped. rm -f conftest.err conftest.$ac_ext if $ac_preproc_ok; then break fi done ac_cv_prog_CXXCPP=$CXXCPP fi CXXCPP=$ac_cv_prog_CXXCPP else ac_cv_prog_CXXCPP=$CXXCPP fi echo "$as_me:$LINENO: result: $CXXCPP" >&5 echo "${ECHO_T}$CXXCPP" >&6 ac_preproc_ok=false for ac_cxx_preproc_warn_flag in '' yes do # Use a header file that comes with gcc, so configuring glibc # with a fresh cross-compiler works. # Prefer to if __STDC__ is defined, since # exists even on freestanding compilers. # On the NeXT, cc -E runs the code through the compiler's parser, # not just through cpp. "Syntax error" is here to catch this case. cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #ifdef __STDC__ # include #else # include #endif Syntax error _ACEOF if { (eval echo "$as_me:$LINENO: \"$ac_cpp conftest.$ac_ext\"") >&5 (eval $ac_cpp conftest.$ac_ext) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } >/dev/null; then if test -s conftest.err; then ac_cpp_err=$ac_cxx_preproc_warn_flag ac_cpp_err=$ac_cpp_err$ac_cxx_werror_flag else ac_cpp_err= fi else ac_cpp_err=yes fi if test -z "$ac_cpp_err"; then : else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 # Broken: fails on valid input. continue fi rm -f conftest.err conftest.$ac_ext # OK, works on sane cases. Now check whether non-existent headers # can be detected and how. cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #include _ACEOF if { (eval echo "$as_me:$LINENO: \"$ac_cpp conftest.$ac_ext\"") >&5 (eval $ac_cpp conftest.$ac_ext) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } >/dev/null; then if test -s conftest.err; then ac_cpp_err=$ac_cxx_preproc_warn_flag ac_cpp_err=$ac_cpp_err$ac_cxx_werror_flag else ac_cpp_err= fi else ac_cpp_err=yes fi if test -z "$ac_cpp_err"; then # Broken: success on invalid input. continue else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 # Passes both tests. ac_preproc_ok=: break fi rm -f conftest.err conftest.$ac_ext done # Because of `break', _AC_PREPROC_IFELSE's cleaning code was skipped. rm -f conftest.err conftest.$ac_ext if $ac_preproc_ok; then : else { { echo "$as_me:$LINENO: error: C++ preprocessor \"$CXXCPP\" fails sanity check See \`config.log' for more details." >&5 echo "$as_me: error: C++ preprocessor \"$CXXCPP\" fails sanity check See \`config.log' for more details." >&2;} { (exit 1); exit 1; }; } fi ac_ext=cc ac_cpp='$CXXCPP $CPPFLAGS' ac_compile='$CXX -c $CXXFLAGS $CPPFLAGS conftest.$ac_ext >&5' ac_link='$CXX -o conftest$ac_exeext $CXXFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' ac_compiler_gnu=$ac_cv_cxx_compiler_gnu fi ac_ext=f ac_compile='$F77 -c $FFLAGS conftest.$ac_ext >&5' ac_link='$F77 -o conftest$ac_exeext $FFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' ac_compiler_gnu=$ac_cv_f77_compiler_gnu if test -n "$ac_tool_prefix"; then for ac_prog in g77 f77 xlf frt pgf77 fort77 fl32 af77 f90 xlf90 pgf90 epcf90 f95 fort xlf95 ifc efc pgf95 lf95 gfortran do # Extract the first word of "$ac_tool_prefix$ac_prog", so it can be a program name with args. set dummy $ac_tool_prefix$ac_prog; ac_word=$2 echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6 if test "${ac_cv_prog_F77+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test -n "$F77"; then ac_cv_prog_F77="$F77" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then ac_cv_prog_F77="$ac_tool_prefix$ac_prog" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done fi fi F77=$ac_cv_prog_F77 if test -n "$F77"; then echo "$as_me:$LINENO: result: $F77" >&5 echo "${ECHO_T}$F77" >&6 else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 fi test -n "$F77" && break done fi if test -z "$F77"; then ac_ct_F77=$F77 for ac_prog in g77 f77 xlf frt pgf77 fort77 fl32 af77 f90 xlf90 pgf90 epcf90 f95 fort xlf95 ifc efc pgf95 lf95 gfortran do # Extract the first word of "$ac_prog", so it can be a program name with args. set dummy $ac_prog; ac_word=$2 echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6 if test "${ac_cv_prog_ac_ct_F77+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test -n "$ac_ct_F77"; then ac_cv_prog_ac_ct_F77="$ac_ct_F77" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then ac_cv_prog_ac_ct_F77="$ac_prog" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done fi fi ac_ct_F77=$ac_cv_prog_ac_ct_F77 if test -n "$ac_ct_F77"; then echo "$as_me:$LINENO: result: $ac_ct_F77" >&5 echo "${ECHO_T}$ac_ct_F77" >&6 else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 fi test -n "$ac_ct_F77" && break done F77=$ac_ct_F77 fi # Provide some information about the compiler. echo "$as_me:5358:" \ "checking for Fortran 77 compiler version" >&5 ac_compiler=`set X $ac_compile; echo $2` { (eval echo "$as_me:$LINENO: \"$ac_compiler --version &5\"") >&5 (eval $ac_compiler --version &5) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } { (eval echo "$as_me:$LINENO: \"$ac_compiler -v &5\"") >&5 (eval $ac_compiler -v &5) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } { (eval echo "$as_me:$LINENO: \"$ac_compiler -V &5\"") >&5 (eval $ac_compiler -V &5) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } rm -f a.out # If we don't use `.F' as extension, the preprocessor is not run on the # input file. (Note that this only needs to work for GNU compilers.) ac_save_ext=$ac_ext ac_ext=F echo "$as_me:$LINENO: checking whether we are using the GNU Fortran 77 compiler" >&5 echo $ECHO_N "checking whether we are using the GNU Fortran 77 compiler... $ECHO_C" >&6 if test "${ac_cv_f77_compiler_gnu+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else cat >conftest.$ac_ext <<_ACEOF program main #ifndef __GNUC__ choke me #endif end _ACEOF rm -f conftest.$ac_objext if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5 (eval $ac_compile) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_f77_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest.$ac_objext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then ac_compiler_gnu=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_compiler_gnu=no fi rm -f conftest.err conftest.$ac_objext conftest.$ac_ext ac_cv_f77_compiler_gnu=$ac_compiler_gnu fi echo "$as_me:$LINENO: result: $ac_cv_f77_compiler_gnu" >&5 echo "${ECHO_T}$ac_cv_f77_compiler_gnu" >&6 ac_ext=$ac_save_ext ac_test_FFLAGS=${FFLAGS+set} ac_save_FFLAGS=$FFLAGS FFLAGS= echo "$as_me:$LINENO: checking whether $F77 accepts -g" >&5 echo $ECHO_N "checking whether $F77 accepts -g... $ECHO_C" >&6 if test "${ac_cv_prog_f77_g+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else FFLAGS=-g cat >conftest.$ac_ext <<_ACEOF program main end _ACEOF rm -f conftest.$ac_objext if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5 (eval $ac_compile) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_f77_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest.$ac_objext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then ac_cv_prog_f77_g=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_cv_prog_f77_g=no fi rm -f conftest.err conftest.$ac_objext conftest.$ac_ext fi echo "$as_me:$LINENO: result: $ac_cv_prog_f77_g" >&5 echo "${ECHO_T}$ac_cv_prog_f77_g" >&6 if test "$ac_test_FFLAGS" = set; then FFLAGS=$ac_save_FFLAGS elif test $ac_cv_prog_f77_g = yes; then if test "x$ac_cv_f77_compiler_gnu" = xyes; then FFLAGS="-g -O2" else FFLAGS="-g" fi else if test "x$ac_cv_f77_compiler_gnu" = xyes; then FFLAGS="-O2" else FFLAGS= fi fi G77=`test $ac_compiler_gnu = yes && echo yes` ac_ext=c ac_cpp='$CPP $CPPFLAGS' ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' ac_compiler_gnu=$ac_cv_c_compiler_gnu # Autoconf 2.13's AC_OBJEXT and AC_EXEEXT macros only works for C compilers! # find the maximum length of command line arguments echo "$as_me:$LINENO: checking the maximum length of command line arguments" >&5 echo $ECHO_N "checking the maximum length of command line arguments... $ECHO_C" >&6 if test "${lt_cv_sys_max_cmd_len+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else i=0 teststring="ABCD" case $build_os in msdosdjgpp*) # On DJGPP, this test can blow up pretty badly due to problems in libc # (any single argument exceeding 2000 bytes causes a buffer overrun # during glob expansion). Even if it were fixed, the result of this # check would be larger than it should be. lt_cv_sys_max_cmd_len=12288; # 12K is about right ;; gnu*) # Under GNU Hurd, this test is not required because there is # no limit to the length of command line arguments. # Libtool will interpret -1 as no limit whatsoever lt_cv_sys_max_cmd_len=-1; ;; cygwin* | mingw*) # On Win9x/ME, this test blows up -- it succeeds, but takes # about 5 minutes as the teststring grows exponentially. # Worse, since 9x/ME are not pre-emptively multitasking, # you end up with a "frozen" computer, even though with patience # the test eventually succeeds (with a max line length of 256k). # Instead, let's just punt: use the minimum linelength reported by # all of the supported platforms: 8192 (on NT/2K/XP). lt_cv_sys_max_cmd_len=8192; ;; amigaos*) # On AmigaOS with pdksh, this test takes hours, literally. # So we just punt and use a minimum line length of 8192. lt_cv_sys_max_cmd_len=8192; ;; netbsd* | freebsd* | openbsd* | darwin* ) # This has been around since 386BSD, at least. Likely further. if test -x /sbin/sysctl; then lt_cv_sys_max_cmd_len=`/sbin/sysctl -n kern.argmax` elif test -x /usr/sbin/sysctl; then lt_cv_sys_max_cmd_len=`/usr/sbin/sysctl -n kern.argmax` else lt_cv_sys_max_cmd_len=65536 # usable default for *BSD fi # And add a safety zone lt_cv_sys_max_cmd_len=`expr $lt_cv_sys_max_cmd_len \/ 4` ;; *) # If test is not a shell built-in, we'll probably end up computing a # maximum length that is only half of the actual maximum length, but # we can't tell. SHELL=${SHELL-${CONFIG_SHELL-/bin/sh}} while (test "X"`$SHELL $0 --fallback-echo "X$teststring" 2>/dev/null` \ = "XX$teststring") >/dev/null 2>&1 && new_result=`expr "X$teststring" : ".*" 2>&1` && lt_cv_sys_max_cmd_len=$new_result && test $i != 17 # 1/2 MB should be enough do i=`expr $i + 1` teststring=$teststring$teststring done teststring= # Add a significant safety factor because C++ compilers can tack on massive # amounts of additional arguments before passing them to the linker. # It appears as though 1/2 is a usable value. lt_cv_sys_max_cmd_len=`expr $lt_cv_sys_max_cmd_len \/ 2` ;; esac fi if test -n $lt_cv_sys_max_cmd_len ; then echo "$as_me:$LINENO: result: $lt_cv_sys_max_cmd_len" >&5 echo "${ECHO_T}$lt_cv_sys_max_cmd_len" >&6 else echo "$as_me:$LINENO: result: none" >&5 echo "${ECHO_T}none" >&6 fi # Check for command to grab the raw symbol name followed by C symbol from nm. echo "$as_me:$LINENO: checking command to parse $NM output from $compiler object" >&5 echo $ECHO_N "checking command to parse $NM output from $compiler object... $ECHO_C" >&6 if test "${lt_cv_sys_global_symbol_pipe+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else # These are sane defaults that work on at least a few old systems. # [They come from Ultrix. What could be older than Ultrix?!! ;)] # Character class describing NM global symbol codes. symcode='[BCDEGRST]' # Regexp to match symbols that can be accessed directly from C. sympat='\([_A-Za-z][_A-Za-z0-9]*\)' # Transform the above into a raw symbol and a C symbol. symxfrm='\1 \2\3 \3' # Transform an extracted symbol line into a proper C declaration lt_cv_sys_global_symbol_to_cdecl="sed -n -e 's/^. .* \(.*\)$/extern int \1;/p'" # Transform an extracted symbol line into symbol name and symbol address lt_cv_sys_global_symbol_to_c_name_address="sed -n -e 's/^: \([^ ]*\) $/ {\\\"\1\\\", (lt_ptr) 0},/p' -e 's/^$symcode \([^ ]*\) \([^ ]*\)$/ {\"\2\", (lt_ptr) \&\2},/p'" # Define system-specific variables. case $host_os in aix*) symcode='[BCDT]' ;; cygwin* | mingw* | pw32*) symcode='[ABCDGISTW]' ;; hpux*) # Its linker distinguishes data from code symbols if test "$host_cpu" = ia64; then symcode='[ABCDEGRST]' fi lt_cv_sys_global_symbol_to_cdecl="sed -n -e 's/^T .* \(.*\)$/extern int \1();/p' -e 's/^$symcode* .* \(.*\)$/extern char \1;/p'" lt_cv_sys_global_symbol_to_c_name_address="sed -n -e 's/^: \([^ ]*\) $/ {\\\"\1\\\", (lt_ptr) 0},/p' -e 's/^$symcode* \([^ ]*\) \([^ ]*\)$/ {\"\2\", (lt_ptr) \&\2},/p'" ;; linux*) if test "$host_cpu" = ia64; then symcode='[ABCDGIRSTW]' lt_cv_sys_global_symbol_to_cdecl="sed -n -e 's/^T .* \(.*\)$/extern int \1();/p' -e 's/^$symcode* .* \(.*\)$/extern char \1;/p'" lt_cv_sys_global_symbol_to_c_name_address="sed -n -e 's/^: \([^ ]*\) $/ {\\\"\1\\\", (lt_ptr) 0},/p' -e 's/^$symcode* \([^ ]*\) \([^ ]*\)$/ {\"\2\", (lt_ptr) \&\2},/p'" fi ;; irix* | nonstopux*) symcode='[BCDEGRST]' ;; osf*) symcode='[BCDEGQRST]' ;; solaris* | sysv5*) symcode='[BDRT]' ;; sysv4) symcode='[DFNSTU]' ;; esac # Handle CRLF in mingw tool chain opt_cr= case $build_os in mingw*) opt_cr=`echo 'x\{0,1\}' | tr x '\015'` # option cr in regexp ;; esac # If we're using GNU nm, then use its standard symbol codes. case `$NM -V 2>&1` in *GNU* | *'with BFD'*) symcode='[ABCDGIRSTW]' ;; esac # Try without a prefix undercore, then with it. for ac_symprfx in "" "_"; do # Write the raw and C identifiers. lt_cv_sys_global_symbol_pipe="sed -n -e 's/^.*[ ]\($symcode$symcode*\)[ ][ ]*\($ac_symprfx\)$sympat$opt_cr$/$symxfrm/p'" # Check to see that the pipe works correctly. pipe_works=no rm -f conftest* cat > conftest.$ac_ext <&5 (eval $ac_compile) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; then # Now try to grab the symbols. nlist=conftest.nm if { (eval echo "$as_me:$LINENO: \"$NM conftest.$ac_objext \| $lt_cv_sys_global_symbol_pipe \> $nlist\"") >&5 (eval $NM conftest.$ac_objext \| $lt_cv_sys_global_symbol_pipe \> $nlist) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && test -s "$nlist"; then # Try sorting and uniquifying the output. if sort "$nlist" | uniq > "$nlist"T; then mv -f "$nlist"T "$nlist" else rm -f "$nlist"T fi # Make sure that we snagged all the symbols we need. if grep ' nm_test_var$' "$nlist" >/dev/null; then if grep ' nm_test_func$' "$nlist" >/dev/null; then cat < conftest.$ac_ext #ifdef __cplusplus extern "C" { #endif EOF # Now generate the symbol file. eval "$lt_cv_sys_global_symbol_to_cdecl"' < "$nlist" | grep -v main >> conftest.$ac_ext' cat <> conftest.$ac_ext #if defined (__STDC__) && __STDC__ # define lt_ptr_t void * #else # define lt_ptr_t char * # define const #endif /* The mapping between symbol names and symbols. */ const struct { const char *name; lt_ptr_t address; } lt_preloaded_symbols[] = { EOF $SED "s/^$symcode$symcode* \(.*\) \(.*\)$/ {\"\2\", (lt_ptr_t) \&\2},/" < "$nlist" | grep -v main >> conftest.$ac_ext cat <<\EOF >> conftest.$ac_ext {0, (lt_ptr_t) 0} }; #ifdef __cplusplus } #endif EOF # Now try linking the two files. mv conftest.$ac_objext conftstm.$ac_objext lt_save_LIBS="$LIBS" lt_save_CFLAGS="$CFLAGS" LIBS="conftstm.$ac_objext" CFLAGS="$CFLAGS$lt_prog_compiler_no_builtin_flag" if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && test -s conftest${ac_exeext}; then pipe_works=yes fi LIBS="$lt_save_LIBS" CFLAGS="$lt_save_CFLAGS" else echo "cannot find nm_test_func in $nlist" >&5 fi else echo "cannot find nm_test_var in $nlist" >&5 fi else echo "cannot run $lt_cv_sys_global_symbol_pipe" >&5 fi else echo "$progname: failed program was:" >&5 cat conftest.$ac_ext >&5 fi rm -f conftest* conftst* # Do not use the global_symbol_pipe unless it works. if test "$pipe_works" = yes; then break else lt_cv_sys_global_symbol_pipe= fi done fi if test -z "$lt_cv_sys_global_symbol_pipe"; then lt_cv_sys_global_symbol_to_cdecl= fi if test -z "$lt_cv_sys_global_symbol_pipe$lt_cv_sys_global_symbol_to_cdecl"; then echo "$as_me:$LINENO: result: failed" >&5 echo "${ECHO_T}failed" >&6 else echo "$as_me:$LINENO: result: ok" >&5 echo "${ECHO_T}ok" >&6 fi echo "$as_me:$LINENO: checking for objdir" >&5 echo $ECHO_N "checking for objdir... $ECHO_C" >&6 if test "${lt_cv_objdir+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else rm -f .libs 2>/dev/null mkdir .libs 2>/dev/null if test -d .libs; then lt_cv_objdir=.libs else # MS-DOS does not allow filenames that begin with a dot. lt_cv_objdir=_libs fi rmdir .libs 2>/dev/null fi echo "$as_me:$LINENO: result: $lt_cv_objdir" >&5 echo "${ECHO_T}$lt_cv_objdir" >&6 objdir=$lt_cv_objdir case $host_os in aix3*) # AIX sometimes has problems with the GCC collect2 program. For some # reason, if we set the COLLECT_NAMES environment variable, the problems # vanish in a puff of smoke. if test "X${COLLECT_NAMES+set}" != Xset; then COLLECT_NAMES= export COLLECT_NAMES fi ;; esac # Sed substitution that helps us do robust quoting. It backslashifies # metacharacters that are still active within double-quoted strings. Xsed='sed -e s/^X//' sed_quote_subst='s/\([\\"\\`$\\\\]\)/\\\1/g' # Same as above, but do not quote variable references. double_quote_subst='s/\([\\"\\`\\\\]\)/\\\1/g' # Sed substitution to delay expansion of an escaped shell variable in a # double_quote_subst'ed string. delay_variable_subst='s/\\\\\\\\\\\$/\\\\\\$/g' # Sed substitution to avoid accidental globbing in evaled expressions no_glob_subst='s/\*/\\\*/g' # Constants: rm="rm -f" # Global variables: default_ofile=libtool can_build_shared=yes # All known linkers require a `.a' archive for static linking (except M$VC, # which needs '.lib'). libext=a ltmain="$ac_aux_dir/ltmain.sh" ofile="$default_ofile" with_gnu_ld="$lt_cv_prog_gnu_ld" if test -n "$ac_tool_prefix"; then # Extract the first word of "${ac_tool_prefix}ar", so it can be a program name with args. set dummy ${ac_tool_prefix}ar; ac_word=$2 echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6 if test "${ac_cv_prog_AR+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test -n "$AR"; then ac_cv_prog_AR="$AR" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then ac_cv_prog_AR="${ac_tool_prefix}ar" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done fi fi AR=$ac_cv_prog_AR if test -n "$AR"; then echo "$as_me:$LINENO: result: $AR" >&5 echo "${ECHO_T}$AR" >&6 else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 fi fi if test -z "$ac_cv_prog_AR"; then ac_ct_AR=$AR # Extract the first word of "ar", so it can be a program name with args. set dummy ar; ac_word=$2 echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6 if test "${ac_cv_prog_ac_ct_AR+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test -n "$ac_ct_AR"; then ac_cv_prog_ac_ct_AR="$ac_ct_AR" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then ac_cv_prog_ac_ct_AR="ar" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done test -z "$ac_cv_prog_ac_ct_AR" && ac_cv_prog_ac_ct_AR="false" fi fi ac_ct_AR=$ac_cv_prog_ac_ct_AR if test -n "$ac_ct_AR"; then echo "$as_me:$LINENO: result: $ac_ct_AR" >&5 echo "${ECHO_T}$ac_ct_AR" >&6 else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 fi AR=$ac_ct_AR else AR="$ac_cv_prog_AR" fi if test -n "$ac_tool_prefix"; then # Extract the first word of "${ac_tool_prefix}ranlib", so it can be a program name with args. set dummy ${ac_tool_prefix}ranlib; ac_word=$2 echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6 if test "${ac_cv_prog_RANLIB+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test -n "$RANLIB"; then ac_cv_prog_RANLIB="$RANLIB" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then ac_cv_prog_RANLIB="${ac_tool_prefix}ranlib" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done fi fi RANLIB=$ac_cv_prog_RANLIB if test -n "$RANLIB"; then echo "$as_me:$LINENO: result: $RANLIB" >&5 echo "${ECHO_T}$RANLIB" >&6 else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 fi fi if test -z "$ac_cv_prog_RANLIB"; then ac_ct_RANLIB=$RANLIB # Extract the first word of "ranlib", so it can be a program name with args. set dummy ranlib; ac_word=$2 echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6 if test "${ac_cv_prog_ac_ct_RANLIB+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test -n "$ac_ct_RANLIB"; then ac_cv_prog_ac_ct_RANLIB="$ac_ct_RANLIB" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then ac_cv_prog_ac_ct_RANLIB="ranlib" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done test -z "$ac_cv_prog_ac_ct_RANLIB" && ac_cv_prog_ac_ct_RANLIB=":" fi fi ac_ct_RANLIB=$ac_cv_prog_ac_ct_RANLIB if test -n "$ac_ct_RANLIB"; then echo "$as_me:$LINENO: result: $ac_ct_RANLIB" >&5 echo "${ECHO_T}$ac_ct_RANLIB" >&6 else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 fi RANLIB=$ac_ct_RANLIB else RANLIB="$ac_cv_prog_RANLIB" fi if test -n "$ac_tool_prefix"; then # Extract the first word of "${ac_tool_prefix}strip", so it can be a program name with args. set dummy ${ac_tool_prefix}strip; ac_word=$2 echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6 if test "${ac_cv_prog_STRIP+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test -n "$STRIP"; then ac_cv_prog_STRIP="$STRIP" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then ac_cv_prog_STRIP="${ac_tool_prefix}strip" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done fi fi STRIP=$ac_cv_prog_STRIP if test -n "$STRIP"; then echo "$as_me:$LINENO: result: $STRIP" >&5 echo "${ECHO_T}$STRIP" >&6 else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 fi fi if test -z "$ac_cv_prog_STRIP"; then ac_ct_STRIP=$STRIP # Extract the first word of "strip", so it can be a program name with args. set dummy strip; ac_word=$2 echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6 if test "${ac_cv_prog_ac_ct_STRIP+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test -n "$ac_ct_STRIP"; then ac_cv_prog_ac_ct_STRIP="$ac_ct_STRIP" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then ac_cv_prog_ac_ct_STRIP="strip" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done test -z "$ac_cv_prog_ac_ct_STRIP" && ac_cv_prog_ac_ct_STRIP=":" fi fi ac_ct_STRIP=$ac_cv_prog_ac_ct_STRIP if test -n "$ac_ct_STRIP"; then echo "$as_me:$LINENO: result: $ac_ct_STRIP" >&5 echo "${ECHO_T}$ac_ct_STRIP" >&6 else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 fi STRIP=$ac_ct_STRIP else STRIP="$ac_cv_prog_STRIP" fi old_CC="$CC" old_CFLAGS="$CFLAGS" # Set sane defaults for various variables test -z "$AR" && AR=ar test -z "$AR_FLAGS" && AR_FLAGS=cru test -z "$AS" && AS=as test -z "$CC" && CC=cc test -z "$LTCC" && LTCC=$CC test -z "$DLLTOOL" && DLLTOOL=dlltool test -z "$LD" && LD=ld test -z "$LN_S" && LN_S="ln -s" test -z "$MAGIC_CMD" && MAGIC_CMD=file test -z "$NM" && NM=nm test -z "$SED" && SED=sed test -z "$OBJDUMP" && OBJDUMP=objdump test -z "$RANLIB" && RANLIB=: test -z "$STRIP" && STRIP=: test -z "$ac_objext" && ac_objext=o # Determine commands to create old-style static archives. old_archive_cmds='$AR $AR_FLAGS $oldlib$oldobjs$old_deplibs' old_postinstall_cmds='chmod 644 $oldlib' old_postuninstall_cmds= if test -n "$RANLIB"; then case $host_os in openbsd*) old_postinstall_cmds="\$RANLIB -t \$oldlib~$old_postinstall_cmds" ;; *) old_postinstall_cmds="\$RANLIB \$oldlib~$old_postinstall_cmds" ;; esac old_archive_cmds="$old_archive_cmds~\$RANLIB \$oldlib" fi cc_basename=`$echo X"$compiler" | $Xsed -e 's%^.*/%%'` # Only perform the check for file, if the check method requires it case $deplibs_check_method in file_magic*) if test "$file_magic_cmd" = '$MAGIC_CMD'; then echo "$as_me:$LINENO: checking for ${ac_tool_prefix}file" >&5 echo $ECHO_N "checking for ${ac_tool_prefix}file... $ECHO_C" >&6 if test "${lt_cv_path_MAGIC_CMD+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else case $MAGIC_CMD in [\\/*] | ?:[\\/]*) lt_cv_path_MAGIC_CMD="$MAGIC_CMD" # Let the user override the test with a path. ;; *) lt_save_MAGIC_CMD="$MAGIC_CMD" lt_save_ifs="$IFS"; IFS=$PATH_SEPARATOR ac_dummy="/usr/bin$PATH_SEPARATOR$PATH" for ac_dir in $ac_dummy; do IFS="$lt_save_ifs" test -z "$ac_dir" && ac_dir=. if test -f $ac_dir/${ac_tool_prefix}file; then lt_cv_path_MAGIC_CMD="$ac_dir/${ac_tool_prefix}file" if test -n "$file_magic_test_file"; then case $deplibs_check_method in "file_magic "*) file_magic_regex="`expr \"$deplibs_check_method\" : \"file_magic \(.*\)\"`" MAGIC_CMD="$lt_cv_path_MAGIC_CMD" if eval $file_magic_cmd \$file_magic_test_file 2> /dev/null | $EGREP "$file_magic_regex" > /dev/null; then : else cat <&2 *** Warning: the command libtool uses to detect shared libraries, *** $file_magic_cmd, produces output that libtool cannot recognize. *** The result is that libtool may fail to recognize shared libraries *** as such. This will affect the creation of libtool libraries that *** depend on shared libraries, but programs linked with such libtool *** libraries will work regardless of this problem. Nevertheless, you *** may want to report the problem to your system manager and/or to *** bug-libtool@gnu.org EOF fi ;; esac fi break fi done IFS="$lt_save_ifs" MAGIC_CMD="$lt_save_MAGIC_CMD" ;; esac fi MAGIC_CMD="$lt_cv_path_MAGIC_CMD" if test -n "$MAGIC_CMD"; then echo "$as_me:$LINENO: result: $MAGIC_CMD" >&5 echo "${ECHO_T}$MAGIC_CMD" >&6 else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 fi if test -z "$lt_cv_path_MAGIC_CMD"; then if test -n "$ac_tool_prefix"; then echo "$as_me:$LINENO: checking for file" >&5 echo $ECHO_N "checking for file... $ECHO_C" >&6 if test "${lt_cv_path_MAGIC_CMD+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else case $MAGIC_CMD in [\\/*] | ?:[\\/]*) lt_cv_path_MAGIC_CMD="$MAGIC_CMD" # Let the user override the test with a path. ;; *) lt_save_MAGIC_CMD="$MAGIC_CMD" lt_save_ifs="$IFS"; IFS=$PATH_SEPARATOR ac_dummy="/usr/bin$PATH_SEPARATOR$PATH" for ac_dir in $ac_dummy; do IFS="$lt_save_ifs" test -z "$ac_dir" && ac_dir=. if test -f $ac_dir/file; then lt_cv_path_MAGIC_CMD="$ac_dir/file" if test -n "$file_magic_test_file"; then case $deplibs_check_method in "file_magic "*) file_magic_regex="`expr \"$deplibs_check_method\" : \"file_magic \(.*\)\"`" MAGIC_CMD="$lt_cv_path_MAGIC_CMD" if eval $file_magic_cmd \$file_magic_test_file 2> /dev/null | $EGREP "$file_magic_regex" > /dev/null; then : else cat <&2 *** Warning: the command libtool uses to detect shared libraries, *** $file_magic_cmd, produces output that libtool cannot recognize. *** The result is that libtool may fail to recognize shared libraries *** as such. This will affect the creation of libtool libraries that *** depend on shared libraries, but programs linked with such libtool *** libraries will work regardless of this problem. Nevertheless, you *** may want to report the problem to your system manager and/or to *** bug-libtool@gnu.org EOF fi ;; esac fi break fi done IFS="$lt_save_ifs" MAGIC_CMD="$lt_save_MAGIC_CMD" ;; esac fi MAGIC_CMD="$lt_cv_path_MAGIC_CMD" if test -n "$MAGIC_CMD"; then echo "$as_me:$LINENO: result: $MAGIC_CMD" >&5 echo "${ECHO_T}$MAGIC_CMD" >&6 else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 fi else MAGIC_CMD=: fi fi fi ;; esac enable_dlopen=no enable_win32_dll=no # Check whether --enable-libtool-lock or --disable-libtool-lock was given. if test "${enable_libtool_lock+set}" = set; then enableval="$enable_libtool_lock" fi; test "x$enable_libtool_lock" != xno && enable_libtool_lock=yes # Check whether --with-pic or --without-pic was given. if test "${with_pic+set}" = set; then withval="$with_pic" pic_mode="$withval" else pic_mode=default fi; test -z "$pic_mode" && pic_mode=default # Use C for the default configuration in the libtool script tagname= lt_save_CC="$CC" ac_ext=c ac_cpp='$CPP $CPPFLAGS' ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' ac_compiler_gnu=$ac_cv_c_compiler_gnu # Source file extension for C test sources. ac_ext=c # Object file extension for compiled C test sources. objext=o objext=$objext # Code to be used in simple compile tests lt_simple_compile_test_code="int some_variable = 0;\n" # Code to be used in simple link tests lt_simple_link_test_code='int main(){return(0);}\n' # If no C compiler was specified, use CC. LTCC=${LTCC-"$CC"} # Allow CC to be a program name with arguments. compiler=$CC # # Check for any special shared library compilation flags. # lt_prog_cc_shlib= if test "$GCC" = no; then case $host_os in sco3.2v5*) lt_prog_cc_shlib='-belf' ;; esac fi if test -n "$lt_prog_cc_shlib"; then { echo "$as_me:$LINENO: WARNING: \`$CC' requires \`$lt_prog_cc_shlib' to build shared libraries" >&5 echo "$as_me: WARNING: \`$CC' requires \`$lt_prog_cc_shlib' to build shared libraries" >&2;} if echo "$old_CC $old_CFLAGS " | grep "[ ]$lt_prog_cc_shlib[ ]" >/dev/null; then : else { echo "$as_me:$LINENO: WARNING: add \`$lt_prog_cc_shlib' to the CC or CFLAGS env variable and reconfigure" >&5 echo "$as_me: WARNING: add \`$lt_prog_cc_shlib' to the CC or CFLAGS env variable and reconfigure" >&2;} lt_cv_prog_cc_can_build_shared=no fi fi # # Check to make sure the static flag actually works. # echo "$as_me:$LINENO: checking if $compiler static flag $lt_prog_compiler_static works" >&5 echo $ECHO_N "checking if $compiler static flag $lt_prog_compiler_static works... $ECHO_C" >&6 if test "${lt_prog_compiler_static_works+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else lt_prog_compiler_static_works=no save_LDFLAGS="$LDFLAGS" LDFLAGS="$LDFLAGS $lt_prog_compiler_static" printf "$lt_simple_link_test_code" > conftest.$ac_ext if (eval $ac_link 2>conftest.err) && test -s conftest$ac_exeext; then # The compiler can only warn and ignore the option if not recognized # So say no if there are warnings if test -s conftest.err; then # Append any errors to the config.log. cat conftest.err 1>&5 else lt_prog_compiler_static_works=yes fi fi $rm conftest* LDFLAGS="$save_LDFLAGS" fi echo "$as_me:$LINENO: result: $lt_prog_compiler_static_works" >&5 echo "${ECHO_T}$lt_prog_compiler_static_works" >&6 if test x"$lt_prog_compiler_static_works" = xyes; then : else lt_prog_compiler_static= fi lt_prog_compiler_no_builtin_flag= if test "$GCC" = yes; then lt_prog_compiler_no_builtin_flag=' -fno-builtin' echo "$as_me:$LINENO: checking if $compiler supports -fno-rtti -fno-exceptions" >&5 echo $ECHO_N "checking if $compiler supports -fno-rtti -fno-exceptions... $ECHO_C" >&6 if test "${lt_cv_prog_compiler_rtti_exceptions+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else lt_cv_prog_compiler_rtti_exceptions=no ac_outfile=conftest.$ac_objext printf "$lt_simple_compile_test_code" > conftest.$ac_ext lt_compiler_flag="-fno-rtti -fno-exceptions" # Insert the option either (1) after the last *FLAGS variable, or # (2) before a word containing "conftest.", or (3) at the end. # Note that $ac_compile itself does not contain backslashes and begins # with a dollar sign (not a hyphen), so the echo should work correctly. # The option is referenced via a variable to avoid confusing sed. lt_compile=`echo "$ac_compile" | $SED \ -e 's:.*FLAGS}? :&$lt_compiler_flag :; t' \ -e 's: [^ ]*conftest\.: $lt_compiler_flag&:; t' \ -e 's:$: $lt_compiler_flag:'` (eval echo "\"\$as_me:6415: $lt_compile\"" >&5) (eval "$lt_compile" 2>conftest.err) ac_status=$? cat conftest.err >&5 echo "$as_me:6419: \$? = $ac_status" >&5 if (exit $ac_status) && test -s "$ac_outfile"; then # The compiler can only warn and ignore the option if not recognized # So say no if there are warnings if test ! -s conftest.err; then lt_cv_prog_compiler_rtti_exceptions=yes fi fi $rm conftest* fi echo "$as_me:$LINENO: result: $lt_cv_prog_compiler_rtti_exceptions" >&5 echo "${ECHO_T}$lt_cv_prog_compiler_rtti_exceptions" >&6 if test x"$lt_cv_prog_compiler_rtti_exceptions" = xyes; then lt_prog_compiler_no_builtin_flag="$lt_prog_compiler_no_builtin_flag -fno-rtti -fno-exceptions" else : fi fi lt_prog_compiler_wl= lt_prog_compiler_pic= lt_prog_compiler_static= echo "$as_me:$LINENO: checking for $compiler option to produce PIC" >&5 echo $ECHO_N "checking for $compiler option to produce PIC... $ECHO_C" >&6 if test "$GCC" = yes; then lt_prog_compiler_wl='-Wl,' lt_prog_compiler_static='-static' case $host_os in aix*) # All AIX code is PIC. if test "$host_cpu" = ia64; then # AIX 5 now supports IA64 processor lt_prog_compiler_static='-Bstatic' fi ;; amigaos*) # FIXME: we need at least 68020 code to build shared libraries, but # adding the `-m68020' flag to GCC prevents building anything better, # like `-m68040'. lt_prog_compiler_pic='-m68020 -resident32 -malways-restore-a4' ;; beos* | cygwin* | irix5* | irix6* | nonstopux* | osf3* | osf4* | osf5*) # PIC is the default for these OSes. ;; mingw* | pw32* | os2*) # This hack is so that the source file can tell whether it is being # built for inclusion in a dll (and should export symbols for example). lt_prog_compiler_pic='-DDLL_EXPORT' ;; darwin* | rhapsody*) # PIC is the default on this platform # Common symbols not allowed in MH_DYLIB files lt_prog_compiler_pic='-fno-common' ;; msdosdjgpp*) # Just because we use GCC doesn't mean we suddenly get shared libraries # on systems that don't support them. lt_prog_compiler_can_build_shared=no enable_shared=no ;; sysv4*MP*) if test -d /usr/nec; then lt_prog_compiler_pic=-Kconform_pic fi ;; hpux*) # PIC is the default for IA64 HP-UX and 64-bit HP-UX, but # not for PA HP-UX. case "$host_cpu" in hppa*64*|ia64*) # +Z the default ;; *) lt_prog_compiler_pic='-fPIC' ;; esac ;; *) lt_prog_compiler_pic='-fPIC' ;; esac else # PORTME Check for flag to pass linker flags through the system compiler. case $host_os in aix*) lt_prog_compiler_wl='-Wl,' if test "$host_cpu" = ia64; then # AIX 5 now supports IA64 processor lt_prog_compiler_static='-Bstatic' else lt_prog_compiler_static='-bnso -bI:/lib/syscalls.exp' fi ;; darwin*) # PIC is the default on this platform # Common symbols not allowed in MH_DYLIB files case "$cc_basename" in xlc*) lt_prog_compiler_pic='-qnocommon' lt_prog_compiler_wl='-Wl,' ;; esac ;; mingw* | pw32* | os2*) # This hack is so that the source file can tell whether it is being # built for inclusion in a dll (and should export symbols for example). lt_prog_compiler_pic='-DDLL_EXPORT' ;; hpux9* | hpux10* | hpux11*) lt_prog_compiler_wl='-Wl,' # PIC is the default for IA64 HP-UX and 64-bit HP-UX, but # not for PA HP-UX. case "$host_cpu" in hppa*64*|ia64*) # +Z the default ;; *) lt_prog_compiler_pic='+Z' ;; esac # Is there a better lt_prog_compiler_static that works with the bundled CC? lt_prog_compiler_static='${wl}-a ${wl}archive' ;; irix5* | irix6* | nonstopux*) lt_prog_compiler_wl='-Wl,' # PIC (with -KPIC) is the default. lt_prog_compiler_static='-non_shared' ;; newsos6) lt_prog_compiler_pic='-KPIC' lt_prog_compiler_static='-Bstatic' ;; linux*) case $CC in icc* | ecc*) lt_prog_compiler_wl='-Wl,' lt_prog_compiler_pic='-KPIC' lt_prog_compiler_static='-static' ;; ccc*) lt_prog_compiler_wl='-Wl,' # All Alpha code is PIC. lt_prog_compiler_static='-non_shared' ;; esac ;; osf3* | osf4* | osf5*) lt_prog_compiler_wl='-Wl,' # All OSF/1 code is PIC. lt_prog_compiler_static='-non_shared' ;; sco3.2v5*) lt_prog_compiler_pic='-Kpic' lt_prog_compiler_static='-dn' ;; solaris*) lt_prog_compiler_wl='-Wl,' lt_prog_compiler_pic='-KPIC' lt_prog_compiler_static='-Bstatic' ;; sunos4*) lt_prog_compiler_wl='-Qoption ld ' lt_prog_compiler_pic='-PIC' lt_prog_compiler_static='-Bstatic' ;; sysv4 | sysv4.2uw2* | sysv4.3* | sysv5*) lt_prog_compiler_wl='-Wl,' lt_prog_compiler_pic='-KPIC' lt_prog_compiler_static='-Bstatic' ;; sysv4*MP*) if test -d /usr/nec ;then lt_prog_compiler_pic='-Kconform_pic' lt_prog_compiler_static='-Bstatic' fi ;; uts4*) lt_prog_compiler_pic='-pic' lt_prog_compiler_static='-Bstatic' ;; *) lt_prog_compiler_can_build_shared=no ;; esac fi echo "$as_me:$LINENO: result: $lt_prog_compiler_pic" >&5 echo "${ECHO_T}$lt_prog_compiler_pic" >&6 # # Check to make sure the PIC flag actually works. # if test -n "$lt_prog_compiler_pic"; then echo "$as_me:$LINENO: checking if $compiler PIC flag $lt_prog_compiler_pic works" >&5 echo $ECHO_N "checking if $compiler PIC flag $lt_prog_compiler_pic works... $ECHO_C" >&6 if test "${lt_prog_compiler_pic_works+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else lt_prog_compiler_pic_works=no ac_outfile=conftest.$ac_objext printf "$lt_simple_compile_test_code" > conftest.$ac_ext lt_compiler_flag="$lt_prog_compiler_pic -DPIC" # Insert the option either (1) after the last *FLAGS variable, or # (2) before a word containing "conftest.", or (3) at the end. # Note that $ac_compile itself does not contain backslashes and begins # with a dollar sign (not a hyphen), so the echo should work correctly. # The option is referenced via a variable to avoid confusing sed. lt_compile=`echo "$ac_compile" | $SED \ -e 's:.*FLAGS}? :&$lt_compiler_flag :; t' \ -e 's: [^ ]*conftest\.: $lt_compiler_flag&:; t' \ -e 's:$: $lt_compiler_flag:'` (eval echo "\"\$as_me:6658: $lt_compile\"" >&5) (eval "$lt_compile" 2>conftest.err) ac_status=$? cat conftest.err >&5 echo "$as_me:6662: \$? = $ac_status" >&5 if (exit $ac_status) && test -s "$ac_outfile"; then # The compiler can only warn and ignore the option if not recognized # So say no if there are warnings if test ! -s conftest.err; then lt_prog_compiler_pic_works=yes fi fi $rm conftest* fi echo "$as_me:$LINENO: result: $lt_prog_compiler_pic_works" >&5 echo "${ECHO_T}$lt_prog_compiler_pic_works" >&6 if test x"$lt_prog_compiler_pic_works" = xyes; then case $lt_prog_compiler_pic in "" | " "*) ;; *) lt_prog_compiler_pic=" $lt_prog_compiler_pic" ;; esac else lt_prog_compiler_pic= lt_prog_compiler_can_build_shared=no fi fi case "$host_os" in # For platforms which do not support PIC, -DPIC is meaningless: *djgpp*) lt_prog_compiler_pic= ;; *) lt_prog_compiler_pic="$lt_prog_compiler_pic -DPIC" ;; esac echo "$as_me:$LINENO: checking if $compiler supports -c -o file.$ac_objext" >&5 echo $ECHO_N "checking if $compiler supports -c -o file.$ac_objext... $ECHO_C" >&6 if test "${lt_cv_prog_compiler_c_o+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else lt_cv_prog_compiler_c_o=no $rm -r conftest 2>/dev/null mkdir conftest cd conftest mkdir out printf "$lt_simple_compile_test_code" > conftest.$ac_ext lt_compiler_flag="-o out/conftest2.$ac_objext" # Insert the option either (1) after the last *FLAGS variable, or # (2) before a word containing "conftest.", or (3) at the end. # Note that $ac_compile itself does not contain backslashes and begins # with a dollar sign (not a hyphen), so the echo should work correctly. lt_compile=`echo "$ac_compile" | $SED \ -e 's:.*FLAGS}? :&$lt_compiler_flag :; t' \ -e 's: [^ ]*conftest\.: $lt_compiler_flag&:; t' \ -e 's:$: $lt_compiler_flag:'` (eval echo "\"\$as_me:6718: $lt_compile\"" >&5) (eval "$lt_compile" 2>out/conftest.err) ac_status=$? cat out/conftest.err >&5 echo "$as_me:6722: \$? = $ac_status" >&5 if (exit $ac_status) && test -s out/conftest2.$ac_objext then # The compiler can only warn and ignore the option if not recognized # So say no if there are warnings if test ! -s out/conftest.err; then lt_cv_prog_compiler_c_o=yes fi fi chmod u+w . $rm conftest* # SGI C++ compiler will create directory out/ii_files/ for # template instantiation test -d out/ii_files && $rm out/ii_files/* && rmdir out/ii_files $rm out/* && rmdir out cd .. rmdir conftest $rm conftest* fi echo "$as_me:$LINENO: result: $lt_cv_prog_compiler_c_o" >&5 echo "${ECHO_T}$lt_cv_prog_compiler_c_o" >&6 hard_links="nottested" if test "$lt_cv_prog_compiler_c_o" = no && test "$need_locks" != no; then # do not overwrite the value of need_locks provided by the user echo "$as_me:$LINENO: checking if we can lock with hard links" >&5 echo $ECHO_N "checking if we can lock with hard links... $ECHO_C" >&6 hard_links=yes $rm conftest* ln conftest.a conftest.b 2>/dev/null && hard_links=no touch conftest.a ln conftest.a conftest.b 2>&5 || hard_links=no ln conftest.a conftest.b 2>/dev/null && hard_links=no echo "$as_me:$LINENO: result: $hard_links" >&5 echo "${ECHO_T}$hard_links" >&6 if test "$hard_links" = no; then { echo "$as_me:$LINENO: WARNING: \`$CC' does not support \`-c -o', so \`make -j' may be unsafe" >&5 echo "$as_me: WARNING: \`$CC' does not support \`-c -o', so \`make -j' may be unsafe" >&2;} need_locks=warn fi else need_locks=no fi echo "$as_me:$LINENO: checking whether the $compiler linker ($LD) supports shared libraries" >&5 echo $ECHO_N "checking whether the $compiler linker ($LD) supports shared libraries... $ECHO_C" >&6 runpath_var= allow_undefined_flag= enable_shared_with_static_runtimes=no archive_cmds= archive_expsym_cmds= old_archive_From_new_cmds= old_archive_from_expsyms_cmds= export_dynamic_flag_spec= whole_archive_flag_spec= thread_safe_flag_spec= hardcode_libdir_flag_spec= hardcode_libdir_flag_spec_ld= hardcode_libdir_separator= hardcode_direct=no hardcode_minus_L=no hardcode_shlibpath_var=unsupported link_all_deplibs=unknown hardcode_automatic=no module_cmds= module_expsym_cmds= always_export_symbols=no export_symbols_cmds='$NM $libobjs $convenience | $global_symbol_pipe | $SED '\''s/.* //'\'' | sort | uniq > $export_symbols' # include_expsyms should be a list of space-separated symbols to be *always* # included in the symbol list include_expsyms= # exclude_expsyms can be an extended regexp of symbols to exclude # it will be wrapped by ` (' and `)$', so one must not match beginning or # end of line. Example: `a|bc|.*d.*' will exclude the symbols `a' and `bc', # as well as any symbol that contains `d'. exclude_expsyms="_GLOBAL_OFFSET_TABLE_" # Although _GLOBAL_OFFSET_TABLE_ is a valid symbol C name, most a.out # platforms (ab)use it in PIC code, but their linkers get confused if # the symbol is explicitly referenced. Since portable code cannot # rely on this symbol name, it's probably fine to never include it in # preloaded symbol tables. extract_expsyms_cmds= case $host_os in cygwin* | mingw* | pw32*) # FIXME: the MSVC++ port hasn't been tested in a loooong time # When not using gcc, we currently assume that we are using # Microsoft Visual C++. if test "$GCC" != yes; then with_gnu_ld=no fi ;; openbsd*) with_gnu_ld=no ;; esac ld_shlibs=yes if test "$with_gnu_ld" = yes; then # If archive_cmds runs LD, not CC, wlarc should be empty wlarc='${wl}' # See if GNU ld supports shared libraries. case $host_os in aix3* | aix4* | aix5*) # On AIX/PPC, the GNU linker is very broken if test "$host_cpu" != ia64; then ld_shlibs=no cat <&2 *** Warning: the GNU linker, at least up to release 2.9.1, is reported *** to be unable to reliably create shared libraries on AIX. *** Therefore, libtool is disabling shared libraries support. If you *** really care for shared libraries, you may want to modify your PATH *** so that a non-GNU linker is found, and then restart. EOF fi ;; amigaos*) archive_cmds='$rm $output_objdir/a2ixlibrary.data~$echo "#define NAME $libname" > $output_objdir/a2ixlibrary.data~$echo "#define LIBRARY_ID 1" >> $output_objdir/a2ixlibrary.data~$echo "#define VERSION $major" >> $output_objdir/a2ixlibrary.data~$echo "#define REVISION $revision" >> $output_objdir/a2ixlibrary.data~$AR $AR_FLAGS $lib $libobjs~$RANLIB $lib~(cd $output_objdir && a2ixlibrary -32)' hardcode_libdir_flag_spec='-L$libdir' hardcode_minus_L=yes # Samuel A. Falvo II reports # that the semantics of dynamic libraries on AmigaOS, at least up # to version 4, is to share data among multiple programs linked # with the same dynamic library. Since this doesn't match the # behavior of shared libraries on other platforms, we can't use # them. ld_shlibs=no ;; beos*) if $LD --help 2>&1 | grep ': supported targets:.* elf' > /dev/null; then allow_undefined_flag=unsupported # Joseph Beckenbach says some releases of gcc # support --undefined. This deserves some investigation. FIXME archive_cmds='$CC -nostart $libobjs $deplibs $compiler_flags ${wl}-soname $wl$soname -o $lib' else ld_shlibs=no fi ;; cygwin* | mingw* | pw32*) # _LT_AC_TAGVAR(hardcode_libdir_flag_spec, ) is actually meaningless, # as there is no search path for DLLs. hardcode_libdir_flag_spec='-L$libdir' allow_undefined_flag=unsupported always_export_symbols=no enable_shared_with_static_runtimes=yes export_symbols_cmds='$NM $libobjs $convenience | $global_symbol_pipe | $SED -e '\''/^[BCDGS] /s/.* \([^ ]*\)/\1 DATA/'\'' | $SED -e '\''/^[AITW] /s/.* //'\'' | sort | uniq > $export_symbols' if $LD --help 2>&1 | grep 'auto-import' > /dev/null; then archive_cmds='$CC -shared $libobjs $deplibs $compiler_flags -o $output_objdir/$soname ${wl}--image-base=0x10000000 ${wl}--out-implib,$lib' # If the export-symbols file already is a .def file (1st line # is EXPORTS), use it as is; otherwise, prepend... archive_expsym_cmds='if test "x`$SED 1q $export_symbols`" = xEXPORTS; then cp $export_symbols $output_objdir/$soname.def; else echo EXPORTS > $output_objdir/$soname.def; cat $export_symbols >> $output_objdir/$soname.def; fi~ $CC -shared $output_objdir/$soname.def $libobjs $deplibs $compiler_flags -o $output_objdir/$soname ${wl}--image-base=0x10000000 ${wl}--out-implib,$lib' else ld_shlibs=no fi ;; netbsd*) if echo __ELF__ | $CC -E - | grep __ELF__ >/dev/null; then archive_cmds='$LD -Bshareable $libobjs $deplibs $linker_flags -o $lib' wlarc= else archive_cmds='$CC -shared $libobjs $deplibs $compiler_flags ${wl}-soname $wl$soname -o $lib' archive_expsym_cmds='$CC -shared $libobjs $deplibs $compiler_flags ${wl}-soname $wl$soname ${wl}-retain-symbols-file $wl$export_symbols -o $lib' fi ;; solaris* | sysv5*) if $LD -v 2>&1 | grep 'BFD 2\.8' > /dev/null; then ld_shlibs=no cat <&2 *** Warning: The releases 2.8.* of the GNU linker cannot reliably *** create shared libraries on Solaris systems. Therefore, libtool *** is disabling shared libraries support. We urge you to upgrade GNU *** binutils to release 2.9.1 or newer. Another option is to modify *** your PATH or compiler configuration so that the native linker is *** used, and then restart. EOF elif $LD --help 2>&1 | grep ': supported targets:.* elf' > /dev/null; then archive_cmds='$CC -shared $libobjs $deplibs $compiler_flags ${wl}-soname $wl$soname -o $lib' archive_expsym_cmds='$CC -shared $libobjs $deplibs $compiler_flags ${wl}-soname $wl$soname ${wl}-retain-symbols-file $wl$export_symbols -o $lib' else ld_shlibs=no fi ;; sunos4*) archive_cmds='$LD -assert pure-text -Bshareable -o $lib $libobjs $deplibs $linker_flags' wlarc= hardcode_direct=yes hardcode_shlibpath_var=no ;; linux*) if $LD --help 2>&1 | grep ': supported targets:.* elf' > /dev/null; then tmp_archive_cmds='$CC -shared $libobjs $deplibs $compiler_flags ${wl}-soname $wl$soname -o $lib' archive_cmds="$tmp_archive_cmds" supports_anon_versioning=no case `$LD -v 2>/dev/null` in *\ 01.* | *\ 2.[0-9].* | *\ 2.10.*) ;; # catch versions < 2.11 *\ 2.11.93.0.2\ *) supports_anon_versioning=yes ;; # RH7.3 ... *\ 2.11.92.0.12\ *) supports_anon_versioning=yes ;; # Mandrake 8.2 ... *\ 2.11.*) ;; # other 2.11 versions *) supports_anon_versioning=yes ;; esac if test $supports_anon_versioning = yes; then archive_expsym_cmds='$echo "{ global:" > $output_objdir/$libname.ver~ cat $export_symbols | sed -e "s/\(.*\)/\1;/" >> $output_objdir/$libname.ver~ $echo "local: *; };" >> $output_objdir/$libname.ver~ $CC -shared $libobjs $deplibs $compiler_flags ${wl}-soname $wl$soname ${wl}-version-script ${wl}$output_objdir/$libname.ver -o $lib' else archive_expsym_cmds="$tmp_archive_cmds" fi else ld_shlibs=no fi ;; *) if $LD --help 2>&1 | grep ': supported targets:.* elf' > /dev/null; then archive_cmds='$CC -shared $libobjs $deplibs $compiler_flags ${wl}-soname $wl$soname -o $lib' archive_expsym_cmds='$CC -shared $libobjs $deplibs $compiler_flags ${wl}-soname $wl$soname ${wl}-retain-symbols-file $wl$export_symbols -o $lib' else ld_shlibs=no fi ;; esac if test "$ld_shlibs" = yes; then runpath_var=LD_RUN_PATH hardcode_libdir_flag_spec='${wl}--rpath ${wl}$libdir' export_dynamic_flag_spec='${wl}--export-dynamic' # ancient GNU ld didn't support --whole-archive et. al. if $LD --help 2>&1 | grep 'no-whole-archive' > /dev/null; then whole_archive_flag_spec="$wlarc"'--whole-archive$convenience '"$wlarc"'--no-whole-archive' else whole_archive_flag_spec= fi fi else # PORTME fill in a description of your system's linker (not GNU ld) case $host_os in aix3*) allow_undefined_flag=unsupported always_export_symbols=yes archive_expsym_cmds='$LD -o $output_objdir/$soname $libobjs $deplibs $linker_flags -bE:$export_symbols -T512 -H512 -bM:SRE~$AR $AR_FLAGS $lib $output_objdir/$soname' # Note: this linker hardcodes the directories in LIBPATH if there # are no directories specified by -L. hardcode_minus_L=yes if test "$GCC" = yes && test -z "$link_static_flag"; then # Neither direct hardcoding nor static linking is supported with a # broken collect2. hardcode_direct=unsupported fi ;; aix4* | aix5*) if test "$host_cpu" = ia64; then # On IA64, the linker does run time linking by default, so we don't # have to do anything special. aix_use_runtimelinking=no exp_sym_flag='-Bexport' no_entry_flag="" else # If we're using GNU nm, then we don't want the "-C" option. # -C means demangle to AIX nm, but means don't demangle with GNU nm if $NM -V 2>&1 | grep 'GNU' > /dev/null; then export_symbols_cmds='$NM -Bpg $libobjs $convenience | awk '\''{ if (((\$2 == "T") || (\$2 == "D") || (\$2 == "B")) && (substr(\$3,1,1) != ".")) { print \$3 } }'\'' | sort -u > $export_symbols' else export_symbols_cmds='$NM -BCpg $libobjs $convenience | awk '\''{ if (((\$2 == "T") || (\$2 == "D") || (\$2 == "B")) && (substr(\$3,1,1) != ".")) { print \$3 } }'\'' | sort -u > $export_symbols' fi aix_use_runtimelinking=no # Test if we are trying to use run time linking or normal # AIX style linking. If -brtl is somewhere in LDFLAGS, we # need to do runtime linking. case $host_os in aix4.[23]|aix4.[23].*|aix5*) for ld_flag in $LDFLAGS; do if (test $ld_flag = "-brtl" || test $ld_flag = "-Wl,-brtl"); then aix_use_runtimelinking=yes break fi done esac exp_sym_flag='-bexport' no_entry_flag='-bnoentry' fi # When large executables or shared objects are built, AIX ld can # have problems creating the table of contents. If linking a library # or program results in "error TOC overflow" add -mminimal-toc to # CXXFLAGS/CFLAGS for g++/gcc. In the cases where that is not # enough to fix the problem, add -Wl,-bbigtoc to LDFLAGS. archive_cmds='' hardcode_direct=yes hardcode_libdir_separator=':' link_all_deplibs=yes if test "$GCC" = yes; then case $host_os in aix4.012|aix4.012.*) # We only want to do this on AIX 4.2 and lower, the check # below for broken collect2 doesn't work under 4.3+ collect2name=`${CC} -print-prog-name=collect2` if test -f "$collect2name" && \ strings "$collect2name" | grep resolve_lib_name >/dev/null then # We have reworked collect2 hardcode_direct=yes else # We have old collect2 hardcode_direct=unsupported # It fails to find uninstalled libraries when the uninstalled # path is not listed in the libpath. Setting hardcode_minus_L # to unsupported forces relinking hardcode_minus_L=yes hardcode_libdir_flag_spec='-L$libdir' hardcode_libdir_separator= fi esac shared_flag='-shared' else # not using gcc if test "$host_cpu" = ia64; then # VisualAge C++, Version 5.5 for AIX 5L for IA-64, Beta 3 Release # chokes on -Wl,-G. The following line is correct: shared_flag='-G' else if test "$aix_use_runtimelinking" = yes; then shared_flag='${wl}-G' else shared_flag='${wl}-bM:SRE' fi fi fi # It seems that -bexpall does not export symbols beginning with # underscore (_), so it is better to generate a list of symbols to export. always_export_symbols=yes if test "$aix_use_runtimelinking" = yes; then # Warning - without using the other runtime loading flags (-brtl), # -berok will link without error, but may produce a broken library. allow_undefined_flag='-berok' # Determine the default libpath from the value encoded in an empty executable. cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ int main () { ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then aix_libpath=`dump -H conftest$ac_exeext 2>/dev/null | $SED -n -e '/Import File Strings/,/^$/ { /^0/ { s/^0 *\(.*\)$/\1/; p; } }'` # Check for a 64-bit object if we didn't find anything. if test -z "$aix_libpath"; then aix_libpath=`dump -HX64 conftest$ac_exeext 2>/dev/null | $SED -n -e '/Import File Strings/,/^$/ { /^0/ { s/^0 *\(.*\)$/\1/; p; } }'`; fi else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 fi rm -f conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext if test -z "$aix_libpath"; then aix_libpath="/usr/lib:/lib"; fi hardcode_libdir_flag_spec='${wl}-blibpath:$libdir:'"$aix_libpath" archive_expsym_cmds="\$CC"' -o $output_objdir/$soname $libobjs $deplibs $compiler_flags `if test "x${allow_undefined_flag}" != "x"; then echo "${wl}${allow_undefined_flag}"; else :; fi` '"\${wl}$no_entry_flag \${wl}$exp_sym_flag:\$export_symbols $shared_flag" else if test "$host_cpu" = ia64; then hardcode_libdir_flag_spec='${wl}-R $libdir:/usr/lib:/lib' allow_undefined_flag="-z nodefs" archive_expsym_cmds="\$CC $shared_flag"' -o $output_objdir/$soname $libobjs $deplibs $compiler_flags ${wl}${allow_undefined_flag} '"\${wl}$no_entry_flag \${wl}$exp_sym_flag:\$export_symbols" else # Determine the default libpath from the value encoded in an empty executable. cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ int main () { ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then aix_libpath=`dump -H conftest$ac_exeext 2>/dev/null | $SED -n -e '/Import File Strings/,/^$/ { /^0/ { s/^0 *\(.*\)$/\1/; p; } }'` # Check for a 64-bit object if we didn't find anything. if test -z "$aix_libpath"; then aix_libpath=`dump -HX64 conftest$ac_exeext 2>/dev/null | $SED -n -e '/Import File Strings/,/^$/ { /^0/ { s/^0 *\(.*\)$/\1/; p; } }'`; fi else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 fi rm -f conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext if test -z "$aix_libpath"; then aix_libpath="/usr/lib:/lib"; fi hardcode_libdir_flag_spec='${wl}-blibpath:$libdir:'"$aix_libpath" # Warning - without using the other run time loading flags, # -berok will link without error, but may produce a broken library. no_undefined_flag=' ${wl}-bernotok' allow_undefined_flag=' ${wl}-berok' # -bexpall does not export symbols beginning with underscore (_) always_export_symbols=yes # Exported symbols can be pulled into shared objects from archives whole_archive_flag_spec=' ' archive_cmds_need_lc=yes # This is similar to how AIX traditionally builds it's shared libraries. archive_expsym_cmds="\$CC $shared_flag"' -o $output_objdir/$soname $libobjs $deplibs $compiler_flags ${wl}-bE:$export_symbols ${wl}-bnoentry${allow_undefined_flag}~$AR $AR_FLAGS $output_objdir/$libname$release.a $output_objdir/$soname' fi fi ;; amigaos*) archive_cmds='$rm $output_objdir/a2ixlibrary.data~$echo "#define NAME $libname" > $output_objdir/a2ixlibrary.data~$echo "#define LIBRARY_ID 1" >> $output_objdir/a2ixlibrary.data~$echo "#define VERSION $major" >> $output_objdir/a2ixlibrary.data~$echo "#define REVISION $revision" >> $output_objdir/a2ixlibrary.data~$AR $AR_FLAGS $lib $libobjs~$RANLIB $lib~(cd $output_objdir && a2ixlibrary -32)' hardcode_libdir_flag_spec='-L$libdir' hardcode_minus_L=yes # see comment about different semantics on the GNU ld section ld_shlibs=no ;; bsdi[45]*) export_dynamic_flag_spec=-rdynamic ;; cygwin* | mingw* | pw32*) # When not using gcc, we currently assume that we are using # Microsoft Visual C++. # hardcode_libdir_flag_spec is actually meaningless, as there is # no search path for DLLs. hardcode_libdir_flag_spec=' ' allow_undefined_flag=unsupported # Tell ltmain to make .lib files, not .a files. libext=lib # Tell ltmain to make .dll files, not .so files. shrext_cmds=".dll" # FIXME: Setting linknames here is a bad hack. archive_cmds='$CC -o $lib $libobjs $compiler_flags `echo "$deplibs" | $SED -e '\''s/ -lc$//'\''` -link -dll~linknames=' # The linker will automatically build a .lib file if we build a DLL. old_archive_From_new_cmds='true' # FIXME: Should let the user specify the lib program. old_archive_cmds='lib /OUT:$oldlib$oldobjs$old_deplibs' fix_srcfile_path='`cygpath -w "$srcfile"`' enable_shared_with_static_runtimes=yes ;; darwin* | rhapsody*) case "$host_os" in rhapsody* | darwin1.[012]) allow_undefined_flag='${wl}-undefined ${wl}suppress' ;; *) # Darwin 1.3 on if test -z ${MACOSX_DEPLOYMENT_TARGET} ; then allow_undefined_flag='${wl}-flat_namespace ${wl}-undefined ${wl}suppress' else case ${MACOSX_DEPLOYMENT_TARGET} in 10.[012]) allow_undefined_flag='${wl}-flat_namespace ${wl}-undefined ${wl}suppress' ;; 10.*) allow_undefined_flag='${wl}-undefined ${wl}dynamic_lookup' ;; esac fi ;; esac archive_cmds_need_lc=no hardcode_direct=no hardcode_automatic=yes hardcode_shlibpath_var=unsupported whole_archive_flag_spec='' link_all_deplibs=yes if test "$GCC" = yes ; then output_verbose_link_cmd='echo' archive_cmds='$CC -dynamiclib $allow_undefined_flag -o $lib $libobjs $deplibs $compiler_flags -install_name $rpath/$soname $verstring' module_cmds='$CC $allow_undefined_flag -o $lib -bundle $libobjs $deplibs$compiler_flags' # Don't fix this by using the ld -exported_symbols_list flag, it doesn't exist in older darwin ld's archive_expsym_cmds='sed -e "s,#.*,," -e "s,^[ ]*,," -e "s,^\(..*\),_&," < $export_symbols > $output_objdir/${libname}-symbols.expsym~$CC -dynamiclib $allow_undefined_flag -o $lib $libobjs $deplibs $compiler_flags -install_name $rpath/$soname $verstring~nmedit -s $output_objdir/${libname}-symbols.expsym ${lib}' module_expsym_cmds='sed -e "s,#.*,," -e "s,^[ ]*,," -e "s,^\(..*\),_&," < $export_symbols > $output_objdir/${libname}-symbols.expsym~$CC $allow_undefined_flag -o $lib -bundle $libobjs $deplibs$compiler_flags~nmedit -s $output_objdir/${libname}-symbols.expsym ${lib}' else case "$cc_basename" in xlc*) output_verbose_link_cmd='echo' archive_cmds='$CC -qmkshrobj $allow_undefined_flag -o $lib $libobjs $deplibs $compiler_flags ${wl}-install_name ${wl}`echo $rpath/$soname` $verstring' module_cmds='$CC $allow_undefined_flag -o $lib -bundle $libobjs $deplibs$compiler_flags' # Don't fix this by using the ld -exported_symbols_list flag, it doesn't exist in older darwin ld's archive_expsym_cmds='sed -e "s,#.*,," -e "s,^[ ]*,," -e "s,^\(..*\),_&," < $export_symbols > $output_objdir/${libname}-symbols.expsym~$CC -qmkshrobj $allow_undefined_flag -o $lib $libobjs $deplibs $compiler_flags ${wl}-install_name ${wl}$rpath/$soname $verstring~nmedit -s $output_objdir/${libname}-symbols.expsym ${lib}' module_expsym_cmds='sed -e "s,#.*,," -e "s,^[ ]*,," -e "s,^\(..*\),_&," < $export_symbols > $output_objdir/${libname}-symbols.expsym~$CC $allow_undefined_flag -o $lib -bundle $libobjs $deplibs$compiler_flags~nmedit -s $output_objdir/${libname}-symbols.expsym ${lib}' ;; *) ld_shlibs=no ;; esac fi ;; dgux*) archive_cmds='$LD -G -h $soname -o $lib $libobjs $deplibs $linker_flags' hardcode_libdir_flag_spec='-L$libdir' hardcode_shlibpath_var=no ;; freebsd1*) ld_shlibs=no ;; # FreeBSD 2.2.[012] allows us to include c++rt0.o to get C++ constructor # support. Future versions do this automatically, but an explicit c++rt0.o # does not break anything, and helps significantly (at the cost of a little # extra space). freebsd2.2*) archive_cmds='$LD -Bshareable -o $lib $libobjs $deplibs $linker_flags /usr/lib/c++rt0.o' hardcode_libdir_flag_spec='-R$libdir' hardcode_direct=yes hardcode_shlibpath_var=no ;; # Unfortunately, older versions of FreeBSD 2 do not have this feature. freebsd2*) archive_cmds='$LD -Bshareable -o $lib $libobjs $deplibs $linker_flags' hardcode_direct=yes hardcode_minus_L=yes hardcode_shlibpath_var=no ;; # FreeBSD 3 and greater uses gcc -shared to do shared libraries. freebsd* | kfreebsd*-gnu) archive_cmds='$CC -shared -o $lib $libobjs $deplibs $compiler_flags' hardcode_libdir_flag_spec='-R$libdir' hardcode_direct=yes hardcode_shlibpath_var=no ;; hpux9*) if test "$GCC" = yes; then archive_cmds='$rm $output_objdir/$soname~$CC -shared -fPIC ${wl}+b ${wl}$install_libdir -o $output_objdir/$soname $libobjs $deplibs $compiler_flags~test $output_objdir/$soname = $lib || mv $output_objdir/$soname $lib' else archive_cmds='$rm $output_objdir/$soname~$LD -b +b $install_libdir -o $output_objdir/$soname $libobjs $deplibs $linker_flags~test $output_objdir/$soname = $lib || mv $output_objdir/$soname $lib' fi hardcode_libdir_flag_spec='${wl}+b ${wl}$libdir' hardcode_libdir_separator=: hardcode_direct=yes # hardcode_minus_L: Not really in the search PATH, # but as the default location of the library. hardcode_minus_L=yes export_dynamic_flag_spec='${wl}-E' ;; hpux10* | hpux11*) if test "$GCC" = yes -a "$with_gnu_ld" = no; then case "$host_cpu" in hppa*64*|ia64*) archive_cmds='$CC -shared ${wl}+h ${wl}$soname -o $lib $libobjs $deplibs $compiler_flags' ;; *) archive_cmds='$CC -shared -fPIC ${wl}+h ${wl}$soname ${wl}+b ${wl}$install_libdir -o $lib $libobjs $deplibs $compiler_flags' ;; esac else case "$host_cpu" in hppa*64*|ia64*) archive_cmds='$LD -b +h $soname -o $lib $libobjs $deplibs $linker_flags' ;; *) archive_cmds='$LD -b +h $soname +b $install_libdir -o $lib $libobjs $deplibs $linker_flags' ;; esac fi if test "$with_gnu_ld" = no; then case "$host_cpu" in hppa*64*) hardcode_libdir_flag_spec='${wl}+b ${wl}$libdir' hardcode_libdir_flag_spec_ld='+b $libdir' hardcode_libdir_separator=: hardcode_direct=no hardcode_shlibpath_var=no ;; ia64*) hardcode_libdir_flag_spec='-L$libdir' hardcode_direct=no hardcode_shlibpath_var=no # hardcode_minus_L: Not really in the search PATH, # but as the default location of the library. hardcode_minus_L=yes ;; *) hardcode_libdir_flag_spec='${wl}+b ${wl}$libdir' hardcode_libdir_separator=: hardcode_direct=yes export_dynamic_flag_spec='${wl}-E' # hardcode_minus_L: Not really in the search PATH, # but as the default location of the library. hardcode_minus_L=yes ;; esac fi ;; irix5* | irix6* | nonstopux*) if test "$GCC" = yes; then archive_cmds='$CC -shared $libobjs $deplibs $compiler_flags ${wl}-soname ${wl}$soname `test -n "$verstring" && echo ${wl}-set_version ${wl}$verstring` ${wl}-update_registry ${wl}${output_objdir}/so_locations -o $lib' else archive_cmds='$LD -shared $libobjs $deplibs $linker_flags -soname $soname `test -n "$verstring" && echo -set_version $verstring` -update_registry ${output_objdir}/so_locations -o $lib' hardcode_libdir_flag_spec_ld='-rpath $libdir' fi hardcode_libdir_flag_spec='${wl}-rpath ${wl}$libdir' hardcode_libdir_separator=: link_all_deplibs=yes ;; netbsd*) if echo __ELF__ | $CC -E - | grep __ELF__ >/dev/null; then archive_cmds='$LD -Bshareable -o $lib $libobjs $deplibs $linker_flags' # a.out else archive_cmds='$LD -shared -o $lib $libobjs $deplibs $linker_flags' # ELF fi hardcode_libdir_flag_spec='-R$libdir' hardcode_direct=yes hardcode_shlibpath_var=no ;; newsos6) archive_cmds='$LD -G -h $soname -o $lib $libobjs $deplibs $linker_flags' hardcode_direct=yes hardcode_libdir_flag_spec='${wl}-rpath ${wl}$libdir' hardcode_libdir_separator=: hardcode_shlibpath_var=no ;; openbsd*) hardcode_direct=yes hardcode_shlibpath_var=no if test -z "`echo __ELF__ | $CC -E - | grep __ELF__`" || test "$host_os-$host_cpu" = "openbsd2.8-powerpc"; then archive_cmds='$CC -shared $pic_flag -o $lib $libobjs $deplibs $compiler_flags' archive_expsym_cmds='$CC -shared $pic_flag -o $lib $libobjs $deplibs $compiler_flags ${wl}-retain-symbols-file,$export_symbols' hardcode_libdir_flag_spec='${wl}-rpath,$libdir' export_dynamic_flag_spec='${wl}-E' else case $host_os in openbsd[01].* | openbsd2.[0-7] | openbsd2.[0-7].*) archive_cmds='$LD -Bshareable -o $lib $libobjs $deplibs $linker_flags' hardcode_libdir_flag_spec='-R$libdir' ;; *) archive_cmds='$CC -shared $pic_flag -o $lib $libobjs $deplibs $compiler_flags' hardcode_libdir_flag_spec='${wl}-rpath,$libdir' ;; esac fi ;; os2*) hardcode_libdir_flag_spec='-L$libdir' hardcode_minus_L=yes allow_undefined_flag=unsupported archive_cmds='$echo "LIBRARY $libname INITINSTANCE" > $output_objdir/$libname.def~$echo "DESCRIPTION \"$libname\"" >> $output_objdir/$libname.def~$echo DATA >> $output_objdir/$libname.def~$echo " SINGLE NONSHARED" >> $output_objdir/$libname.def~$echo EXPORTS >> $output_objdir/$libname.def~emxexp $libobjs >> $output_objdir/$libname.def~$CC -Zdll -Zcrtdll -o $lib $libobjs $deplibs $compiler_flags $output_objdir/$libname.def' old_archive_From_new_cmds='emximp -o $output_objdir/$libname.a $output_objdir/$libname.def' ;; osf3*) if test "$GCC" = yes; then allow_undefined_flag=' ${wl}-expect_unresolved ${wl}\*' archive_cmds='$CC -shared${allow_undefined_flag} $libobjs $deplibs $compiler_flags ${wl}-soname ${wl}$soname `test -n "$verstring" && echo ${wl}-set_version ${wl}$verstring` ${wl}-update_registry ${wl}${output_objdir}/so_locations -o $lib' else allow_undefined_flag=' -expect_unresolved \*' archive_cmds='$LD -shared${allow_undefined_flag} $libobjs $deplibs $linker_flags -soname $soname `test -n "$verstring" && echo -set_version $verstring` -update_registry ${output_objdir}/so_locations -o $lib' fi hardcode_libdir_flag_spec='${wl}-rpath ${wl}$libdir' hardcode_libdir_separator=: ;; osf4* | osf5*) # as osf3* with the addition of -msym flag if test "$GCC" = yes; then allow_undefined_flag=' ${wl}-expect_unresolved ${wl}\*' archive_cmds='$CC -shared${allow_undefined_flag} $libobjs $deplibs $compiler_flags ${wl}-msym ${wl}-soname ${wl}$soname `test -n "$verstring" && echo ${wl}-set_version ${wl}$verstring` ${wl}-update_registry ${wl}${output_objdir}/so_locations -o $lib' hardcode_libdir_flag_spec='${wl}-rpath ${wl}$libdir' else allow_undefined_flag=' -expect_unresolved \*' archive_cmds='$LD -shared${allow_undefined_flag} $libobjs $deplibs $linker_flags -msym -soname $soname `test -n "$verstring" && echo -set_version $verstring` -update_registry ${output_objdir}/so_locations -o $lib' archive_expsym_cmds='for i in `cat $export_symbols`; do printf "%s %s\\n" -exported_symbol "\$i" >> $lib.exp; done; echo "-hidden">> $lib.exp~ $LD -shared${allow_undefined_flag} -input $lib.exp $linker_flags $libobjs $deplibs -soname $soname `test -n "$verstring" && echo -set_version $verstring` -update_registry ${objdir}/so_locations -o $lib~$rm $lib.exp' # Both c and cxx compiler support -rpath directly hardcode_libdir_flag_spec='-rpath $libdir' fi hardcode_libdir_separator=: ;; sco3.2v5*) archive_cmds='$LD -G -h $soname -o $lib $libobjs $deplibs $linker_flags' hardcode_shlibpath_var=no export_dynamic_flag_spec='${wl}-Bexport' runpath_var=LD_RUN_PATH hardcode_runpath_var=yes ;; solaris*) no_undefined_flag=' -z text' if test "$GCC" = yes; then archive_cmds='$CC -shared ${wl}-h ${wl}$soname -o $lib $libobjs $deplibs $compiler_flags' archive_expsym_cmds='$echo "{ global:" > $lib.exp~cat $export_symbols | $SED -e "s/\(.*\)/\1;/" >> $lib.exp~$echo "local: *; };" >> $lib.exp~ $CC -shared ${wl}-M ${wl}$lib.exp ${wl}-h ${wl}$soname -o $lib $libobjs $deplibs $compiler_flags~$rm $lib.exp' else archive_cmds='$LD -G${allow_undefined_flag} -h $soname -o $lib $libobjs $deplibs $linker_flags' archive_expsym_cmds='$echo "{ global:" > $lib.exp~cat $export_symbols | $SED -e "s/\(.*\)/\1;/" >> $lib.exp~$echo "local: *; };" >> $lib.exp~ $LD -G${allow_undefined_flag} -M $lib.exp -h $soname -o $lib $libobjs $deplibs $linker_flags~$rm $lib.exp' fi hardcode_libdir_flag_spec='-R$libdir' hardcode_shlibpath_var=no case $host_os in solaris2.[0-5] | solaris2.[0-5].*) ;; *) # Supported since Solaris 2.6 (maybe 2.5.1?) whole_archive_flag_spec='-z allextract$convenience -z defaultextract' ;; esac link_all_deplibs=yes ;; sunos4*) if test "x$host_vendor" = xsequent; then # Use $CC to link under sequent, because it throws in some extra .o # files that make .init and .fini sections work. archive_cmds='$CC -G ${wl}-h $soname -o $lib $libobjs $deplibs $compiler_flags' else archive_cmds='$LD -assert pure-text -Bstatic -o $lib $libobjs $deplibs $linker_flags' fi hardcode_libdir_flag_spec='-L$libdir' hardcode_direct=yes hardcode_minus_L=yes hardcode_shlibpath_var=no ;; sysv4) case $host_vendor in sni) archive_cmds='$LD -G -h $soname -o $lib $libobjs $deplibs $linker_flags' hardcode_direct=yes # is this really true??? ;; siemens) ## LD is ld it makes a PLAMLIB ## CC just makes a GrossModule. archive_cmds='$LD -G -o $lib $libobjs $deplibs $linker_flags' reload_cmds='$CC -r -o $output$reload_objs' hardcode_direct=no ;; motorola) archive_cmds='$LD -G -h $soname -o $lib $libobjs $deplibs $linker_flags' hardcode_direct=no #Motorola manual says yes, but my tests say they lie ;; esac runpath_var='LD_RUN_PATH' hardcode_shlibpath_var=no ;; sysv4.3*) archive_cmds='$LD -G -h $soname -o $lib $libobjs $deplibs $linker_flags' hardcode_shlibpath_var=no export_dynamic_flag_spec='-Bexport' ;; sysv4*MP*) if test -d /usr/nec; then archive_cmds='$LD -G -h $soname -o $lib $libobjs $deplibs $linker_flags' hardcode_shlibpath_var=no runpath_var=LD_RUN_PATH hardcode_runpath_var=yes ld_shlibs=yes fi ;; sysv4.2uw2*) archive_cmds='$LD -G -o $lib $libobjs $deplibs $linker_flags' hardcode_direct=yes hardcode_minus_L=no hardcode_shlibpath_var=no hardcode_runpath_var=yes runpath_var=LD_RUN_PATH ;; sysv5OpenUNIX8* | sysv5UnixWare7* | sysv5uw[78]* | unixware7*) no_undefined_flag='${wl}-z ${wl}text' if test "$GCC" = yes; then archive_cmds='$CC -shared ${wl}-h ${wl}$soname -o $lib $libobjs $deplibs $compiler_flags' else archive_cmds='$CC -G ${wl}-h ${wl}$soname -o $lib $libobjs $deplibs $compiler_flags' fi runpath_var='LD_RUN_PATH' hardcode_shlibpath_var=no ;; sysv5*) no_undefined_flag=' -z text' # $CC -shared without GNU ld will not create a library from C++ # object files and a static libstdc++, better avoid it by now archive_cmds='$LD -G${allow_undefined_flag} -h $soname -o $lib $libobjs $deplibs $linker_flags' archive_expsym_cmds='$echo "{ global:" > $lib.exp~cat $export_symbols | $SED -e "s/\(.*\)/\1;/" >> $lib.exp~$echo "local: *; };" >> $lib.exp~ $LD -G${allow_undefined_flag} -M $lib.exp -h $soname -o $lib $libobjs $deplibs $linker_flags~$rm $lib.exp' hardcode_libdir_flag_spec= hardcode_shlibpath_var=no runpath_var='LD_RUN_PATH' ;; uts4*) archive_cmds='$LD -G -h $soname -o $lib $libobjs $deplibs $linker_flags' hardcode_libdir_flag_spec='-L$libdir' hardcode_shlibpath_var=no ;; *) ld_shlibs=no ;; esac fi echo "$as_me:$LINENO: result: $ld_shlibs" >&5 echo "${ECHO_T}$ld_shlibs" >&6 test "$ld_shlibs" = no && can_build_shared=no variables_saved_for_relink="PATH $shlibpath_var $runpath_var" if test "$GCC" = yes; then variables_saved_for_relink="$variables_saved_for_relink GCC_EXEC_PREFIX COMPILER_PATH LIBRARY_PATH" fi # # Do we need to explicitly link libc? # case "x$archive_cmds_need_lc" in x|xyes) # Assume -lc should be added archive_cmds_need_lc=yes if test "$enable_shared" = yes && test "$GCC" = yes; then case $archive_cmds in *'~'*) # FIXME: we may have to deal with multi-command sequences. ;; '$CC '*) # Test whether the compiler implicitly links with -lc since on some # systems, -lgcc has to come before -lc. If gcc already passes -lc # to ld, don't add -lc before -lgcc. echo "$as_me:$LINENO: checking whether -lc should be explicitly linked in" >&5 echo $ECHO_N "checking whether -lc should be explicitly linked in... $ECHO_C" >&6 $rm conftest* printf "$lt_simple_compile_test_code" > conftest.$ac_ext if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5 (eval $ac_compile) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } 2>conftest.err; then soname=conftest lib=conftest libobjs=conftest.$ac_objext deplibs= wl=$lt_prog_compiler_wl compiler_flags=-v linker_flags=-v verstring= output_objdir=. libname=conftest lt_save_allow_undefined_flag=$allow_undefined_flag allow_undefined_flag= if { (eval echo "$as_me:$LINENO: \"$archive_cmds 2\>\&1 \| grep \" -lc \" \>/dev/null 2\>\&1\"") >&5 (eval $archive_cmds 2\>\&1 \| grep \" -lc \" \>/dev/null 2\>\&1) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } then archive_cmds_need_lc=no else archive_cmds_need_lc=yes fi allow_undefined_flag=$lt_save_allow_undefined_flag else cat conftest.err 1>&5 fi $rm conftest* echo "$as_me:$LINENO: result: $archive_cmds_need_lc" >&5 echo "${ECHO_T}$archive_cmds_need_lc" >&6 ;; esac fi ;; esac echo "$as_me:$LINENO: checking dynamic linker characteristics" >&5 echo $ECHO_N "checking dynamic linker characteristics... $ECHO_C" >&6 library_names_spec= libname_spec='lib$name' soname_spec= shrext_cmds=".so" postinstall_cmds= postuninstall_cmds= finish_cmds= finish_eval= shlibpath_var= shlibpath_overrides_runpath=unknown version_type=none dynamic_linker="$host_os ld.so" sys_lib_dlsearch_path_spec="/lib /usr/lib" if test "$GCC" = yes; then sys_lib_search_path_spec=`$CC -print-search-dirs | grep "^libraries:" | $SED -e "s/^libraries://" -e "s,=/,/,g"` if echo "$sys_lib_search_path_spec" | grep ';' >/dev/null ; then # if the path contains ";" then we assume it to be the separator # otherwise default to the standard path separator (i.e. ":") - it is # assumed that no part of a normal pathname contains ";" but that should # okay in the real world where ";" in dirpaths is itself problematic. sys_lib_search_path_spec=`echo "$sys_lib_search_path_spec" | $SED -e 's/;/ /g'` else sys_lib_search_path_spec=`echo "$sys_lib_search_path_spec" | $SED -e "s/$PATH_SEPARATOR/ /g"` fi else sys_lib_search_path_spec="/lib /usr/lib /usr/local/lib" fi need_lib_prefix=unknown hardcode_into_libs=no # when you set need_version to no, make sure it does not cause -set_version # flags to be left without arguments need_version=unknown case $host_os in aix3*) version_type=linux library_names_spec='${libname}${release}${shared_ext}$versuffix $libname.a' shlibpath_var=LIBPATH # AIX 3 has no versioning support, so we append a major version to the name. soname_spec='${libname}${release}${shared_ext}$major' ;; aix4* | aix5*) version_type=linux need_lib_prefix=no need_version=no hardcode_into_libs=yes if test "$host_cpu" = ia64; then # AIX 5 supports IA64 library_names_spec='${libname}${release}${shared_ext}$major ${libname}${release}${shared_ext}$versuffix $libname${shared_ext}' shlibpath_var=LD_LIBRARY_PATH else # With GCC up to 2.95.x, collect2 would create an import file # for dependence libraries. The import file would start with # the line `#! .'. This would cause the generated library to # depend on `.', always an invalid library. This was fixed in # development snapshots of GCC prior to 3.0. case $host_os in aix4 | aix4.[01] | aix4.[01].*) if { echo '#if __GNUC__ > 2 || (__GNUC__ == 2 && __GNUC_MINOR__ >= 97)' echo ' yes ' echo '#endif'; } | ${CC} -E - | grep yes > /dev/null; then : else can_build_shared=no fi ;; esac # AIX (on Power*) has no versioning support, so currently we can not hardcode correct # soname into executable. Probably we can add versioning support to # collect2, so additional links can be useful in future. if test "$aix_use_runtimelinking" = yes; then # If using run time linking (on AIX 4.2 or later) use lib.so # instead of lib.a to let people know that these are not # typical AIX shared libraries. library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' else # We preserve .a as extension for shared libraries through AIX4.2 # and later when we are not doing run time linking. library_names_spec='${libname}${release}.a $libname.a' soname_spec='${libname}${release}${shared_ext}$major' fi shlibpath_var=LIBPATH fi ;; amigaos*) library_names_spec='$libname.ixlibrary $libname.a' # Create ${libname}_ixlibrary.a entries in /sys/libs. finish_eval='for lib in `ls $libdir/*.ixlibrary 2>/dev/null`; do libname=`$echo "X$lib" | $Xsed -e '\''s%^.*/\([^/]*\)\.ixlibrary$%\1%'\''`; test $rm /sys/libs/${libname}_ixlibrary.a; $show "cd /sys/libs && $LN_S $lib ${libname}_ixlibrary.a"; cd /sys/libs && $LN_S $lib ${libname}_ixlibrary.a || exit 1; done' ;; beos*) library_names_spec='${libname}${shared_ext}' dynamic_linker="$host_os ld.so" shlibpath_var=LIBRARY_PATH ;; bsdi[45]*) version_type=linux need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' finish_cmds='PATH="\$PATH:/sbin" ldconfig $libdir' shlibpath_var=LD_LIBRARY_PATH sys_lib_search_path_spec="/shlib /usr/lib /usr/X11/lib /usr/contrib/lib /lib /usr/local/lib" sys_lib_dlsearch_path_spec="/shlib /usr/lib /usr/local/lib" # the default ld.so.conf also contains /usr/contrib/lib and # /usr/X11R6/lib (/usr/X11 is a link to /usr/X11R6), but let us allow # libtool to hard-code these into programs ;; cygwin* | mingw* | pw32*) version_type=windows shrext_cmds=".dll" need_version=no need_lib_prefix=no case $GCC,$host_os in yes,cygwin* | yes,mingw* | yes,pw32*) library_names_spec='$libname.dll.a' # DLL is installed to $(libdir)/../bin by postinstall_cmds postinstall_cmds='base_file=`basename \${file}`~ dlpath=`$SHELL 2>&1 -c '\''. $dir/'\''\${base_file}'\''i;echo \$dlname'\''`~ dldir=$destdir/`dirname \$dlpath`~ test -d \$dldir || mkdir -p \$dldir~ $install_prog $dir/$dlname \$dldir/$dlname' postuninstall_cmds='dldll=`$SHELL 2>&1 -c '\''. $file; echo \$dlname'\''`~ dlpath=$dir/\$dldll~ $rm \$dlpath' shlibpath_overrides_runpath=yes case $host_os in cygwin*) # Cygwin DLLs use 'cyg' prefix rather than 'lib' soname_spec='`echo ${libname} | sed -e 's/^lib/cyg/'``echo ${release} | $SED -e 's/[.]/-/g'`${versuffix}${shared_ext}' sys_lib_search_path_spec="/usr/lib /lib/w32api /lib /usr/local/lib" ;; mingw*) # MinGW DLLs use traditional 'lib' prefix soname_spec='${libname}`echo ${release} | $SED -e 's/[.]/-/g'`${versuffix}${shared_ext}' sys_lib_search_path_spec=`$CC -print-search-dirs | grep "^libraries:" | $SED -e "s/^libraries://" -e "s,=/,/,g"` if echo "$sys_lib_search_path_spec" | grep ';[c-zC-Z]:/' >/dev/null; then # It is most probably a Windows format PATH printed by # mingw gcc, but we are running on Cygwin. Gcc prints its search # path with ; separators, and with drive letters. We can handle the # drive letters (cygwin fileutils understands them), so leave them, # especially as we might pass files found there to a mingw objdump, # which wouldn't understand a cygwinified path. Ahh. sys_lib_search_path_spec=`echo "$sys_lib_search_path_spec" | $SED -e 's/;/ /g'` else sys_lib_search_path_spec=`echo "$sys_lib_search_path_spec" | $SED -e "s/$PATH_SEPARATOR/ /g"` fi ;; pw32*) # pw32 DLLs use 'pw' prefix rather than 'lib' library_names_spec='`echo ${libname} | sed -e 's/^lib/pw/'``echo ${release} | $SED -e 's/./-/g'`${versuffix}${shared_ext}' ;; esac ;; *) library_names_spec='${libname}`echo ${release} | $SED -e 's/[.]/-/g'`${versuffix}${shared_ext} $libname.lib' ;; esac dynamic_linker='Win32 ld.exe' # FIXME: first we should search . and the directory the executable is in shlibpath_var=PATH ;; darwin* | rhapsody*) dynamic_linker="$host_os dyld" version_type=darwin need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${versuffix}$shared_ext ${libname}${release}${major}$shared_ext ${libname}$shared_ext' soname_spec='${libname}${release}${major}$shared_ext' shlibpath_overrides_runpath=yes shlibpath_var=DYLD_LIBRARY_PATH shrext_cmds='$(test .$module = .yes && echo .so || echo .dylib)' # Apple's gcc prints 'gcc -print-search-dirs' doesn't operate the same. if test "$GCC" = yes; then sys_lib_search_path_spec=`$CC -print-search-dirs | tr "\n" "$PATH_SEPARATOR" | sed -e 's/libraries:/@libraries:/' | tr "@" "\n" | grep "^libraries:" | sed -e "s/^libraries://" -e "s,=/,/,g" -e "s,$PATH_SEPARATOR, ,g" -e "s,.*,& /lib /usr/lib /usr/local/lib,g"` else sys_lib_search_path_spec='/lib /usr/lib /usr/local/lib' fi sys_lib_dlsearch_path_spec='/usr/local/lib /lib /usr/lib' ;; dgux*) version_type=linux need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname$shared_ext' soname_spec='${libname}${release}${shared_ext}$major' shlibpath_var=LD_LIBRARY_PATH ;; freebsd1*) dynamic_linker=no ;; kfreebsd*-gnu) version_type=linux need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major ${libname}${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=no hardcode_into_libs=yes dynamic_linker='GNU ld.so' ;; freebsd*) objformat=`test -x /usr/bin/objformat && /usr/bin/objformat || echo aout` version_type=freebsd-$objformat case $version_type in freebsd-elf*) library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext} $libname${shared_ext}' need_version=no need_lib_prefix=no ;; freebsd-*) library_names_spec='${libname}${release}${shared_ext}$versuffix $libname${shared_ext}$versuffix' need_version=yes ;; esac shlibpath_var=LD_LIBRARY_PATH case $host_os in freebsd2*) shlibpath_overrides_runpath=yes ;; freebsd3.01* | freebsdelf3.01*) shlibpath_overrides_runpath=yes hardcode_into_libs=yes ;; *) # from 3.2 on shlibpath_overrides_runpath=no hardcode_into_libs=yes ;; esac ;; gnu*) version_type=linux need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}${major} ${libname}${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' shlibpath_var=LD_LIBRARY_PATH hardcode_into_libs=yes ;; hpux9* | hpux10* | hpux11*) # Give a soname corresponding to the major version so that dld.sl refuses to # link against other versions. version_type=sunos need_lib_prefix=no need_version=no case "$host_cpu" in ia64*) shrext_cmds='.so' hardcode_into_libs=yes dynamic_linker="$host_os dld.so" shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=yes # Unless +noenvvar is specified. library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' if test "X$HPUX_IA64_MODE" = X32; then sys_lib_search_path_spec="/usr/lib/hpux32 /usr/local/lib/hpux32 /usr/local/lib" else sys_lib_search_path_spec="/usr/lib/hpux64 /usr/local/lib/hpux64" fi sys_lib_dlsearch_path_spec=$sys_lib_search_path_spec ;; hppa*64*) shrext_cmds='.sl' hardcode_into_libs=yes dynamic_linker="$host_os dld.sl" shlibpath_var=LD_LIBRARY_PATH # How should we handle SHLIB_PATH shlibpath_overrides_runpath=yes # Unless +noenvvar is specified. library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' sys_lib_search_path_spec="/usr/lib/pa20_64 /usr/ccs/lib/pa20_64" sys_lib_dlsearch_path_spec=$sys_lib_search_path_spec ;; *) shrext_cmds='.sl' dynamic_linker="$host_os dld.sl" shlibpath_var=SHLIB_PATH shlibpath_overrides_runpath=no # +s is required to enable SHLIB_PATH library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' ;; esac # HP-UX runs *really* slowly unless shared libraries are mode 555. postinstall_cmds='chmod 555 $lib' ;; irix5* | irix6* | nonstopux*) case $host_os in nonstopux*) version_type=nonstopux ;; *) if test "$lt_cv_prog_gnu_ld" = yes; then version_type=linux else version_type=irix fi ;; esac need_lib_prefix=no need_version=no soname_spec='${libname}${release}${shared_ext}$major' library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major ${libname}${release}${shared_ext} $libname${shared_ext}' case $host_os in irix5* | nonstopux*) libsuff= shlibsuff= ;; *) case $LD in # libtool.m4 will add one of these switches to LD *-32|*"-32 "|*-melf32bsmip|*"-melf32bsmip ") libsuff= shlibsuff= libmagic=32-bit;; *-n32|*"-n32 "|*-melf32bmipn32|*"-melf32bmipn32 ") libsuff=32 shlibsuff=N32 libmagic=N32;; *-64|*"-64 "|*-melf64bmip|*"-melf64bmip ") libsuff=64 shlibsuff=64 libmagic=64-bit;; *) libsuff= shlibsuff= libmagic=never-match;; esac ;; esac shlibpath_var=LD_LIBRARY${shlibsuff}_PATH shlibpath_overrides_runpath=no sys_lib_search_path_spec="/usr/lib${libsuff} /lib${libsuff} /usr/local/lib${libsuff}" sys_lib_dlsearch_path_spec="/usr/lib${libsuff} /lib${libsuff}" hardcode_into_libs=yes ;; # No shared lib support for Linux oldld, aout, or coff. linux*oldld* | linux*aout* | linux*coff*) dynamic_linker=no ;; # This must be Linux ELF. linux*) version_type=linux need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' finish_cmds='PATH="\$PATH:/sbin" ldconfig -n $libdir' shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=no # This implies no fast_install, which is unacceptable. # Some rework will be needed to allow for fast_install # before this can be enabled. hardcode_into_libs=yes # Append ld.so.conf contents to the search path if test -f /etc/ld.so.conf; then lt_ld_extra=`$SED -e 's/:,\t/ /g;s/=^=*$//;s/=^= * / /g' /etc/ld.so.conf | tr '\n' ' '` sys_lib_dlsearch_path_spec="/lib /usr/lib $lt_ld_extra" fi # We used to test for /lib/ld.so.1 and disable shared libraries on # powerpc, because MkLinux only supported shared libraries with the # GNU dynamic linker. Since this was broken with cross compilers, # most powerpc-linux boxes support dynamic linking these days and # people can always --disable-shared, the test was removed, and we # assume the GNU/Linux dynamic linker is in use. dynamic_linker='GNU/Linux ld.so' ;; knetbsd*-gnu) version_type=linux need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major ${libname}${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=no hardcode_into_libs=yes dynamic_linker='GNU ld.so' ;; netbsd*) version_type=sunos need_lib_prefix=no need_version=no if echo __ELF__ | $CC -E - | grep __ELF__ >/dev/null; then library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${shared_ext}$versuffix' finish_cmds='PATH="\$PATH:/sbin" ldconfig -m $libdir' dynamic_linker='NetBSD (a.out) ld.so' else library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major ${libname}${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' dynamic_linker='NetBSD ld.elf_so' fi shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=yes hardcode_into_libs=yes ;; newsos6) version_type=linux library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=yes ;; nto-qnx*) version_type=linux need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=yes ;; openbsd*) version_type=sunos need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${shared_ext}$versuffix' finish_cmds='PATH="\$PATH:/sbin" ldconfig -m $libdir' shlibpath_var=LD_LIBRARY_PATH if test -z "`echo __ELF__ | $CC -E - | grep __ELF__`" || test "$host_os-$host_cpu" = "openbsd2.8-powerpc"; then case $host_os in openbsd2.[89] | openbsd2.[89].*) shlibpath_overrides_runpath=no ;; *) shlibpath_overrides_runpath=yes ;; esac else shlibpath_overrides_runpath=yes fi ;; os2*) libname_spec='$name' shrext_cmds=".dll" need_lib_prefix=no library_names_spec='$libname${shared_ext} $libname.a' dynamic_linker='OS/2 ld.exe' shlibpath_var=LIBPATH ;; osf3* | osf4* | osf5*) version_type=osf need_lib_prefix=no need_version=no soname_spec='${libname}${release}${shared_ext}$major' library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' shlibpath_var=LD_LIBRARY_PATH sys_lib_search_path_spec="/usr/shlib /usr/ccs/lib /usr/lib/cmplrs/cc /usr/lib /usr/local/lib /var/shlib" sys_lib_dlsearch_path_spec="$sys_lib_search_path_spec" ;; sco3.2v5*) version_type=osf soname_spec='${libname}${release}${shared_ext}$major' library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' shlibpath_var=LD_LIBRARY_PATH ;; solaris*) version_type=linux need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=yes hardcode_into_libs=yes # ldd complains unless libraries are executable postinstall_cmds='chmod +x $lib' ;; sunos4*) version_type=sunos library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${shared_ext}$versuffix' finish_cmds='PATH="\$PATH:/usr/etc" ldconfig $libdir' shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=yes if test "$with_gnu_ld" = yes; then need_lib_prefix=no fi need_version=yes ;; sysv4 | sysv4.2uw2* | sysv4.3* | sysv5*) version_type=linux library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' shlibpath_var=LD_LIBRARY_PATH case $host_vendor in sni) shlibpath_overrides_runpath=no need_lib_prefix=no export_dynamic_flag_spec='${wl}-Blargedynsym' runpath_var=LD_RUN_PATH ;; siemens) need_lib_prefix=no ;; motorola) need_lib_prefix=no need_version=no shlibpath_overrides_runpath=no sys_lib_search_path_spec='/lib /usr/lib /usr/ccs/lib' ;; esac ;; sysv4*MP*) if test -d /usr/nec ;then version_type=linux library_names_spec='$libname${shared_ext}.$versuffix $libname${shared_ext}.$major $libname${shared_ext}' soname_spec='$libname${shared_ext}.$major' shlibpath_var=LD_LIBRARY_PATH fi ;; uts4*) version_type=linux library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' shlibpath_var=LD_LIBRARY_PATH ;; *) dynamic_linker=no ;; esac echo "$as_me:$LINENO: result: $dynamic_linker" >&5 echo "${ECHO_T}$dynamic_linker" >&6 test "$dynamic_linker" = no && can_build_shared=no echo "$as_me:$LINENO: checking how to hardcode library paths into programs" >&5 echo $ECHO_N "checking how to hardcode library paths into programs... $ECHO_C" >&6 hardcode_action= if test -n "$hardcode_libdir_flag_spec" || \ test -n "$runpath_var" || \ test "X$hardcode_automatic" = "Xyes" ; then # We can hardcode non-existant directories. if test "$hardcode_direct" != no && # If the only mechanism to avoid hardcoding is shlibpath_var, we # have to relink, otherwise we might link with an installed library # when we should be linking with a yet-to-be-installed one ## test "$_LT_AC_TAGVAR(hardcode_shlibpath_var, )" != no && test "$hardcode_minus_L" != no; then # Linking always hardcodes the temporary library directory. hardcode_action=relink else # We can link without hardcoding, and we can hardcode nonexisting dirs. hardcode_action=immediate fi else # We cannot hardcode anything, or else we can only hardcode existing # directories. hardcode_action=unsupported fi echo "$as_me:$LINENO: result: $hardcode_action" >&5 echo "${ECHO_T}$hardcode_action" >&6 if test "$hardcode_action" = relink; then # Fast installation is not supported enable_fast_install=no elif test "$shlibpath_overrides_runpath" = yes || test "$enable_shared" = no; then # Fast installation is not necessary enable_fast_install=needless fi striplib= old_striplib= echo "$as_me:$LINENO: checking whether stripping libraries is possible" >&5 echo $ECHO_N "checking whether stripping libraries is possible... $ECHO_C" >&6 if test -n "$STRIP" && $STRIP -V 2>&1 | grep "GNU strip" >/dev/null; then test -z "$old_striplib" && old_striplib="$STRIP --strip-debug" test -z "$striplib" && striplib="$STRIP --strip-unneeded" echo "$as_me:$LINENO: result: yes" >&5 echo "${ECHO_T}yes" >&6 else # FIXME - insert some real tests, host_os isn't really good enough case $host_os in darwin*) if test -n "$STRIP" ; then striplib="$STRIP -x" echo "$as_me:$LINENO: result: yes" >&5 echo "${ECHO_T}yes" >&6 else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 fi ;; *) echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 ;; esac fi if test "x$enable_dlopen" != xyes; then enable_dlopen=unknown enable_dlopen_self=unknown enable_dlopen_self_static=unknown else lt_cv_dlopen=no lt_cv_dlopen_libs= case $host_os in beos*) lt_cv_dlopen="load_add_on" lt_cv_dlopen_libs= lt_cv_dlopen_self=yes ;; mingw* | pw32*) lt_cv_dlopen="LoadLibrary" lt_cv_dlopen_libs= ;; cygwin*) lt_cv_dlopen="dlopen" lt_cv_dlopen_libs= ;; darwin*) # if libdl is installed we need to link against it echo "$as_me:$LINENO: checking for dlopen in -ldl" >&5 echo $ECHO_N "checking for dlopen in -ldl... $ECHO_C" >&6 if test "${ac_cv_lib_dl_dlopen+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else ac_check_lib_save_LIBS=$LIBS LIBS="-ldl $LIBS" cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ /* Override any gcc2 internal prototype to avoid an error. */ #ifdef __cplusplus extern "C" #endif /* We use char because int might match the return type of a gcc2 builtin and then its argument prototype would still apply. */ char dlopen (); int main () { dlopen (); ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then ac_cv_lib_dl_dlopen=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_cv_lib_dl_dlopen=no fi rm -f conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext LIBS=$ac_check_lib_save_LIBS fi echo "$as_me:$LINENO: result: $ac_cv_lib_dl_dlopen" >&5 echo "${ECHO_T}$ac_cv_lib_dl_dlopen" >&6 if test $ac_cv_lib_dl_dlopen = yes; then lt_cv_dlopen="dlopen" lt_cv_dlopen_libs="-ldl" else lt_cv_dlopen="dyld" lt_cv_dlopen_libs= lt_cv_dlopen_self=yes fi ;; *) echo "$as_me:$LINENO: checking for shl_load" >&5 echo $ECHO_N "checking for shl_load... $ECHO_C" >&6 if test "${ac_cv_func_shl_load+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ /* Define shl_load to an innocuous variant, in case declares shl_load. For example, HP-UX 11i declares gettimeofday. */ #define shl_load innocuous_shl_load /* System header to define __stub macros and hopefully few prototypes, which can conflict with char shl_load (); below. Prefer to if __STDC__ is defined, since exists even on freestanding compilers. */ #ifdef __STDC__ # include #else # include #endif #undef shl_load /* Override any gcc2 internal prototype to avoid an error. */ #ifdef __cplusplus extern "C" { #endif /* We use char because int might match the return type of a gcc2 builtin and then its argument prototype would still apply. */ char shl_load (); /* The GNU C library defines this for functions which it implements to always fail with ENOSYS. Some functions are actually named something starting with __ and the normal name is an alias. */ #if defined (__stub_shl_load) || defined (__stub___shl_load) choke me #else char (*f) () = shl_load; #endif #ifdef __cplusplus } #endif int main () { return f != shl_load; ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then ac_cv_func_shl_load=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_cv_func_shl_load=no fi rm -f conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext fi echo "$as_me:$LINENO: result: $ac_cv_func_shl_load" >&5 echo "${ECHO_T}$ac_cv_func_shl_load" >&6 if test $ac_cv_func_shl_load = yes; then lt_cv_dlopen="shl_load" else echo "$as_me:$LINENO: checking for shl_load in -ldld" >&5 echo $ECHO_N "checking for shl_load in -ldld... $ECHO_C" >&6 if test "${ac_cv_lib_dld_shl_load+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else ac_check_lib_save_LIBS=$LIBS LIBS="-ldld $LIBS" cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ /* Override any gcc2 internal prototype to avoid an error. */ #ifdef __cplusplus extern "C" #endif /* We use char because int might match the return type of a gcc2 builtin and then its argument prototype would still apply. */ char shl_load (); int main () { shl_load (); ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then ac_cv_lib_dld_shl_load=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_cv_lib_dld_shl_load=no fi rm -f conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext LIBS=$ac_check_lib_save_LIBS fi echo "$as_me:$LINENO: result: $ac_cv_lib_dld_shl_load" >&5 echo "${ECHO_T}$ac_cv_lib_dld_shl_load" >&6 if test $ac_cv_lib_dld_shl_load = yes; then lt_cv_dlopen="shl_load" lt_cv_dlopen_libs="-dld" else echo "$as_me:$LINENO: checking for dlopen" >&5 echo $ECHO_N "checking for dlopen... $ECHO_C" >&6 if test "${ac_cv_func_dlopen+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ /* Define dlopen to an innocuous variant, in case declares dlopen. For example, HP-UX 11i declares gettimeofday. */ #define dlopen innocuous_dlopen /* System header to define __stub macros and hopefully few prototypes, which can conflict with char dlopen (); below. Prefer to if __STDC__ is defined, since exists even on freestanding compilers. */ #ifdef __STDC__ # include #else # include #endif #undef dlopen /* Override any gcc2 internal prototype to avoid an error. */ #ifdef __cplusplus extern "C" { #endif /* We use char because int might match the return type of a gcc2 builtin and then its argument prototype would still apply. */ char dlopen (); /* The GNU C library defines this for functions which it implements to always fail with ENOSYS. Some functions are actually named something starting with __ and the normal name is an alias. */ #if defined (__stub_dlopen) || defined (__stub___dlopen) choke me #else char (*f) () = dlopen; #endif #ifdef __cplusplus } #endif int main () { return f != dlopen; ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then ac_cv_func_dlopen=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_cv_func_dlopen=no fi rm -f conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext fi echo "$as_me:$LINENO: result: $ac_cv_func_dlopen" >&5 echo "${ECHO_T}$ac_cv_func_dlopen" >&6 if test $ac_cv_func_dlopen = yes; then lt_cv_dlopen="dlopen" else echo "$as_me:$LINENO: checking for dlopen in -ldl" >&5 echo $ECHO_N "checking for dlopen in -ldl... $ECHO_C" >&6 if test "${ac_cv_lib_dl_dlopen+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else ac_check_lib_save_LIBS=$LIBS LIBS="-ldl $LIBS" cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ /* Override any gcc2 internal prototype to avoid an error. */ #ifdef __cplusplus extern "C" #endif /* We use char because int might match the return type of a gcc2 builtin and then its argument prototype would still apply. */ char dlopen (); int main () { dlopen (); ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then ac_cv_lib_dl_dlopen=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_cv_lib_dl_dlopen=no fi rm -f conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext LIBS=$ac_check_lib_save_LIBS fi echo "$as_me:$LINENO: result: $ac_cv_lib_dl_dlopen" >&5 echo "${ECHO_T}$ac_cv_lib_dl_dlopen" >&6 if test $ac_cv_lib_dl_dlopen = yes; then lt_cv_dlopen="dlopen" lt_cv_dlopen_libs="-ldl" else echo "$as_me:$LINENO: checking for dlopen in -lsvld" >&5 echo $ECHO_N "checking for dlopen in -lsvld... $ECHO_C" >&6 if test "${ac_cv_lib_svld_dlopen+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else ac_check_lib_save_LIBS=$LIBS LIBS="-lsvld $LIBS" cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ /* Override any gcc2 internal prototype to avoid an error. */ #ifdef __cplusplus extern "C" #endif /* We use char because int might match the return type of a gcc2 builtin and then its argument prototype would still apply. */ char dlopen (); int main () { dlopen (); ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then ac_cv_lib_svld_dlopen=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_cv_lib_svld_dlopen=no fi rm -f conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext LIBS=$ac_check_lib_save_LIBS fi echo "$as_me:$LINENO: result: $ac_cv_lib_svld_dlopen" >&5 echo "${ECHO_T}$ac_cv_lib_svld_dlopen" >&6 if test $ac_cv_lib_svld_dlopen = yes; then lt_cv_dlopen="dlopen" lt_cv_dlopen_libs="-lsvld" else echo "$as_me:$LINENO: checking for dld_link in -ldld" >&5 echo $ECHO_N "checking for dld_link in -ldld... $ECHO_C" >&6 if test "${ac_cv_lib_dld_dld_link+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else ac_check_lib_save_LIBS=$LIBS LIBS="-ldld $LIBS" cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ /* Override any gcc2 internal prototype to avoid an error. */ #ifdef __cplusplus extern "C" #endif /* We use char because int might match the return type of a gcc2 builtin and then its argument prototype would still apply. */ char dld_link (); int main () { dld_link (); ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then ac_cv_lib_dld_dld_link=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_cv_lib_dld_dld_link=no fi rm -f conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext LIBS=$ac_check_lib_save_LIBS fi echo "$as_me:$LINENO: result: $ac_cv_lib_dld_dld_link" >&5 echo "${ECHO_T}$ac_cv_lib_dld_dld_link" >&6 if test $ac_cv_lib_dld_dld_link = yes; then lt_cv_dlopen="dld_link" lt_cv_dlopen_libs="-dld" fi fi fi fi fi fi ;; esac if test "x$lt_cv_dlopen" != xno; then enable_dlopen=yes else enable_dlopen=no fi case $lt_cv_dlopen in dlopen) save_CPPFLAGS="$CPPFLAGS" test "x$ac_cv_header_dlfcn_h" = xyes && CPPFLAGS="$CPPFLAGS -DHAVE_DLFCN_H" save_LDFLAGS="$LDFLAGS" eval LDFLAGS=\"\$LDFLAGS $export_dynamic_flag_spec\" save_LIBS="$LIBS" LIBS="$lt_cv_dlopen_libs $LIBS" echo "$as_me:$LINENO: checking whether a program can dlopen itself" >&5 echo $ECHO_N "checking whether a program can dlopen itself... $ECHO_C" >&6 if test "${lt_cv_dlopen_self+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test "$cross_compiling" = yes; then : lt_cv_dlopen_self=cross else lt_dlunknown=0; lt_dlno_uscore=1; lt_dlneed_uscore=2 lt_status=$lt_dlunknown cat > conftest.$ac_ext < #endif #include #ifdef RTLD_GLOBAL # define LT_DLGLOBAL RTLD_GLOBAL #else # ifdef DL_GLOBAL # define LT_DLGLOBAL DL_GLOBAL # else # define LT_DLGLOBAL 0 # endif #endif /* We may have to define LT_DLLAZY_OR_NOW in the command line if we find out it does not work in some platform. */ #ifndef LT_DLLAZY_OR_NOW # ifdef RTLD_LAZY # define LT_DLLAZY_OR_NOW RTLD_LAZY # else # ifdef DL_LAZY # define LT_DLLAZY_OR_NOW DL_LAZY # else # ifdef RTLD_NOW # define LT_DLLAZY_OR_NOW RTLD_NOW # else # ifdef DL_NOW # define LT_DLLAZY_OR_NOW DL_NOW # else # define LT_DLLAZY_OR_NOW 0 # endif # endif # endif # endif #endif #ifdef __cplusplus extern "C" void exit (int); #endif void fnord() { int i=42;} int main () { void *self = dlopen (0, LT_DLGLOBAL|LT_DLLAZY_OR_NOW); int status = $lt_dlunknown; if (self) { if (dlsym (self,"fnord")) status = $lt_dlno_uscore; else if (dlsym( self,"_fnord")) status = $lt_dlneed_uscore; /* dlclose (self); */ } exit (status); } EOF if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && test -s conftest${ac_exeext} 2>/dev/null; then (./conftest; exit; ) 2>/dev/null lt_status=$? case x$lt_status in x$lt_dlno_uscore) lt_cv_dlopen_self=yes ;; x$lt_dlneed_uscore) lt_cv_dlopen_self=yes ;; x$lt_unknown|x*) lt_cv_dlopen_self=no ;; esac else : # compilation failed lt_cv_dlopen_self=no fi fi rm -fr conftest* fi echo "$as_me:$LINENO: result: $lt_cv_dlopen_self" >&5 echo "${ECHO_T}$lt_cv_dlopen_self" >&6 if test "x$lt_cv_dlopen_self" = xyes; then LDFLAGS="$LDFLAGS $link_static_flag" echo "$as_me:$LINENO: checking whether a statically linked program can dlopen itself" >&5 echo $ECHO_N "checking whether a statically linked program can dlopen itself... $ECHO_C" >&6 if test "${lt_cv_dlopen_self_static+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test "$cross_compiling" = yes; then : lt_cv_dlopen_self_static=cross else lt_dlunknown=0; lt_dlno_uscore=1; lt_dlneed_uscore=2 lt_status=$lt_dlunknown cat > conftest.$ac_ext < #endif #include #ifdef RTLD_GLOBAL # define LT_DLGLOBAL RTLD_GLOBAL #else # ifdef DL_GLOBAL # define LT_DLGLOBAL DL_GLOBAL # else # define LT_DLGLOBAL 0 # endif #endif /* We may have to define LT_DLLAZY_OR_NOW in the command line if we find out it does not work in some platform. */ #ifndef LT_DLLAZY_OR_NOW # ifdef RTLD_LAZY # define LT_DLLAZY_OR_NOW RTLD_LAZY # else # ifdef DL_LAZY # define LT_DLLAZY_OR_NOW DL_LAZY # else # ifdef RTLD_NOW # define LT_DLLAZY_OR_NOW RTLD_NOW # else # ifdef DL_NOW # define LT_DLLAZY_OR_NOW DL_NOW # else # define LT_DLLAZY_OR_NOW 0 # endif # endif # endif # endif #endif #ifdef __cplusplus extern "C" void exit (int); #endif void fnord() { int i=42;} int main () { void *self = dlopen (0, LT_DLGLOBAL|LT_DLLAZY_OR_NOW); int status = $lt_dlunknown; if (self) { if (dlsym (self,"fnord")) status = $lt_dlno_uscore; else if (dlsym( self,"_fnord")) status = $lt_dlneed_uscore; /* dlclose (self); */ } exit (status); } EOF if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && test -s conftest${ac_exeext} 2>/dev/null; then (./conftest; exit; ) 2>/dev/null lt_status=$? case x$lt_status in x$lt_dlno_uscore) lt_cv_dlopen_self_static=yes ;; x$lt_dlneed_uscore) lt_cv_dlopen_self_static=yes ;; x$lt_unknown|x*) lt_cv_dlopen_self_static=no ;; esac else : # compilation failed lt_cv_dlopen_self_static=no fi fi rm -fr conftest* fi echo "$as_me:$LINENO: result: $lt_cv_dlopen_self_static" >&5 echo "${ECHO_T}$lt_cv_dlopen_self_static" >&6 fi CPPFLAGS="$save_CPPFLAGS" LDFLAGS="$save_LDFLAGS" LIBS="$save_LIBS" ;; esac case $lt_cv_dlopen_self in yes|no) enable_dlopen_self=$lt_cv_dlopen_self ;; *) enable_dlopen_self=unknown ;; esac case $lt_cv_dlopen_self_static in yes|no) enable_dlopen_self_static=$lt_cv_dlopen_self_static ;; *) enable_dlopen_self_static=unknown ;; esac fi # Report which librarie types wil actually be built echo "$as_me:$LINENO: checking if libtool supports shared libraries" >&5 echo $ECHO_N "checking if libtool supports shared libraries... $ECHO_C" >&6 echo "$as_me:$LINENO: result: $can_build_shared" >&5 echo "${ECHO_T}$can_build_shared" >&6 echo "$as_me:$LINENO: checking whether to build shared libraries" >&5 echo $ECHO_N "checking whether to build shared libraries... $ECHO_C" >&6 test "$can_build_shared" = "no" && enable_shared=no # On AIX, shared libraries and static libraries use the same namespace, and # are all built from PIC. case "$host_os" in aix3*) test "$enable_shared" = yes && enable_static=no if test -n "$RANLIB"; then archive_cmds="$archive_cmds~\$RANLIB \$lib" postinstall_cmds='$RANLIB $lib' fi ;; aix4* | aix5*) if test "$host_cpu" != ia64 && test "$aix_use_runtimelinking" = no ; then test "$enable_shared" = yes && enable_static=no fi ;; esac echo "$as_me:$LINENO: result: $enable_shared" >&5 echo "${ECHO_T}$enable_shared" >&6 echo "$as_me:$LINENO: checking whether to build static libraries" >&5 echo $ECHO_N "checking whether to build static libraries... $ECHO_C" >&6 # Make sure either enable_shared or enable_static is yes. test "$enable_shared" = yes || enable_static=yes echo "$as_me:$LINENO: result: $enable_static" >&5 echo "${ECHO_T}$enable_static" >&6 # The else clause should only fire when bootstrapping the # libtool distribution, otherwise you forgot to ship ltmain.sh # with your package, and you will get complaints that there are # no rules to generate ltmain.sh. if test -f "$ltmain"; then # See if we are running on zsh, and set the options which allow our commands through # without removal of \ escapes. if test -n "${ZSH_VERSION+set}" ; then setopt NO_GLOB_SUBST fi # Now quote all the things that may contain metacharacters while being # careful not to overquote the AC_SUBSTed values. We take copies of the # variables and quote the copies for generation of the libtool script. for var in echo old_CC old_CFLAGS AR AR_FLAGS EGREP RANLIB LN_S LTCC NM \ SED SHELL STRIP \ libname_spec library_names_spec soname_spec extract_expsyms_cmds \ old_striplib striplib file_magic_cmd finish_cmds finish_eval \ deplibs_check_method reload_flag reload_cmds need_locks \ lt_cv_sys_global_symbol_pipe lt_cv_sys_global_symbol_to_cdecl \ lt_cv_sys_global_symbol_to_c_name_address \ sys_lib_search_path_spec sys_lib_dlsearch_path_spec \ old_postinstall_cmds old_postuninstall_cmds \ compiler \ CC \ LD \ lt_prog_compiler_wl \ lt_prog_compiler_pic \ lt_prog_compiler_static \ lt_prog_compiler_no_builtin_flag \ export_dynamic_flag_spec \ thread_safe_flag_spec \ whole_archive_flag_spec \ enable_shared_with_static_runtimes \ old_archive_cmds \ old_archive_from_new_cmds \ predep_objects \ postdep_objects \ predeps \ postdeps \ compiler_lib_search_path \ archive_cmds \ archive_expsym_cmds \ postinstall_cmds \ postuninstall_cmds \ old_archive_from_expsyms_cmds \ allow_undefined_flag \ no_undefined_flag \ export_symbols_cmds \ hardcode_libdir_flag_spec \ hardcode_libdir_flag_spec_ld \ hardcode_libdir_separator \ hardcode_automatic \ module_cmds \ module_expsym_cmds \ lt_cv_prog_compiler_c_o \ exclude_expsyms \ include_expsyms; do case $var in old_archive_cmds | \ old_archive_from_new_cmds | \ archive_cmds | \ archive_expsym_cmds | \ module_cmds | \ module_expsym_cmds | \ old_archive_from_expsyms_cmds | \ export_symbols_cmds | \ extract_expsyms_cmds | reload_cmds | finish_cmds | \ postinstall_cmds | postuninstall_cmds | \ old_postinstall_cmds | old_postuninstall_cmds | \ sys_lib_search_path_spec | sys_lib_dlsearch_path_spec) # Double-quote double-evaled strings. eval "lt_$var=\\\"\`\$echo \"X\$$var\" | \$Xsed -e \"\$double_quote_subst\" -e \"\$sed_quote_subst\" -e \"\$delay_variable_subst\"\`\\\"" ;; *) eval "lt_$var=\\\"\`\$echo \"X\$$var\" | \$Xsed -e \"\$sed_quote_subst\"\`\\\"" ;; esac done case $lt_echo in *'\$0 --fallback-echo"') lt_echo=`$echo "X$lt_echo" | $Xsed -e 's/\\\\\\\$0 --fallback-echo"$/$0 --fallback-echo"/'` ;; esac cfgfile="${ofile}T" trap "$rm \"$cfgfile\"; exit 1" 1 2 15 $rm -f "$cfgfile" { echo "$as_me:$LINENO: creating $ofile" >&5 echo "$as_me: creating $ofile" >&6;} cat <<__EOF__ >> "$cfgfile" #! $SHELL # `$echo "$cfgfile" | sed 's%^.*/%%'` - Provide generalized library-building support services. # Generated automatically by $PROGRAM (GNU $PACKAGE $VERSION$TIMESTAMP) # NOTE: Changes made to this file will be lost: look at ltmain.sh. # # Copyright (C) 1996, 1997, 1998, 1999, 2000, 2001 # Free Software Foundation, Inc. # # This file is part of GNU Libtool: # Originally by Gordon Matzigkeit , 1996 # # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2 of the License, or # (at your option) any later version. # # This program is distributed in the hope that it will be useful, but # WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU # General Public License for more details. # # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA. # # As a special exception to the GNU General Public License, if you # distribute this file as part of a program that contains a # configuration script generated by Autoconf, you may include it under # the same distribution terms that you use for the rest of that program. # A sed program that does not truncate output. SED=$lt_SED # Sed that helps us avoid accidentally triggering echo(1) options like -n. Xsed="$SED -e s/^X//" # The HP-UX ksh and POSIX shell print the target directory to stdout # if CDPATH is set. (unset CDPATH) >/dev/null 2>&1 && unset CDPATH # The names of the tagged configurations supported by this script. available_tags= # ### BEGIN LIBTOOL CONFIG # Libtool was configured on host `(hostname || uname -n) 2>/dev/null | sed 1q`: # Shell to use when invoking shell scripts. SHELL=$lt_SHELL # Whether or not to build shared libraries. build_libtool_libs=$enable_shared # Whether or not to build static libraries. build_old_libs=$enable_static # Whether or not to add -lc for building shared libraries. build_libtool_need_lc=$archive_cmds_need_lc # Whether or not to disallow shared libs when runtime libs are static allow_libtool_libs_with_static_runtimes=$enable_shared_with_static_runtimes # Whether or not to optimize for fast installation. fast_install=$enable_fast_install # The host system. host_alias=$host_alias host=$host # An echo program that does not interpret backslashes. echo=$lt_echo # The archiver. AR=$lt_AR AR_FLAGS=$lt_AR_FLAGS # A C compiler. LTCC=$lt_LTCC # A language-specific compiler. CC=$lt_compiler # Is the compiler the GNU C compiler? with_gcc=$GCC # An ERE matcher. EGREP=$lt_EGREP # The linker used to build libraries. LD=$lt_LD # Whether we need hard or soft links. LN_S=$lt_LN_S # A BSD-compatible nm program. NM=$lt_NM # A symbol stripping program STRIP=$lt_STRIP # Used to examine libraries when file_magic_cmd begins "file" MAGIC_CMD=$MAGIC_CMD # Used on cygwin: DLL creation program. DLLTOOL="$DLLTOOL" # Used on cygwin: object dumper. OBJDUMP="$OBJDUMP" # Used on cygwin: assembler. AS="$AS" # The name of the directory that contains temporary libtool files. objdir=$objdir # How to create reloadable object files. reload_flag=$lt_reload_flag reload_cmds=$lt_reload_cmds # How to pass a linker flag through the compiler. wl=$lt_lt_prog_compiler_wl # Object file suffix (normally "o"). objext="$ac_objext" # Old archive suffix (normally "a"). libext="$libext" # Shared library suffix (normally ".so"). shrext_cmds='$shrext_cmds' # Executable file suffix (normally ""). exeext="$exeext" # Additional compiler flags for building library objects. pic_flag=$lt_lt_prog_compiler_pic pic_mode=$pic_mode # What is the maximum length of a command? max_cmd_len=$lt_cv_sys_max_cmd_len # Does compiler simultaneously support -c and -o options? compiler_c_o=$lt_lt_cv_prog_compiler_c_o # Must we lock files when doing compilation ? need_locks=$lt_need_locks # Do we need the lib prefix for modules? need_lib_prefix=$need_lib_prefix # Do we need a version for libraries? need_version=$need_version # Whether dlopen is supported. dlopen_support=$enable_dlopen # Whether dlopen of programs is supported. dlopen_self=$enable_dlopen_self # Whether dlopen of statically linked programs is supported. dlopen_self_static=$enable_dlopen_self_static # Compiler flag to prevent dynamic linking. link_static_flag=$lt_lt_prog_compiler_static # Compiler flag to turn off builtin functions. no_builtin_flag=$lt_lt_prog_compiler_no_builtin_flag # Compiler flag to allow reflexive dlopens. export_dynamic_flag_spec=$lt_export_dynamic_flag_spec # Compiler flag to generate shared objects directly from archives. whole_archive_flag_spec=$lt_whole_archive_flag_spec # Compiler flag to generate thread-safe objects. thread_safe_flag_spec=$lt_thread_safe_flag_spec # Library versioning type. version_type=$version_type # Format of library name prefix. libname_spec=$lt_libname_spec # List of archive names. First name is the real one, the rest are links. # The last name is the one that the linker finds with -lNAME. library_names_spec=$lt_library_names_spec # The coded name of the library, if different from the real name. soname_spec=$lt_soname_spec # Commands used to build and install an old-style archive. RANLIB=$lt_RANLIB old_archive_cmds=$lt_old_archive_cmds old_postinstall_cmds=$lt_old_postinstall_cmds old_postuninstall_cmds=$lt_old_postuninstall_cmds # Create an old-style archive from a shared archive. old_archive_from_new_cmds=$lt_old_archive_from_new_cmds # Create a temporary old-style archive to link instead of a shared archive. old_archive_from_expsyms_cmds=$lt_old_archive_from_expsyms_cmds # Commands used to build and install a shared archive. archive_cmds=$lt_archive_cmds archive_expsym_cmds=$lt_archive_expsym_cmds postinstall_cmds=$lt_postinstall_cmds postuninstall_cmds=$lt_postuninstall_cmds # Commands used to build a loadable module (assumed same as above if empty) module_cmds=$lt_module_cmds module_expsym_cmds=$lt_module_expsym_cmds # Commands to strip libraries. old_striplib=$lt_old_striplib striplib=$lt_striplib # Dependencies to place before the objects being linked to create a # shared library. predep_objects=$lt_predep_objects # Dependencies to place after the objects being linked to create a # shared library. postdep_objects=$lt_postdep_objects # Dependencies to place before the objects being linked to create a # shared library. predeps=$lt_predeps # Dependencies to place after the objects being linked to create a # shared library. postdeps=$lt_postdeps # The library search path used internally by the compiler when linking # a shared library. compiler_lib_search_path=$lt_compiler_lib_search_path # Method to check whether dependent libraries are shared objects. deplibs_check_method=$lt_deplibs_check_method # Command to use when deplibs_check_method == file_magic. file_magic_cmd=$lt_file_magic_cmd # Flag that allows shared libraries with undefined symbols to be built. allow_undefined_flag=$lt_allow_undefined_flag # Flag that forces no undefined symbols. no_undefined_flag=$lt_no_undefined_flag # Commands used to finish a libtool library installation in a directory. finish_cmds=$lt_finish_cmds # Same as above, but a single script fragment to be evaled but not shown. finish_eval=$lt_finish_eval # Take the output of nm and produce a listing of raw symbols and C names. global_symbol_pipe=$lt_lt_cv_sys_global_symbol_pipe # Transform the output of nm in a proper C declaration global_symbol_to_cdecl=$lt_lt_cv_sys_global_symbol_to_cdecl # Transform the output of nm in a C name address pair global_symbol_to_c_name_address=$lt_lt_cv_sys_global_symbol_to_c_name_address # This is the shared library runtime path variable. runpath_var=$runpath_var # This is the shared library path variable. shlibpath_var=$shlibpath_var # Is shlibpath searched before the hard-coded library search path? shlibpath_overrides_runpath=$shlibpath_overrides_runpath # How to hardcode a shared library path into an executable. hardcode_action=$hardcode_action # Whether we should hardcode library paths into libraries. hardcode_into_libs=$hardcode_into_libs # Flag to hardcode \$libdir into a binary during linking. # This must work even if \$libdir does not exist. hardcode_libdir_flag_spec=$lt_hardcode_libdir_flag_spec # If ld is used when linking, flag to hardcode \$libdir into # a binary during linking. This must work even if \$libdir does # not exist. hardcode_libdir_flag_spec_ld=$lt_hardcode_libdir_flag_spec_ld # Whether we need a single -rpath flag with a separated argument. hardcode_libdir_separator=$lt_hardcode_libdir_separator # Set to yes if using DIR/libNAME${shared_ext} during linking hardcodes DIR into the # resulting binary. hardcode_direct=$hardcode_direct # Set to yes if using the -LDIR flag during linking hardcodes DIR into the # resulting binary. hardcode_minus_L=$hardcode_minus_L # Set to yes if using SHLIBPATH_VAR=DIR during linking hardcodes DIR into # the resulting binary. hardcode_shlibpath_var=$hardcode_shlibpath_var # Set to yes if building a shared library automatically hardcodes DIR into the library # and all subsequent libraries and executables linked against it. hardcode_automatic=$hardcode_automatic # Variables whose values should be saved in libtool wrapper scripts and # restored at relink time. variables_saved_for_relink="$variables_saved_for_relink" # Whether libtool must link a program against all its dependency libraries. link_all_deplibs=$link_all_deplibs # Compile-time system search path for libraries sys_lib_search_path_spec=$lt_sys_lib_search_path_spec # Run-time system search path for libraries sys_lib_dlsearch_path_spec=$lt_sys_lib_dlsearch_path_spec # Fix the shell variable \$srcfile for the compiler. fix_srcfile_path="$fix_srcfile_path" # Set to yes if exported symbols are required. always_export_symbols=$always_export_symbols # The commands to list exported symbols. export_symbols_cmds=$lt_export_symbols_cmds # The commands to extract the exported symbol list from a shared archive. extract_expsyms_cmds=$lt_extract_expsyms_cmds # Symbols that should not be listed in the preloaded symbols. exclude_expsyms=$lt_exclude_expsyms # Symbols that must always be exported. include_expsyms=$lt_include_expsyms # ### END LIBTOOL CONFIG __EOF__ case $host_os in aix3*) cat <<\EOF >> "$cfgfile" # AIX sometimes has problems with the GCC collect2 program. For some # reason, if we set the COLLECT_NAMES environment variable, the problems # vanish in a puff of smoke. if test "X${COLLECT_NAMES+set}" != Xset; then COLLECT_NAMES= export COLLECT_NAMES fi EOF ;; esac # We use sed instead of cat because bash on DJGPP gets confused if # if finds mixed CR/LF and LF-only lines. Since sed operates in # text mode, it properly converts lines to CR/LF. This bash problem # is reportedly fixed, but why not run on old versions too? sed '$q' "$ltmain" >> "$cfgfile" || (rm -f "$cfgfile"; exit 1) mv -f "$cfgfile" "$ofile" || \ (rm -f "$ofile" && cp "$cfgfile" "$ofile" && rm -f "$cfgfile") chmod +x "$ofile" else # If there is no Makefile yet, we rely on a make rule to execute # `config.status --recheck' to rerun these tests and create the # libtool script then. ltmain_in=`echo $ltmain | sed -e 's/\.sh$/.in/'` if test -f "$ltmain_in"; then test -f Makefile && make "$ltmain" fi fi ac_ext=c ac_cpp='$CPP $CPPFLAGS' ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' ac_compiler_gnu=$ac_cv_c_compiler_gnu CC="$lt_save_CC" # Check whether --with-tags or --without-tags was given. if test "${with_tags+set}" = set; then withval="$with_tags" tagnames="$withval" fi; if test -f "$ltmain" && test -n "$tagnames"; then if test ! -f "${ofile}"; then { echo "$as_me:$LINENO: WARNING: output file \`$ofile' does not exist" >&5 echo "$as_me: WARNING: output file \`$ofile' does not exist" >&2;} fi if test -z "$LTCC"; then eval "`$SHELL ${ofile} --config | grep '^LTCC='`" if test -z "$LTCC"; then { echo "$as_me:$LINENO: WARNING: output file \`$ofile' does not look like a libtool script" >&5 echo "$as_me: WARNING: output file \`$ofile' does not look like a libtool script" >&2;} else { echo "$as_me:$LINENO: WARNING: using \`LTCC=$LTCC', extracted from \`$ofile'" >&5 echo "$as_me: WARNING: using \`LTCC=$LTCC', extracted from \`$ofile'" >&2;} fi fi # Extract list of available tagged configurations in $ofile. # Note that this assumes the entire list is on one line. available_tags=`grep "^available_tags=" "${ofile}" | $SED -e 's/available_tags=\(.*$\)/\1/' -e 's/\"//g'` lt_save_ifs="$IFS"; IFS="${IFS}$PATH_SEPARATOR," for tagname in $tagnames; do IFS="$lt_save_ifs" # Check whether tagname contains only valid characters case `$echo "X$tagname" | $Xsed -e 's:[-_ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz1234567890,/]::g'` in "") ;; *) { { echo "$as_me:$LINENO: error: invalid tag name: $tagname" >&5 echo "$as_me: error: invalid tag name: $tagname" >&2;} { (exit 1); exit 1; }; } ;; esac if grep "^# ### BEGIN LIBTOOL TAG CONFIG: $tagname$" < "${ofile}" > /dev/null then { { echo "$as_me:$LINENO: error: tag name \"$tagname\" already exists" >&5 echo "$as_me: error: tag name \"$tagname\" already exists" >&2;} { (exit 1); exit 1; }; } fi # Update the list of available tags. if test -n "$tagname"; then echo appending configuration tag \"$tagname\" to $ofile case $tagname in CXX) if test -n "$CXX" && ( test "X$CXX" != "Xno" && ( (test "X$CXX" = "Xg++" && `g++ -v >/dev/null 2>&1` ) || (test "X$CXX" != "Xg++"))) ; then ac_ext=cc ac_cpp='$CXXCPP $CPPFLAGS' ac_compile='$CXX -c $CXXFLAGS $CPPFLAGS conftest.$ac_ext >&5' ac_link='$CXX -o conftest$ac_exeext $CXXFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' ac_compiler_gnu=$ac_cv_cxx_compiler_gnu archive_cmds_need_lc_CXX=no allow_undefined_flag_CXX= always_export_symbols_CXX=no archive_expsym_cmds_CXX= export_dynamic_flag_spec_CXX= hardcode_direct_CXX=no hardcode_libdir_flag_spec_CXX= hardcode_libdir_flag_spec_ld_CXX= hardcode_libdir_separator_CXX= hardcode_minus_L_CXX=no hardcode_automatic_CXX=no module_cmds_CXX= module_expsym_cmds_CXX= link_all_deplibs_CXX=unknown old_archive_cmds_CXX=$old_archive_cmds no_undefined_flag_CXX= whole_archive_flag_spec_CXX= enable_shared_with_static_runtimes_CXX=no # Dependencies to place before and after the object being linked: predep_objects_CXX= postdep_objects_CXX= predeps_CXX= postdeps_CXX= compiler_lib_search_path_CXX= # Source file extension for C++ test sources. ac_ext=cc # Object file extension for compiled C++ test sources. objext=o objext_CXX=$objext # Code to be used in simple compile tests lt_simple_compile_test_code="int some_variable = 0;\n" # Code to be used in simple link tests lt_simple_link_test_code='int main(int, char *) { return(0); }\n' # ltmain only uses $CC for tagged configurations so make sure $CC is set. # If no C compiler was specified, use CC. LTCC=${LTCC-"$CC"} # Allow CC to be a program name with arguments. compiler=$CC # Allow CC to be a program name with arguments. lt_save_CC=$CC lt_save_LD=$LD lt_save_GCC=$GCC GCC=$GXX lt_save_with_gnu_ld=$with_gnu_ld lt_save_path_LD=$lt_cv_path_LD if test -n "${lt_cv_prog_gnu_ldcxx+set}"; then lt_cv_prog_gnu_ld=$lt_cv_prog_gnu_ldcxx else unset lt_cv_prog_gnu_ld fi if test -n "${lt_cv_path_LDCXX+set}"; then lt_cv_path_LD=$lt_cv_path_LDCXX else unset lt_cv_path_LD fi test -z "${LDCXX+set}" || LD=$LDCXX CC=${CXX-"c++"} compiler=$CC compiler_CXX=$CC cc_basename=`$echo X"$compiler" | $Xsed -e 's%^.*/%%'` # We don't want -fno-exception wen compiling C++ code, so set the # no_builtin_flag separately if test "$GXX" = yes; then lt_prog_compiler_no_builtin_flag_CXX=' -fno-builtin' else lt_prog_compiler_no_builtin_flag_CXX= fi if test "$GXX" = yes; then # Set up default GNU C++ configuration # Check whether --with-gnu-ld or --without-gnu-ld was given. if test "${with_gnu_ld+set}" = set; then withval="$with_gnu_ld" test "$withval" = no || with_gnu_ld=yes else with_gnu_ld=no fi; ac_prog=ld if test "$GCC" = yes; then # Check if gcc -print-prog-name=ld gives a path. echo "$as_me:$LINENO: checking for ld used by $CC" >&5 echo $ECHO_N "checking for ld used by $CC... $ECHO_C" >&6 case $host in *-*-mingw*) # gcc leaves a trailing carriage return which upsets mingw ac_prog=`($CC -print-prog-name=ld) 2>&5 | tr -d '\015'` ;; *) ac_prog=`($CC -print-prog-name=ld) 2>&5` ;; esac case $ac_prog in # Accept absolute paths. [\\/]* | ?:[\\/]*) re_direlt='/[^/][^/]*/\.\./' # Canonicalize the pathname of ld ac_prog=`echo $ac_prog| $SED 's%\\\\%/%g'` while echo $ac_prog | grep "$re_direlt" > /dev/null 2>&1; do ac_prog=`echo $ac_prog| $SED "s%$re_direlt%/%"` done test -z "$LD" && LD="$ac_prog" ;; "") # If it fails, then pretend we aren't using GCC. ac_prog=ld ;; *) # If it is relative, then search for the first ld in PATH. with_gnu_ld=unknown ;; esac elif test "$with_gnu_ld" = yes; then echo "$as_me:$LINENO: checking for GNU ld" >&5 echo $ECHO_N "checking for GNU ld... $ECHO_C" >&6 else echo "$as_me:$LINENO: checking for non-GNU ld" >&5 echo $ECHO_N "checking for non-GNU ld... $ECHO_C" >&6 fi if test "${lt_cv_path_LD+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test -z "$LD"; then lt_save_ifs="$IFS"; IFS=$PATH_SEPARATOR for ac_dir in $PATH; do IFS="$lt_save_ifs" test -z "$ac_dir" && ac_dir=. if test -f "$ac_dir/$ac_prog" || test -f "$ac_dir/$ac_prog$ac_exeext"; then lt_cv_path_LD="$ac_dir/$ac_prog" # Check to see if the program is GNU ld. I'd rather use --version, # but apparently some GNU ld's only accept -v. # Break only if it was the GNU/non-GNU ld that we prefer. case `"$lt_cv_path_LD" -v 2>&1 &5 echo "${ECHO_T}$LD" >&6 else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 fi test -z "$LD" && { { echo "$as_me:$LINENO: error: no acceptable ld found in \$PATH" >&5 echo "$as_me: error: no acceptable ld found in \$PATH" >&2;} { (exit 1); exit 1; }; } echo "$as_me:$LINENO: checking if the linker ($LD) is GNU ld" >&5 echo $ECHO_N "checking if the linker ($LD) is GNU ld... $ECHO_C" >&6 if test "${lt_cv_prog_gnu_ld+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else # I'd rather use --version here, but apparently some GNU ld's only accept -v. case `$LD -v 2>&1 &5 echo "${ECHO_T}$lt_cv_prog_gnu_ld" >&6 with_gnu_ld=$lt_cv_prog_gnu_ld # Check if GNU C++ uses GNU ld as the underlying linker, since the # archiving commands below assume that GNU ld is being used. if test "$with_gnu_ld" = yes; then archive_cmds_CXX='$CC -shared -nostdlib $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags ${wl}-soname $wl$soname -o $lib' archive_expsym_cmds_CXX='$CC -shared -nostdlib $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags ${wl}-soname $wl$soname ${wl}-retain-symbols-file $wl$export_symbols -o $lib' hardcode_libdir_flag_spec_CXX='${wl}--rpath ${wl}$libdir' export_dynamic_flag_spec_CXX='${wl}--export-dynamic' # If archive_cmds runs LD, not CC, wlarc should be empty # XXX I think wlarc can be eliminated in ltcf-cxx, but I need to # investigate it a little bit more. (MM) wlarc='${wl}' # ancient GNU ld didn't support --whole-archive et. al. if eval "`$CC -print-prog-name=ld` --help 2>&1" | \ grep 'no-whole-archive' > /dev/null; then whole_archive_flag_spec_CXX="$wlarc"'--whole-archive$convenience '"$wlarc"'--no-whole-archive' else whole_archive_flag_spec_CXX= fi else with_gnu_ld=no wlarc= # A generic and very simple default shared library creation # command for GNU C++ for the case where it uses the native # linker, instead of GNU ld. If possible, this setting should # overridden to take advantage of the native linker features on # the platform it is being used on. archive_cmds_CXX='$CC -shared -nostdlib $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags -o $lib' fi # Commands to make compiler produce verbose output that lists # what "hidden" libraries, object files and flags are used when # linking a shared library. output_verbose_link_cmd='$CC -shared $CFLAGS -v conftest.$objext 2>&1 | grep "\-L"' else GXX=no with_gnu_ld=no wlarc= fi # PORTME: fill in a description of your system's C++ link characteristics echo "$as_me:$LINENO: checking whether the $compiler linker ($LD) supports shared libraries" >&5 echo $ECHO_N "checking whether the $compiler linker ($LD) supports shared libraries... $ECHO_C" >&6 ld_shlibs_CXX=yes case $host_os in aix3*) # FIXME: insert proper C++ library support ld_shlibs_CXX=no ;; aix4* | aix5*) if test "$host_cpu" = ia64; then # On IA64, the linker does run time linking by default, so we don't # have to do anything special. aix_use_runtimelinking=no exp_sym_flag='-Bexport' no_entry_flag="" else aix_use_runtimelinking=no # Test if we are trying to use run time linking or normal # AIX style linking. If -brtl is somewhere in LDFLAGS, we # need to do runtime linking. case $host_os in aix4.[23]|aix4.[23].*|aix5*) for ld_flag in $LDFLAGS; do case $ld_flag in *-brtl*) aix_use_runtimelinking=yes break ;; esac done esac exp_sym_flag='-bexport' no_entry_flag='-bnoentry' fi # When large executables or shared objects are built, AIX ld can # have problems creating the table of contents. If linking a library # or program results in "error TOC overflow" add -mminimal-toc to # CXXFLAGS/CFLAGS for g++/gcc. In the cases where that is not # enough to fix the problem, add -Wl,-bbigtoc to LDFLAGS. archive_cmds_CXX='' hardcode_direct_CXX=yes hardcode_libdir_separator_CXX=':' link_all_deplibs_CXX=yes if test "$GXX" = yes; then case $host_os in aix4.012|aix4.012.*) # We only want to do this on AIX 4.2 and lower, the check # below for broken collect2 doesn't work under 4.3+ collect2name=`${CC} -print-prog-name=collect2` if test -f "$collect2name" && \ strings "$collect2name" | grep resolve_lib_name >/dev/null then # We have reworked collect2 hardcode_direct_CXX=yes else # We have old collect2 hardcode_direct_CXX=unsupported # It fails to find uninstalled libraries when the uninstalled # path is not listed in the libpath. Setting hardcode_minus_L # to unsupported forces relinking hardcode_minus_L_CXX=yes hardcode_libdir_flag_spec_CXX='-L$libdir' hardcode_libdir_separator_CXX= fi esac shared_flag='-shared' else # not using gcc if test "$host_cpu" = ia64; then # VisualAge C++, Version 5.5 for AIX 5L for IA-64, Beta 3 Release # chokes on -Wl,-G. The following line is correct: shared_flag='-G' else if test "$aix_use_runtimelinking" = yes; then shared_flag='${wl}-G' else shared_flag='${wl}-bM:SRE' fi fi fi # It seems that -bexpall does not export symbols beginning with # underscore (_), so it is better to generate a list of symbols to export. always_export_symbols_CXX=yes if test "$aix_use_runtimelinking" = yes; then # Warning - without using the other runtime loading flags (-brtl), # -berok will link without error, but may produce a broken library. allow_undefined_flag_CXX='-berok' # Determine the default libpath from the value encoded in an empty executable. cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ int main () { ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_cxx_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then aix_libpath=`dump -H conftest$ac_exeext 2>/dev/null | $SED -n -e '/Import File Strings/,/^$/ { /^0/ { s/^0 *\(.*\)$/\1/; p; } }'` # Check for a 64-bit object if we didn't find anything. if test -z "$aix_libpath"; then aix_libpath=`dump -HX64 conftest$ac_exeext 2>/dev/null | $SED -n -e '/Import File Strings/,/^$/ { /^0/ { s/^0 *\(.*\)$/\1/; p; } }'`; fi else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 fi rm -f conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext if test -z "$aix_libpath"; then aix_libpath="/usr/lib:/lib"; fi hardcode_libdir_flag_spec_CXX='${wl}-blibpath:$libdir:'"$aix_libpath" archive_expsym_cmds_CXX="\$CC"' -o $output_objdir/$soname $libobjs $deplibs $compiler_flags `if test "x${allow_undefined_flag}" != "x"; then echo "${wl}${allow_undefined_flag}"; else :; fi` '"\${wl}$no_entry_flag \${wl}$exp_sym_flag:\$export_symbols $shared_flag" else if test "$host_cpu" = ia64; then hardcode_libdir_flag_spec_CXX='${wl}-R $libdir:/usr/lib:/lib' allow_undefined_flag_CXX="-z nodefs" archive_expsym_cmds_CXX="\$CC $shared_flag"' -o $output_objdir/$soname $libobjs $deplibs $compiler_flags ${wl}${allow_undefined_flag} '"\${wl}$no_entry_flag \${wl}$exp_sym_flag:\$export_symbols" else # Determine the default libpath from the value encoded in an empty executable. cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ int main () { ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_cxx_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then aix_libpath=`dump -H conftest$ac_exeext 2>/dev/null | $SED -n -e '/Import File Strings/,/^$/ { /^0/ { s/^0 *\(.*\)$/\1/; p; } }'` # Check for a 64-bit object if we didn't find anything. if test -z "$aix_libpath"; then aix_libpath=`dump -HX64 conftest$ac_exeext 2>/dev/null | $SED -n -e '/Import File Strings/,/^$/ { /^0/ { s/^0 *\(.*\)$/\1/; p; } }'`; fi else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 fi rm -f conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext if test -z "$aix_libpath"; then aix_libpath="/usr/lib:/lib"; fi hardcode_libdir_flag_spec_CXX='${wl}-blibpath:$libdir:'"$aix_libpath" # Warning - without using the other run time loading flags, # -berok will link without error, but may produce a broken library. no_undefined_flag_CXX=' ${wl}-bernotok' allow_undefined_flag_CXX=' ${wl}-berok' # -bexpall does not export symbols beginning with underscore (_) always_export_symbols_CXX=yes # Exported symbols can be pulled into shared objects from archives whole_archive_flag_spec_CXX=' ' archive_cmds_need_lc_CXX=yes # This is similar to how AIX traditionally builds it's shared libraries. archive_expsym_cmds_CXX="\$CC $shared_flag"' -o $output_objdir/$soname $libobjs $deplibs $compiler_flags ${wl}-bE:$export_symbols ${wl}-bnoentry${allow_undefined_flag}~$AR $AR_FLAGS $output_objdir/$libname$release.a $output_objdir/$soname' fi fi ;; chorus*) case $cc_basename in *) # FIXME: insert proper C++ library support ld_shlibs_CXX=no ;; esac ;; cygwin* | mingw* | pw32*) # _LT_AC_TAGVAR(hardcode_libdir_flag_spec, CXX) is actually meaningless, # as there is no search path for DLLs. hardcode_libdir_flag_spec_CXX='-L$libdir' allow_undefined_flag_CXX=unsupported always_export_symbols_CXX=no enable_shared_with_static_runtimes_CXX=yes if $LD --help 2>&1 | grep 'auto-import' > /dev/null; then archive_cmds_CXX='$CC -shared -nostdlib $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags -o $output_objdir/$soname ${wl}--image-base=0x10000000 ${wl}--out-implib,$lib' # If the export-symbols file already is a .def file (1st line # is EXPORTS), use it as is; otherwise, prepend... archive_expsym_cmds_CXX='if test "x`$SED 1q $export_symbols`" = xEXPORTS; then cp $export_symbols $output_objdir/$soname.def; else echo EXPORTS > $output_objdir/$soname.def; cat $export_symbols >> $output_objdir/$soname.def; fi~ $CC -shared -nostdlib $output_objdir/$soname.def $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags -o $output_objdir/$soname ${wl}--image-base=0x10000000 ${wl}--out-implib,$lib' else ld_shlibs_CXX=no fi ;; darwin* | rhapsody*) case "$host_os" in rhapsody* | darwin1.[012]) allow_undefined_flag_CXX='${wl}-undefined ${wl}suppress' ;; *) # Darwin 1.3 on if test -z ${MACOSX_DEPLOYMENT_TARGET} ; then allow_undefined_flag_CXX='${wl}-flat_namespace ${wl}-undefined ${wl}suppress' else case ${MACOSX_DEPLOYMENT_TARGET} in 10.[012]) allow_undefined_flag_CXX='${wl}-flat_namespace ${wl}-undefined ${wl}suppress' ;; 10.*) allow_undefined_flag_CXX='${wl}-undefined ${wl}dynamic_lookup' ;; esac fi ;; esac archive_cmds_need_lc_CXX=no hardcode_direct_CXX=no hardcode_automatic_CXX=yes hardcode_shlibpath_var_CXX=unsupported whole_archive_flag_spec_CXX='' link_all_deplibs_CXX=yes if test "$GXX" = yes ; then lt_int_apple_cc_single_mod=no output_verbose_link_cmd='echo' if $CC -dumpspecs 2>&1 | $EGREP 'single_module' >/dev/null ; then lt_int_apple_cc_single_mod=yes fi if test "X$lt_int_apple_cc_single_mod" = Xyes ; then archive_cmds_CXX='$CC -dynamiclib -single_module $allow_undefined_flag -o $lib $libobjs $deplibs $compiler_flags -install_name $rpath/$soname $verstring' else archive_cmds_CXX='$CC -r -keep_private_externs -nostdlib -o ${lib}-master.o $libobjs~$CC -dynamiclib $allow_undefined_flag -o $lib ${lib}-master.o $deplibs $compiler_flags -install_name $rpath/$soname $verstring' fi module_cmds_CXX='$CC $allow_undefined_flag -o $lib -bundle $libobjs $deplibs$compiler_flags' # Don't fix this by using the ld -exported_symbols_list flag, it doesn't exist in older darwin ld's if test "X$lt_int_apple_cc_single_mod" = Xyes ; then archive_expsym_cmds_CXX='sed -e "s,#.*,," -e "s,^[ ]*,," -e "s,^\(..*\),_&," < $export_symbols > $output_objdir/${libname}-symbols.expsym~$CC -dynamiclib -single_module $allow_undefined_flag -o $lib $libobjs $deplibs $compiler_flags -install_name $rpath/$soname $verstring~nmedit -s $output_objdir/${libname}-symbols.expsym ${lib}' else archive_expsym_cmds_CXX='sed -e "s,#.*,," -e "s,^[ ]*,," -e "s,^\(..*\),_&," < $export_symbols > $output_objdir/${libname}-symbols.expsym~$CC -r -keep_private_externs -nostdlib -o ${lib}-master.o $libobjs~$CC -dynamiclib $allow_undefined_flag -o $lib ${lib}-master.o $deplibs $compiler_flags -install_name $rpath/$soname $verstring~nmedit -s $output_objdir/${libname}-symbols.expsym ${lib}' fi module_expsym_cmds_CXX='sed -e "s,#.*,," -e "s,^[ ]*,," -e "s,^\(..*\),_&," < $export_symbols > $output_objdir/${libname}-symbols.expsym~$CC $allow_undefined_flag -o $lib -bundle $libobjs $deplibs$compiler_flags~nmedit -s $output_objdir/${libname}-symbols.expsym ${lib}' else case "$cc_basename" in xlc*) output_verbose_link_cmd='echo' archive_cmds_CXX='$CC -qmkshrobj ${wl}-single_module $allow_undefined_flag -o $lib $libobjs $deplibs $compiler_flags ${wl}-install_name ${wl}`echo $rpath/$soname` $verstring' module_cmds_CXX='$CC $allow_undefined_flag -o $lib -bundle $libobjs $deplibs$compiler_flags' # Don't fix this by using the ld -exported_symbols_list flag, it doesn't exist in older darwin ld's archive_expsym_cmds_CXX='sed -e "s,#.*,," -e "s,^[ ]*,," -e "s,^\(..*\),_&," < $export_symbols > $output_objdir/${libname}-symbols.expsym~$CC -qmkshrobj ${wl}-single_module $allow_undefined_flag -o $lib $libobjs $deplibs $compiler_flags ${wl}-install_name ${wl}$rpath/$soname $verstring~nmedit -s $output_objdir/${libname}-symbols.expsym ${lib}' module_expsym_cmds_CXX='sed -e "s,#.*,," -e "s,^[ ]*,," -e "s,^\(..*\),_&," < $export_symbols > $output_objdir/${libname}-symbols.expsym~$CC $allow_undefined_flag -o $lib -bundle $libobjs $deplibs$compiler_flags~nmedit -s $output_objdir/${libname}-symbols.expsym ${lib}' ;; *) ld_shlibs_CXX=no ;; esac fi ;; dgux*) case $cc_basename in ec++) # FIXME: insert proper C++ library support ld_shlibs_CXX=no ;; ghcx) # Green Hills C++ Compiler # FIXME: insert proper C++ library support ld_shlibs_CXX=no ;; *) # FIXME: insert proper C++ library support ld_shlibs_CXX=no ;; esac ;; freebsd12*) # C++ shared libraries reported to be fairly broken before switch to ELF ld_shlibs_CXX=no ;; freebsd-elf*) archive_cmds_need_lc_CXX=no ;; freebsd* | kfreebsd*-gnu) # FreeBSD 3 and later use GNU C++ and GNU ld with standard ELF # conventions ld_shlibs_CXX=yes ;; gnu*) ;; hpux9*) hardcode_libdir_flag_spec_CXX='${wl}+b ${wl}$libdir' hardcode_libdir_separator_CXX=: export_dynamic_flag_spec_CXX='${wl}-E' hardcode_direct_CXX=yes hardcode_minus_L_CXX=yes # Not in the search PATH, # but as the default # location of the library. case $cc_basename in CC) # FIXME: insert proper C++ library support ld_shlibs_CXX=no ;; aCC) archive_cmds_CXX='$rm $output_objdir/$soname~$CC -b ${wl}+b ${wl}$install_libdir -o $output_objdir/$soname $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags~test $output_objdir/$soname = $lib || mv $output_objdir/$soname $lib' # Commands to make compiler produce verbose output that lists # what "hidden" libraries, object files and flags are used when # linking a shared library. # # There doesn't appear to be a way to prevent this compiler from # explicitly linking system object files so we need to strip them # from the output so that they don't get included in the library # dependencies. output_verbose_link_cmd='templist=`($CC -b $CFLAGS -v conftest.$objext 2>&1) | grep "-L"`; list=""; for z in $templist; do case $z in conftest.$objext) list="$list $z";; *.$objext);; *) list="$list $z";;esac; done; echo $list' ;; *) if test "$GXX" = yes; then archive_cmds_CXX='$rm $output_objdir/$soname~$CC -shared -nostdlib -fPIC ${wl}+b ${wl}$install_libdir -o $output_objdir/$soname $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags~test $output_objdir/$soname = $lib || mv $output_objdir/$soname $lib' else # FIXME: insert proper C++ library support ld_shlibs_CXX=no fi ;; esac ;; hpux10*|hpux11*) if test $with_gnu_ld = no; then case "$host_cpu" in hppa*64*) hardcode_libdir_flag_spec_CXX='${wl}+b ${wl}$libdir' hardcode_libdir_flag_spec_ld_CXX='+b $libdir' hardcode_libdir_separator_CXX=: ;; ia64*) hardcode_libdir_flag_spec_CXX='-L$libdir' ;; *) hardcode_libdir_flag_spec_CXX='${wl}+b ${wl}$libdir' hardcode_libdir_separator_CXX=: export_dynamic_flag_spec_CXX='${wl}-E' ;; esac fi case "$host_cpu" in hppa*64*) hardcode_direct_CXX=no hardcode_shlibpath_var_CXX=no ;; ia64*) hardcode_direct_CXX=no hardcode_shlibpath_var_CXX=no hardcode_minus_L_CXX=yes # Not in the search PATH, # but as the default # location of the library. ;; *) hardcode_direct_CXX=yes hardcode_minus_L_CXX=yes # Not in the search PATH, # but as the default # location of the library. ;; esac case $cc_basename in CC) # FIXME: insert proper C++ library support ld_shlibs_CXX=no ;; aCC) case "$host_cpu" in hppa*64*|ia64*) archive_cmds_CXX='$LD -b +h $soname -o $lib $linker_flags $libobjs $deplibs' ;; *) archive_cmds_CXX='$CC -b ${wl}+h ${wl}$soname ${wl}+b ${wl}$install_libdir -o $lib $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags' ;; esac # Commands to make compiler produce verbose output that lists # what "hidden" libraries, object files and flags are used when # linking a shared library. # # There doesn't appear to be a way to prevent this compiler from # explicitly linking system object files so we need to strip them # from the output so that they don't get included in the library # dependencies. output_verbose_link_cmd='templist=`($CC -b $CFLAGS -v conftest.$objext 2>&1) | grep "\-L"`; list=""; for z in $templist; do case $z in conftest.$objext) list="$list $z";; *.$objext);; *) list="$list $z";;esac; done; echo $list' ;; *) if test "$GXX" = yes; then if test $with_gnu_ld = no; then case "$host_cpu" in ia64*|hppa*64*) archive_cmds_CXX='$LD -b +h $soname -o $lib $linker_flags $libobjs $deplibs' ;; *) archive_cmds_CXX='$CC -shared -nostdlib -fPIC ${wl}+h ${wl}$soname ${wl}+b ${wl}$install_libdir -o $lib $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags' ;; esac fi else # FIXME: insert proper C++ library support ld_shlibs_CXX=no fi ;; esac ;; irix5* | irix6*) case $cc_basename in CC) # SGI C++ archive_cmds_CXX='$CC -shared -all -multigot $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags -soname $soname `test -n "$verstring" && echo -set_version $verstring` -update_registry ${objdir}/so_locations -o $lib' # Archives containing C++ object files must be created using # "CC -ar", where "CC" is the IRIX C++ compiler. This is # necessary to make sure instantiated templates are included # in the archive. old_archive_cmds_CXX='$CC -ar -WR,-u -o $oldlib $oldobjs' ;; *) if test "$GXX" = yes; then if test "$with_gnu_ld" = no; then archive_cmds_CXX='$CC -shared -nostdlib $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags ${wl}-soname ${wl}$soname `test -n "$verstring" && echo ${wl}-set_version ${wl}$verstring` ${wl}-update_registry ${wl}${objdir}/so_locations -o $lib' else archive_cmds_CXX='$CC -shared -nostdlib $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags ${wl}-soname ${wl}$soname `test -n "$verstring" && echo ${wl}-set_version ${wl}$verstring` -o $lib' fi fi link_all_deplibs_CXX=yes ;; esac hardcode_libdir_flag_spec_CXX='${wl}-rpath ${wl}$libdir' hardcode_libdir_separator_CXX=: ;; linux*) case $cc_basename in KCC) # Kuck and Associates, Inc. (KAI) C++ Compiler # KCC will only create a shared library if the output file # ends with ".so" (or ".sl" for HP-UX), so rename the library # to its proper name (with version) after linking. archive_cmds_CXX='tempext=`echo $shared_ext | $SED -e '\''s/\([^()0-9A-Za-z{}]\)/\\\\\1/g'\''`; templib=`echo $lib | $SED -e "s/\${tempext}\..*/.so/"`; $CC $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags --soname $soname -o \$templib; mv \$templib $lib' archive_expsym_cmds_CXX='tempext=`echo $shared_ext | $SED -e '\''s/\([^()0-9A-Za-z{}]\)/\\\\\1/g'\''`; templib=`echo $lib | $SED -e "s/\${tempext}\..*/.so/"`; $CC $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags --soname $soname -o \$templib ${wl}-retain-symbols-file,$export_symbols; mv \$templib $lib' # Commands to make compiler produce verbose output that lists # what "hidden" libraries, object files and flags are used when # linking a shared library. # # There doesn't appear to be a way to prevent this compiler from # explicitly linking system object files so we need to strip them # from the output so that they don't get included in the library # dependencies. output_verbose_link_cmd='templist=`$CC $CFLAGS -v conftest.$objext -o libconftest$shared_ext 2>&1 | grep "ld"`; rm -f libconftest$shared_ext; list=""; for z in $templist; do case $z in conftest.$objext) list="$list $z";; *.$objext);; *) list="$list $z";;esac; done; echo $list' hardcode_libdir_flag_spec_CXX='${wl}--rpath,$libdir' export_dynamic_flag_spec_CXX='${wl}--export-dynamic' # Archives containing C++ object files must be created using # "CC -Bstatic", where "CC" is the KAI C++ compiler. old_archive_cmds_CXX='$CC -Bstatic -o $oldlib $oldobjs' ;; icpc) # Intel C++ with_gnu_ld=yes # version 8.0 and above of icpc choke on multiply defined symbols # if we add $predep_objects and $postdep_objects, however 7.1 and # earlier do not add the objects themselves. case `$CC -V 2>&1` in *"Version 7."*) archive_cmds_CXX='$CC -shared $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags ${wl}-soname $wl$soname -o $lib' archive_expsym_cmds_CXX='$CC -shared $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags ${wl}-soname $wl$soname ${wl}-retain-symbols-file $wl$export_symbols -o $lib' ;; *) # Version 8.0 or newer archive_cmds_CXX='$CC -shared $libobjs $deplibs $compiler_flags ${wl}-soname $wl$soname -o $lib' archive_expsym_cmds_CXX='$CC -shared $libobjs $deplibs $compiler_flags ${wl}-soname $wl$soname ${wl}-retain-symbols-file $wl$export_symbols -o $lib' ;; esac archive_cmds_need_lc_CXX=no hardcode_libdir_flag_spec_CXX='${wl}-rpath,$libdir' export_dynamic_flag_spec_CXX='${wl}--export-dynamic' whole_archive_flag_spec_CXX='${wl}--whole-archive$convenience ${wl}--no-whole-archive' ;; cxx) # Compaq C++ archive_cmds_CXX='$CC -shared $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags ${wl}-soname $wl$soname -o $lib' archive_expsym_cmds_CXX='$CC -shared $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags ${wl}-soname $wl$soname -o $lib ${wl}-retain-symbols-file $wl$export_symbols' runpath_var=LD_RUN_PATH hardcode_libdir_flag_spec_CXX='-rpath $libdir' hardcode_libdir_separator_CXX=: # Commands to make compiler produce verbose output that lists # what "hidden" libraries, object files and flags are used when # linking a shared library. # # There doesn't appear to be a way to prevent this compiler from # explicitly linking system object files so we need to strip them # from the output so that they don't get included in the library # dependencies. output_verbose_link_cmd='templist=`$CC -shared $CFLAGS -v conftest.$objext 2>&1 | grep "ld"`; templist=`echo $templist | $SED "s/\(^.*ld.*\)\( .*ld .*$\)/\1/"`; list=""; for z in $templist; do case $z in conftest.$objext) list="$list $z";; *.$objext);; *) list="$list $z";;esac; done; echo $list' ;; esac ;; lynxos*) # FIXME: insert proper C++ library support ld_shlibs_CXX=no ;; m88k*) # FIXME: insert proper C++ library support ld_shlibs_CXX=no ;; mvs*) case $cc_basename in cxx) # FIXME: insert proper C++ library support ld_shlibs_CXX=no ;; *) # FIXME: insert proper C++ library support ld_shlibs_CXX=no ;; esac ;; netbsd*) if echo __ELF__ | $CC -E - | grep __ELF__ >/dev/null; then archive_cmds_CXX='$LD -Bshareable -o $lib $predep_objects $libobjs $deplibs $postdep_objects $linker_flags' wlarc= hardcode_libdir_flag_spec_CXX='-R$libdir' hardcode_direct_CXX=yes hardcode_shlibpath_var_CXX=no fi # Workaround some broken pre-1.5 toolchains output_verbose_link_cmd='$CC -shared $CFLAGS -v conftest.$objext 2>&1 | grep conftest.$objext | $SED -e "s:-lgcc -lc -lgcc::"' ;; openbsd2*) # C++ shared libraries are fairly broken ld_shlibs_CXX=no ;; openbsd*) hardcode_direct_CXX=yes hardcode_shlibpath_var_CXX=no archive_cmds_CXX='$CC -shared $pic_flag $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags -o $lib' hardcode_libdir_flag_spec_CXX='${wl}-rpath,$libdir' if test -z "`echo __ELF__ | $CC -E - | grep __ELF__`" || test "$host_os-$host_cpu" = "openbsd2.8-powerpc"; then archive_expsym_cmds_CXX='$CC -shared $pic_flag $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags ${wl}-retain-symbols-file,$export_symbols -o $lib' export_dynamic_flag_spec_CXX='${wl}-E' whole_archive_flag_spec_CXX="$wlarc"'--whole-archive$convenience '"$wlarc"'--no-whole-archive' fi output_verbose_link_cmd='echo' ;; osf3*) case $cc_basename in KCC) # Kuck and Associates, Inc. (KAI) C++ Compiler # KCC will only create a shared library if the output file # ends with ".so" (or ".sl" for HP-UX), so rename the library # to its proper name (with version) after linking. archive_cmds_CXX='tempext=`echo $shared_ext | $SED -e '\''s/\([^()0-9A-Za-z{}]\)/\\\\\1/g'\''`; templib=`echo $lib | $SED -e "s/\${tempext}\..*/.so/"`; $CC $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags --soname $soname -o \$templib; mv \$templib $lib' hardcode_libdir_flag_spec_CXX='${wl}-rpath,$libdir' hardcode_libdir_separator_CXX=: # Archives containing C++ object files must be created using # "CC -Bstatic", where "CC" is the KAI C++ compiler. old_archive_cmds_CXX='$CC -Bstatic -o $oldlib $oldobjs' ;; RCC) # Rational C++ 2.4.1 # FIXME: insert proper C++ library support ld_shlibs_CXX=no ;; cxx) allow_undefined_flag_CXX=' ${wl}-expect_unresolved ${wl}\*' archive_cmds_CXX='$CC -shared${allow_undefined_flag} $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags ${wl}-soname $soname `test -n "$verstring" && echo ${wl}-set_version $verstring` -update_registry ${objdir}/so_locations -o $lib' hardcode_libdir_flag_spec_CXX='${wl}-rpath ${wl}$libdir' hardcode_libdir_separator_CXX=: # Commands to make compiler produce verbose output that lists # what "hidden" libraries, object files and flags are used when # linking a shared library. # # There doesn't appear to be a way to prevent this compiler from # explicitly linking system object files so we need to strip them # from the output so that they don't get included in the library # dependencies. output_verbose_link_cmd='templist=`$CC -shared $CFLAGS -v conftest.$objext 2>&1 | grep "ld" | grep -v "ld:"`; templist=`echo $templist | $SED "s/\(^.*ld.*\)\( .*ld.*$\)/\1/"`; list=""; for z in $templist; do case $z in conftest.$objext) list="$list $z";; *.$objext);; *) list="$list $z";;esac; done; echo $list' ;; *) if test "$GXX" = yes && test "$with_gnu_ld" = no; then allow_undefined_flag_CXX=' ${wl}-expect_unresolved ${wl}\*' archive_cmds_CXX='$CC -shared -nostdlib ${allow_undefined_flag} $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags ${wl}-soname ${wl}$soname `test -n "$verstring" && echo ${wl}-set_version ${wl}$verstring` ${wl}-update_registry ${wl}${objdir}/so_locations -o $lib' hardcode_libdir_flag_spec_CXX='${wl}-rpath ${wl}$libdir' hardcode_libdir_separator_CXX=: # Commands to make compiler produce verbose output that lists # what "hidden" libraries, object files and flags are used when # linking a shared library. output_verbose_link_cmd='$CC -shared $CFLAGS -v conftest.$objext 2>&1 | grep "\-L"' else # FIXME: insert proper C++ library support ld_shlibs_CXX=no fi ;; esac ;; osf4* | osf5*) case $cc_basename in KCC) # Kuck and Associates, Inc. (KAI) C++ Compiler # KCC will only create a shared library if the output file # ends with ".so" (or ".sl" for HP-UX), so rename the library # to its proper name (with version) after linking. archive_cmds_CXX='tempext=`echo $shared_ext | $SED -e '\''s/\([^()0-9A-Za-z{}]\)/\\\\\1/g'\''`; templib=`echo $lib | $SED -e "s/\${tempext}\..*/.so/"`; $CC $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags --soname $soname -o \$templib; mv \$templib $lib' hardcode_libdir_flag_spec_CXX='${wl}-rpath,$libdir' hardcode_libdir_separator_CXX=: # Archives containing C++ object files must be created using # the KAI C++ compiler. old_archive_cmds_CXX='$CC -o $oldlib $oldobjs' ;; RCC) # Rational C++ 2.4.1 # FIXME: insert proper C++ library support ld_shlibs_CXX=no ;; cxx) allow_undefined_flag_CXX=' -expect_unresolved \*' archive_cmds_CXX='$CC -shared${allow_undefined_flag} $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags -msym -soname $soname `test -n "$verstring" && echo -set_version $verstring` -update_registry ${objdir}/so_locations -o $lib' archive_expsym_cmds_CXX='for i in `cat $export_symbols`; do printf "%s %s\\n" -exported_symbol "\$i" >> $lib.exp; done~ echo "-hidden">> $lib.exp~ $CC -shared$allow_undefined_flag $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags -msym -soname $soname -Wl,-input -Wl,$lib.exp `test -n "$verstring" && echo -set_version $verstring` -update_registry $objdir/so_locations -o $lib~ $rm $lib.exp' hardcode_libdir_flag_spec_CXX='-rpath $libdir' hardcode_libdir_separator_CXX=: # Commands to make compiler produce verbose output that lists # what "hidden" libraries, object files and flags are used when # linking a shared library. # # There doesn't appear to be a way to prevent this compiler from # explicitly linking system object files so we need to strip them # from the output so that they don't get included in the library # dependencies. output_verbose_link_cmd='templist=`$CC -shared $CFLAGS -v conftest.$objext 2>&1 | grep "ld" | grep -v "ld:"`; templist=`echo $templist | $SED "s/\(^.*ld.*\)\( .*ld.*$\)/\1/"`; list=""; for z in $templist; do case $z in conftest.$objext) list="$list $z";; *.$objext);; *) list="$list $z";;esac; done; echo $list' ;; *) if test "$GXX" = yes && test "$with_gnu_ld" = no; then allow_undefined_flag_CXX=' ${wl}-expect_unresolved ${wl}\*' archive_cmds_CXX='$CC -shared -nostdlib ${allow_undefined_flag} $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags ${wl}-msym ${wl}-soname ${wl}$soname `test -n "$verstring" && echo ${wl}-set_version ${wl}$verstring` ${wl}-update_registry ${wl}${objdir}/so_locations -o $lib' hardcode_libdir_flag_spec_CXX='${wl}-rpath ${wl}$libdir' hardcode_libdir_separator_CXX=: # Commands to make compiler produce verbose output that lists # what "hidden" libraries, object files and flags are used when # linking a shared library. output_verbose_link_cmd='$CC -shared $CFLAGS -v conftest.$objext 2>&1 | grep "\-L"' else # FIXME: insert proper C++ library support ld_shlibs_CXX=no fi ;; esac ;; psos*) # FIXME: insert proper C++ library support ld_shlibs_CXX=no ;; sco*) archive_cmds_need_lc_CXX=no case $cc_basename in CC) # FIXME: insert proper C++ library support ld_shlibs_CXX=no ;; *) # FIXME: insert proper C++ library support ld_shlibs_CXX=no ;; esac ;; sunos4*) case $cc_basename in CC) # Sun C++ 4.x # FIXME: insert proper C++ library support ld_shlibs_CXX=no ;; lcc) # Lucid # FIXME: insert proper C++ library support ld_shlibs_CXX=no ;; *) # FIXME: insert proper C++ library support ld_shlibs_CXX=no ;; esac ;; solaris*) case $cc_basename in CC) # Sun C++ 4.2, 5.x and Centerline C++ no_undefined_flag_CXX=' -zdefs' archive_cmds_CXX='$CC -G${allow_undefined_flag} -nolib -h$soname -o $lib $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags' archive_expsym_cmds_CXX='$echo "{ global:" > $lib.exp~cat $export_symbols | $SED -e "s/\(.*\)/\1;/" >> $lib.exp~$echo "local: *; };" >> $lib.exp~ $CC -G${allow_undefined_flag} -nolib ${wl}-M ${wl}$lib.exp -h$soname -o $lib $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags~$rm $lib.exp' hardcode_libdir_flag_spec_CXX='-R$libdir' hardcode_shlibpath_var_CXX=no case $host_os in solaris2.0-5 | solaris2.0-5.*) ;; *) # The C++ compiler is used as linker so we must use $wl # flag to pass the commands to the underlying system # linker. # Supported since Solaris 2.6 (maybe 2.5.1?) whole_archive_flag_spec_CXX='${wl}-z ${wl}allextract$convenience ${wl}-z ${wl}defaultextract' ;; esac link_all_deplibs_CXX=yes # Commands to make compiler produce verbose output that lists # what "hidden" libraries, object files and flags are used when # linking a shared library. # # There doesn't appear to be a way to prevent this compiler from # explicitly linking system object files so we need to strip them # from the output so that they don't get included in the library # dependencies. output_verbose_link_cmd='templist=`$CC -G $CFLAGS -v conftest.$objext 2>&1 | grep "\-[LR]"`; list=""; for z in $templist; do case $z in conftest.$objext) list="$list $z";; *.$objext);; *) list="$list $z";;esac; done; echo $list' # Archives containing C++ object files must be created using # "CC -xar", where "CC" is the Sun C++ compiler. This is # necessary to make sure instantiated templates are included # in the archive. old_archive_cmds_CXX='$CC -xar -o $oldlib $oldobjs' ;; gcx) # Green Hills C++ Compiler archive_cmds_CXX='$CC -shared $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags ${wl}-h $wl$soname -o $lib' # The C++ compiler must be used to create the archive. old_archive_cmds_CXX='$CC $LDFLAGS -archive -o $oldlib $oldobjs' ;; *) # GNU C++ compiler with Solaris linker if test "$GXX" = yes && test "$with_gnu_ld" = no; then no_undefined_flag_CXX=' ${wl}-z ${wl}defs' if $CC --version | grep -v '^2\.7' > /dev/null; then archive_cmds_CXX='$CC -shared -nostdlib $LDFLAGS $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags ${wl}-h $wl$soname -o $lib' archive_expsym_cmds_CXX='$echo "{ global:" > $lib.exp~cat $export_symbols | $SED -e "s/\(.*\)/\1;/" >> $lib.exp~$echo "local: *; };" >> $lib.exp~ $CC -shared -nostdlib ${wl}-M $wl$lib.exp -o $lib $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags~$rm $lib.exp' # Commands to make compiler produce verbose output that lists # what "hidden" libraries, object files and flags are used when # linking a shared library. output_verbose_link_cmd="$CC -shared $CFLAGS -v conftest.$objext 2>&1 | grep \"\-L\"" else # g++ 2.7 appears to require `-G' NOT `-shared' on this # platform. archive_cmds_CXX='$CC -G -nostdlib $LDFLAGS $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags ${wl}-h $wl$soname -o $lib' archive_expsym_cmds_CXX='$echo "{ global:" > $lib.exp~cat $export_symbols | $SED -e "s/\(.*\)/\1;/" >> $lib.exp~$echo "local: *; };" >> $lib.exp~ $CC -G -nostdlib ${wl}-M $wl$lib.exp -o $lib $predep_objects $libobjs $deplibs $postdep_objects $compiler_flags~$rm $lib.exp' # Commands to make compiler produce verbose output that lists # what "hidden" libraries, object files and flags are used when # linking a shared library. output_verbose_link_cmd="$CC -G $CFLAGS -v conftest.$objext 2>&1 | grep \"\-L\"" fi hardcode_libdir_flag_spec_CXX='${wl}-R $wl$libdir' fi ;; esac ;; sysv5OpenUNIX8* | sysv5UnixWare7* | sysv5uw[78]* | unixware7*) archive_cmds_need_lc_CXX=no ;; tandem*) case $cc_basename in NCC) # NonStop-UX NCC 3.20 # FIXME: insert proper C++ library support ld_shlibs_CXX=no ;; *) # FIXME: insert proper C++ library support ld_shlibs_CXX=no ;; esac ;; vxworks*) # FIXME: insert proper C++ library support ld_shlibs_CXX=no ;; *) # FIXME: insert proper C++ library support ld_shlibs_CXX=no ;; esac echo "$as_me:$LINENO: result: $ld_shlibs_CXX" >&5 echo "${ECHO_T}$ld_shlibs_CXX" >&6 test "$ld_shlibs_CXX" = no && can_build_shared=no GCC_CXX="$GXX" LD_CXX="$LD" cat > conftest.$ac_ext <&5 (eval $ac_compile) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; then # Parse the compiler output and extract the necessary # objects, libraries and library flags. # Sentinel used to keep track of whether or not we are before # the conftest object file. pre_test_object_deps_done=no # The `*' in the case matches for architectures that use `case' in # $output_verbose_cmd can trigger glob expansion during the loop # eval without this substitution. output_verbose_link_cmd="`$echo \"X$output_verbose_link_cmd\" | $Xsed -e \"$no_glob_subst\"`" for p in `eval $output_verbose_link_cmd`; do case $p in -L* | -R* | -l*) # Some compilers place space between "-{L,R}" and the path. # Remove the space. if test $p = "-L" \ || test $p = "-R"; then prev=$p continue else prev= fi if test "$pre_test_object_deps_done" = no; then case $p in -L* | -R*) # Internal compiler library paths should come after those # provided the user. The postdeps already come after the # user supplied libs so there is no need to process them. if test -z "$compiler_lib_search_path_CXX"; then compiler_lib_search_path_CXX="${prev}${p}" else compiler_lib_search_path_CXX="${compiler_lib_search_path_CXX} ${prev}${p}" fi ;; # The "-l" case would never come before the object being # linked, so don't bother handling this case. esac else if test -z "$postdeps_CXX"; then postdeps_CXX="${prev}${p}" else postdeps_CXX="${postdeps_CXX} ${prev}${p}" fi fi ;; *.$objext) # This assumes that the test object file only shows up # once in the compiler output. if test "$p" = "conftest.$objext"; then pre_test_object_deps_done=yes continue fi if test "$pre_test_object_deps_done" = no; then if test -z "$predep_objects_CXX"; then predep_objects_CXX="$p" else predep_objects_CXX="$predep_objects_CXX $p" fi else if test -z "$postdep_objects_CXX"; then postdep_objects_CXX="$p" else postdep_objects_CXX="$postdep_objects_CXX $p" fi fi ;; *) ;; # Ignore the rest. esac done # Clean up. rm -f a.out a.exe else echo "libtool.m4: error: problem compiling CXX test program" fi $rm -f confest.$objext case " $postdeps_CXX " in *" -lc "*) archive_cmds_need_lc_CXX=no ;; esac lt_prog_compiler_wl_CXX= lt_prog_compiler_pic_CXX= lt_prog_compiler_static_CXX= echo "$as_me:$LINENO: checking for $compiler option to produce PIC" >&5 echo $ECHO_N "checking for $compiler option to produce PIC... $ECHO_C" >&6 # C++ specific cases for pic, static, wl, etc. if test "$GXX" = yes; then lt_prog_compiler_wl_CXX='-Wl,' lt_prog_compiler_static_CXX='-static' case $host_os in aix*) # All AIX code is PIC. if test "$host_cpu" = ia64; then # AIX 5 now supports IA64 processor lt_prog_compiler_static_CXX='-Bstatic' fi ;; amigaos*) # FIXME: we need at least 68020 code to build shared libraries, but # adding the `-m68020' flag to GCC prevents building anything better, # like `-m68040'. lt_prog_compiler_pic_CXX='-m68020 -resident32 -malways-restore-a4' ;; beos* | cygwin* | irix5* | irix6* | nonstopux* | osf3* | osf4* | osf5*) # PIC is the default for these OSes. ;; mingw* | os2* | pw32*) # This hack is so that the source file can tell whether it is being # built for inclusion in a dll (and should export symbols for example). lt_prog_compiler_pic_CXX='-DDLL_EXPORT' ;; darwin* | rhapsody*) # PIC is the default on this platform # Common symbols not allowed in MH_DYLIB files lt_prog_compiler_pic_CXX='-fno-common' ;; *djgpp*) # DJGPP does not support shared libraries at all lt_prog_compiler_pic_CXX= ;; sysv4*MP*) if test -d /usr/nec; then lt_prog_compiler_pic_CXX=-Kconform_pic fi ;; hpux*) # PIC is the default for IA64 HP-UX and 64-bit HP-UX, but # not for PA HP-UX. case "$host_cpu" in hppa*64*|ia64*) ;; *) lt_prog_compiler_pic_CXX='-fPIC' ;; esac ;; *) lt_prog_compiler_pic_CXX='-fPIC' ;; esac else case $host_os in aix4* | aix5*) # All AIX code is PIC. if test "$host_cpu" = ia64; then # AIX 5 now supports IA64 processor lt_prog_compiler_static_CXX='-Bstatic' else lt_prog_compiler_static_CXX='-bnso -bI:/lib/syscalls.exp' fi ;; chorus*) case $cc_basename in cxch68) # Green Hills C++ Compiler # _LT_AC_TAGVAR(lt_prog_compiler_static, CXX)="--no_auto_instantiation -u __main -u __premain -u _abort -r $COOL_DIR/lib/libOrb.a $MVME_DIR/lib/CC/libC.a $MVME_DIR/lib/classix/libcx.s.a" ;; esac ;; darwin*) # PIC is the default on this platform # Common symbols not allowed in MH_DYLIB files case "$cc_basename" in xlc*) lt_prog_compiler_pic_CXX='-qnocommon' lt_prog_compiler_wl_CXX='-Wl,' ;; esac ;; dgux*) case $cc_basename in ec++) lt_prog_compiler_pic_CXX='-KPIC' ;; ghcx) # Green Hills C++ Compiler lt_prog_compiler_pic_CXX='-pic' ;; *) ;; esac ;; freebsd* | kfreebsd*-gnu) # FreeBSD uses GNU C++ ;; hpux9* | hpux10* | hpux11*) case $cc_basename in CC) lt_prog_compiler_wl_CXX='-Wl,' lt_prog_compiler_static_CXX="${ac_cv_prog_cc_wl}-a ${ac_cv_prog_cc_wl}archive" if test "$host_cpu" != ia64; then lt_prog_compiler_pic_CXX='+Z' fi ;; aCC) lt_prog_compiler_wl_CXX='-Wl,' lt_prog_compiler_static_CXX="${ac_cv_prog_cc_wl}-a ${ac_cv_prog_cc_wl}archive" case "$host_cpu" in hppa*64*|ia64*) # +Z the default ;; *) lt_prog_compiler_pic_CXX='+Z' ;; esac ;; *) ;; esac ;; irix5* | irix6* | nonstopux*) case $cc_basename in CC) lt_prog_compiler_wl_CXX='-Wl,' lt_prog_compiler_static_CXX='-non_shared' # CC pic flag -KPIC is the default. ;; *) ;; esac ;; linux*) case $cc_basename in KCC) # KAI C++ Compiler lt_prog_compiler_wl_CXX='--backend -Wl,' lt_prog_compiler_pic_CXX='-fPIC' ;; icpc) # Intel C++ lt_prog_compiler_wl_CXX='-Wl,' lt_prog_compiler_pic_CXX='-KPIC' lt_prog_compiler_static_CXX='-static' ;; cxx) # Compaq C++ # Make sure the PIC flag is empty. It appears that all Alpha # Linux and Compaq Tru64 Unix objects are PIC. lt_prog_compiler_pic_CXX= lt_prog_compiler_static_CXX='-non_shared' ;; *) ;; esac ;; lynxos*) ;; m88k*) ;; mvs*) case $cc_basename in cxx) lt_prog_compiler_pic_CXX='-W c,exportall' ;; *) ;; esac ;; netbsd*) ;; osf3* | osf4* | osf5*) case $cc_basename in KCC) lt_prog_compiler_wl_CXX='--backend -Wl,' ;; RCC) # Rational C++ 2.4.1 lt_prog_compiler_pic_CXX='-pic' ;; cxx) # Digital/Compaq C++ lt_prog_compiler_wl_CXX='-Wl,' # Make sure the PIC flag is empty. It appears that all Alpha # Linux and Compaq Tru64 Unix objects are PIC. lt_prog_compiler_pic_CXX= lt_prog_compiler_static_CXX='-non_shared' ;; *) ;; esac ;; psos*) ;; sco*) case $cc_basename in CC) lt_prog_compiler_pic_CXX='-fPIC' ;; *) ;; esac ;; solaris*) case $cc_basename in CC) # Sun C++ 4.2, 5.x and Centerline C++ lt_prog_compiler_pic_CXX='-KPIC' lt_prog_compiler_static_CXX='-Bstatic' lt_prog_compiler_wl_CXX='-Qoption ld ' ;; gcx) # Green Hills C++ Compiler lt_prog_compiler_pic_CXX='-PIC' ;; *) ;; esac ;; sunos4*) case $cc_basename in CC) # Sun C++ 4.x lt_prog_compiler_pic_CXX='-pic' lt_prog_compiler_static_CXX='-Bstatic' ;; lcc) # Lucid lt_prog_compiler_pic_CXX='-pic' ;; *) ;; esac ;; tandem*) case $cc_basename in NCC) # NonStop-UX NCC 3.20 lt_prog_compiler_pic_CXX='-KPIC' ;; *) ;; esac ;; unixware*) ;; vxworks*) ;; *) lt_prog_compiler_can_build_shared_CXX=no ;; esac fi echo "$as_me:$LINENO: result: $lt_prog_compiler_pic_CXX" >&5 echo "${ECHO_T}$lt_prog_compiler_pic_CXX" >&6 # # Check to make sure the PIC flag actually works. # if test -n "$lt_prog_compiler_pic_CXX"; then echo "$as_me:$LINENO: checking if $compiler PIC flag $lt_prog_compiler_pic_CXX works" >&5 echo $ECHO_N "checking if $compiler PIC flag $lt_prog_compiler_pic_CXX works... $ECHO_C" >&6 if test "${lt_prog_compiler_pic_works_CXX+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else lt_prog_compiler_pic_works_CXX=no ac_outfile=conftest.$ac_objext printf "$lt_simple_compile_test_code" > conftest.$ac_ext lt_compiler_flag="$lt_prog_compiler_pic_CXX -DPIC" # Insert the option either (1) after the last *FLAGS variable, or # (2) before a word containing "conftest.", or (3) at the end. # Note that $ac_compile itself does not contain backslashes and begins # with a dollar sign (not a hyphen), so the echo should work correctly. # The option is referenced via a variable to avoid confusing sed. lt_compile=`echo "$ac_compile" | $SED \ -e 's:.*FLAGS}? :&$lt_compiler_flag :; t' \ -e 's: [^ ]*conftest\.: $lt_compiler_flag&:; t' \ -e 's:$: $lt_compiler_flag:'` (eval echo "\"\$as_me:11194: $lt_compile\"" >&5) (eval "$lt_compile" 2>conftest.err) ac_status=$? cat conftest.err >&5 echo "$as_me:11198: \$? = $ac_status" >&5 if (exit $ac_status) && test -s "$ac_outfile"; then # The compiler can only warn and ignore the option if not recognized # So say no if there are warnings if test ! -s conftest.err; then lt_prog_compiler_pic_works_CXX=yes fi fi $rm conftest* fi echo "$as_me:$LINENO: result: $lt_prog_compiler_pic_works_CXX" >&5 echo "${ECHO_T}$lt_prog_compiler_pic_works_CXX" >&6 if test x"$lt_prog_compiler_pic_works_CXX" = xyes; then case $lt_prog_compiler_pic_CXX in "" | " "*) ;; *) lt_prog_compiler_pic_CXX=" $lt_prog_compiler_pic_CXX" ;; esac else lt_prog_compiler_pic_CXX= lt_prog_compiler_can_build_shared_CXX=no fi fi case "$host_os" in # For platforms which do not support PIC, -DPIC is meaningless: *djgpp*) lt_prog_compiler_pic_CXX= ;; *) lt_prog_compiler_pic_CXX="$lt_prog_compiler_pic_CXX -DPIC" ;; esac echo "$as_me:$LINENO: checking if $compiler supports -c -o file.$ac_objext" >&5 echo $ECHO_N "checking if $compiler supports -c -o file.$ac_objext... $ECHO_C" >&6 if test "${lt_cv_prog_compiler_c_o_CXX+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else lt_cv_prog_compiler_c_o_CXX=no $rm -r conftest 2>/dev/null mkdir conftest cd conftest mkdir out printf "$lt_simple_compile_test_code" > conftest.$ac_ext lt_compiler_flag="-o out/conftest2.$ac_objext" # Insert the option either (1) after the last *FLAGS variable, or # (2) before a word containing "conftest.", or (3) at the end. # Note that $ac_compile itself does not contain backslashes and begins # with a dollar sign (not a hyphen), so the echo should work correctly. lt_compile=`echo "$ac_compile" | $SED \ -e 's:.*FLAGS}? :&$lt_compiler_flag :; t' \ -e 's: [^ ]*conftest\.: $lt_compiler_flag&:; t' \ -e 's:$: $lt_compiler_flag:'` (eval echo "\"\$as_me:11254: $lt_compile\"" >&5) (eval "$lt_compile" 2>out/conftest.err) ac_status=$? cat out/conftest.err >&5 echo "$as_me:11258: \$? = $ac_status" >&5 if (exit $ac_status) && test -s out/conftest2.$ac_objext then # The compiler can only warn and ignore the option if not recognized # So say no if there are warnings if test ! -s out/conftest.err; then lt_cv_prog_compiler_c_o_CXX=yes fi fi chmod u+w . $rm conftest* # SGI C++ compiler will create directory out/ii_files/ for # template instantiation test -d out/ii_files && $rm out/ii_files/* && rmdir out/ii_files $rm out/* && rmdir out cd .. rmdir conftest $rm conftest* fi echo "$as_me:$LINENO: result: $lt_cv_prog_compiler_c_o_CXX" >&5 echo "${ECHO_T}$lt_cv_prog_compiler_c_o_CXX" >&6 hard_links="nottested" if test "$lt_cv_prog_compiler_c_o_CXX" = no && test "$need_locks" != no; then # do not overwrite the value of need_locks provided by the user echo "$as_me:$LINENO: checking if we can lock with hard links" >&5 echo $ECHO_N "checking if we can lock with hard links... $ECHO_C" >&6 hard_links=yes $rm conftest* ln conftest.a conftest.b 2>/dev/null && hard_links=no touch conftest.a ln conftest.a conftest.b 2>&5 || hard_links=no ln conftest.a conftest.b 2>/dev/null && hard_links=no echo "$as_me:$LINENO: result: $hard_links" >&5 echo "${ECHO_T}$hard_links" >&6 if test "$hard_links" = no; then { echo "$as_me:$LINENO: WARNING: \`$CC' does not support \`-c -o', so \`make -j' may be unsafe" >&5 echo "$as_me: WARNING: \`$CC' does not support \`-c -o', so \`make -j' may be unsafe" >&2;} need_locks=warn fi else need_locks=no fi echo "$as_me:$LINENO: checking whether the $compiler linker ($LD) supports shared libraries" >&5 echo $ECHO_N "checking whether the $compiler linker ($LD) supports shared libraries... $ECHO_C" >&6 export_symbols_cmds_CXX='$NM $libobjs $convenience | $global_symbol_pipe | $SED '\''s/.* //'\'' | sort | uniq > $export_symbols' case $host_os in aix4* | aix5*) # If we're using GNU nm, then we don't want the "-C" option. # -C means demangle to AIX nm, but means don't demangle with GNU nm if $NM -V 2>&1 | grep 'GNU' > /dev/null; then export_symbols_cmds_CXX='$NM -Bpg $libobjs $convenience | awk '\''{ if (((\$2 == "T") || (\$2 == "D") || (\$2 == "B")) && (substr(\$3,1,1) != ".")) { print \$3 } }'\'' | sort -u > $export_symbols' else export_symbols_cmds_CXX='$NM -BCpg $libobjs $convenience | awk '\''{ if (((\$2 == "T") || (\$2 == "D") || (\$2 == "B")) && (substr(\$3,1,1) != ".")) { print \$3 } }'\'' | sort -u > $export_symbols' fi ;; pw32*) export_symbols_cmds_CXX="$ltdll_cmds" ;; cygwin* | mingw*) export_symbols_cmds_CXX='$NM $libobjs $convenience | $global_symbol_pipe | $SED -e '\''/^[BCDGS] /s/.* \([^ ]*\)/\1 DATA/'\'' | $SED -e '\''/^[AITW] /s/.* //'\'' | sort | uniq > $export_symbols' ;; *) export_symbols_cmds_CXX='$NM $libobjs $convenience | $global_symbol_pipe | $SED '\''s/.* //'\'' | sort | uniq > $export_symbols' ;; esac echo "$as_me:$LINENO: result: $ld_shlibs_CXX" >&5 echo "${ECHO_T}$ld_shlibs_CXX" >&6 test "$ld_shlibs_CXX" = no && can_build_shared=no variables_saved_for_relink="PATH $shlibpath_var $runpath_var" if test "$GCC" = yes; then variables_saved_for_relink="$variables_saved_for_relink GCC_EXEC_PREFIX COMPILER_PATH LIBRARY_PATH" fi # # Do we need to explicitly link libc? # case "x$archive_cmds_need_lc_CXX" in x|xyes) # Assume -lc should be added archive_cmds_need_lc_CXX=yes if test "$enable_shared" = yes && test "$GCC" = yes; then case $archive_cmds_CXX in *'~'*) # FIXME: we may have to deal with multi-command sequences. ;; '$CC '*) # Test whether the compiler implicitly links with -lc since on some # systems, -lgcc has to come before -lc. If gcc already passes -lc # to ld, don't add -lc before -lgcc. echo "$as_me:$LINENO: checking whether -lc should be explicitly linked in" >&5 echo $ECHO_N "checking whether -lc should be explicitly linked in... $ECHO_C" >&6 $rm conftest* printf "$lt_simple_compile_test_code" > conftest.$ac_ext if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5 (eval $ac_compile) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } 2>conftest.err; then soname=conftest lib=conftest libobjs=conftest.$ac_objext deplibs= wl=$lt_prog_compiler_wl_CXX compiler_flags=-v linker_flags=-v verstring= output_objdir=. libname=conftest lt_save_allow_undefined_flag=$allow_undefined_flag_CXX allow_undefined_flag_CXX= if { (eval echo "$as_me:$LINENO: \"$archive_cmds_CXX 2\>\&1 \| grep \" -lc \" \>/dev/null 2\>\&1\"") >&5 (eval $archive_cmds_CXX 2\>\&1 \| grep \" -lc \" \>/dev/null 2\>\&1) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } then archive_cmds_need_lc_CXX=no else archive_cmds_need_lc_CXX=yes fi allow_undefined_flag_CXX=$lt_save_allow_undefined_flag else cat conftest.err 1>&5 fi $rm conftest* echo "$as_me:$LINENO: result: $archive_cmds_need_lc_CXX" >&5 echo "${ECHO_T}$archive_cmds_need_lc_CXX" >&6 ;; esac fi ;; esac echo "$as_me:$LINENO: checking dynamic linker characteristics" >&5 echo $ECHO_N "checking dynamic linker characteristics... $ECHO_C" >&6 library_names_spec= libname_spec='lib$name' soname_spec= shrext_cmds=".so" postinstall_cmds= postuninstall_cmds= finish_cmds= finish_eval= shlibpath_var= shlibpath_overrides_runpath=unknown version_type=none dynamic_linker="$host_os ld.so" sys_lib_dlsearch_path_spec="/lib /usr/lib" if test "$GCC" = yes; then sys_lib_search_path_spec=`$CC -print-search-dirs | grep "^libraries:" | $SED -e "s/^libraries://" -e "s,=/,/,g"` if echo "$sys_lib_search_path_spec" | grep ';' >/dev/null ; then # if the path contains ";" then we assume it to be the separator # otherwise default to the standard path separator (i.e. ":") - it is # assumed that no part of a normal pathname contains ";" but that should # okay in the real world where ";" in dirpaths is itself problematic. sys_lib_search_path_spec=`echo "$sys_lib_search_path_spec" | $SED -e 's/;/ /g'` else sys_lib_search_path_spec=`echo "$sys_lib_search_path_spec" | $SED -e "s/$PATH_SEPARATOR/ /g"` fi else sys_lib_search_path_spec="/lib /usr/lib /usr/local/lib" fi need_lib_prefix=unknown hardcode_into_libs=no # when you set need_version to no, make sure it does not cause -set_version # flags to be left without arguments need_version=unknown case $host_os in aix3*) version_type=linux library_names_spec='${libname}${release}${shared_ext}$versuffix $libname.a' shlibpath_var=LIBPATH # AIX 3 has no versioning support, so we append a major version to the name. soname_spec='${libname}${release}${shared_ext}$major' ;; aix4* | aix5*) version_type=linux need_lib_prefix=no need_version=no hardcode_into_libs=yes if test "$host_cpu" = ia64; then # AIX 5 supports IA64 library_names_spec='${libname}${release}${shared_ext}$major ${libname}${release}${shared_ext}$versuffix $libname${shared_ext}' shlibpath_var=LD_LIBRARY_PATH else # With GCC up to 2.95.x, collect2 would create an import file # for dependence libraries. The import file would start with # the line `#! .'. This would cause the generated library to # depend on `.', always an invalid library. This was fixed in # development snapshots of GCC prior to 3.0. case $host_os in aix4 | aix4.[01] | aix4.[01].*) if { echo '#if __GNUC__ > 2 || (__GNUC__ == 2 && __GNUC_MINOR__ >= 97)' echo ' yes ' echo '#endif'; } | ${CC} -E - | grep yes > /dev/null; then : else can_build_shared=no fi ;; esac # AIX (on Power*) has no versioning support, so currently we can not hardcode correct # soname into executable. Probably we can add versioning support to # collect2, so additional links can be useful in future. if test "$aix_use_runtimelinking" = yes; then # If using run time linking (on AIX 4.2 or later) use lib.so # instead of lib.a to let people know that these are not # typical AIX shared libraries. library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' else # We preserve .a as extension for shared libraries through AIX4.2 # and later when we are not doing run time linking. library_names_spec='${libname}${release}.a $libname.a' soname_spec='${libname}${release}${shared_ext}$major' fi shlibpath_var=LIBPATH fi ;; amigaos*) library_names_spec='$libname.ixlibrary $libname.a' # Create ${libname}_ixlibrary.a entries in /sys/libs. finish_eval='for lib in `ls $libdir/*.ixlibrary 2>/dev/null`; do libname=`$echo "X$lib" | $Xsed -e '\''s%^.*/\([^/]*\)\.ixlibrary$%\1%'\''`; test $rm /sys/libs/${libname}_ixlibrary.a; $show "cd /sys/libs && $LN_S $lib ${libname}_ixlibrary.a"; cd /sys/libs && $LN_S $lib ${libname}_ixlibrary.a || exit 1; done' ;; beos*) library_names_spec='${libname}${shared_ext}' dynamic_linker="$host_os ld.so" shlibpath_var=LIBRARY_PATH ;; bsdi[45]*) version_type=linux need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' finish_cmds='PATH="\$PATH:/sbin" ldconfig $libdir' shlibpath_var=LD_LIBRARY_PATH sys_lib_search_path_spec="/shlib /usr/lib /usr/X11/lib /usr/contrib/lib /lib /usr/local/lib" sys_lib_dlsearch_path_spec="/shlib /usr/lib /usr/local/lib" # the default ld.so.conf also contains /usr/contrib/lib and # /usr/X11R6/lib (/usr/X11 is a link to /usr/X11R6), but let us allow # libtool to hard-code these into programs ;; cygwin* | mingw* | pw32*) version_type=windows shrext_cmds=".dll" need_version=no need_lib_prefix=no case $GCC,$host_os in yes,cygwin* | yes,mingw* | yes,pw32*) library_names_spec='$libname.dll.a' # DLL is installed to $(libdir)/../bin by postinstall_cmds postinstall_cmds='base_file=`basename \${file}`~ dlpath=`$SHELL 2>&1 -c '\''. $dir/'\''\${base_file}'\''i;echo \$dlname'\''`~ dldir=$destdir/`dirname \$dlpath`~ test -d \$dldir || mkdir -p \$dldir~ $install_prog $dir/$dlname \$dldir/$dlname' postuninstall_cmds='dldll=`$SHELL 2>&1 -c '\''. $file; echo \$dlname'\''`~ dlpath=$dir/\$dldll~ $rm \$dlpath' shlibpath_overrides_runpath=yes case $host_os in cygwin*) # Cygwin DLLs use 'cyg' prefix rather than 'lib' soname_spec='`echo ${libname} | sed -e 's/^lib/cyg/'``echo ${release} | $SED -e 's/[.]/-/g'`${versuffix}${shared_ext}' sys_lib_search_path_spec="/usr/lib /lib/w32api /lib /usr/local/lib" ;; mingw*) # MinGW DLLs use traditional 'lib' prefix soname_spec='${libname}`echo ${release} | $SED -e 's/[.]/-/g'`${versuffix}${shared_ext}' sys_lib_search_path_spec=`$CC -print-search-dirs | grep "^libraries:" | $SED -e "s/^libraries://" -e "s,=/,/,g"` if echo "$sys_lib_search_path_spec" | grep ';[c-zC-Z]:/' >/dev/null; then # It is most probably a Windows format PATH printed by # mingw gcc, but we are running on Cygwin. Gcc prints its search # path with ; separators, and with drive letters. We can handle the # drive letters (cygwin fileutils understands them), so leave them, # especially as we might pass files found there to a mingw objdump, # which wouldn't understand a cygwinified path. Ahh. sys_lib_search_path_spec=`echo "$sys_lib_search_path_spec" | $SED -e 's/;/ /g'` else sys_lib_search_path_spec=`echo "$sys_lib_search_path_spec" | $SED -e "s/$PATH_SEPARATOR/ /g"` fi ;; pw32*) # pw32 DLLs use 'pw' prefix rather than 'lib' library_names_spec='`echo ${libname} | sed -e 's/^lib/pw/'``echo ${release} | $SED -e 's/./-/g'`${versuffix}${shared_ext}' ;; esac ;; *) library_names_spec='${libname}`echo ${release} | $SED -e 's/[.]/-/g'`${versuffix}${shared_ext} $libname.lib' ;; esac dynamic_linker='Win32 ld.exe' # FIXME: first we should search . and the directory the executable is in shlibpath_var=PATH ;; darwin* | rhapsody*) dynamic_linker="$host_os dyld" version_type=darwin need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${versuffix}$shared_ext ${libname}${release}${major}$shared_ext ${libname}$shared_ext' soname_spec='${libname}${release}${major}$shared_ext' shlibpath_overrides_runpath=yes shlibpath_var=DYLD_LIBRARY_PATH shrext_cmds='$(test .$module = .yes && echo .so || echo .dylib)' # Apple's gcc prints 'gcc -print-search-dirs' doesn't operate the same. if test "$GCC" = yes; then sys_lib_search_path_spec=`$CC -print-search-dirs | tr "\n" "$PATH_SEPARATOR" | sed -e 's/libraries:/@libraries:/' | tr "@" "\n" | grep "^libraries:" | sed -e "s/^libraries://" -e "s,=/,/,g" -e "s,$PATH_SEPARATOR, ,g" -e "s,.*,& /lib /usr/lib /usr/local/lib,g"` else sys_lib_search_path_spec='/lib /usr/lib /usr/local/lib' fi sys_lib_dlsearch_path_spec='/usr/local/lib /lib /usr/lib' ;; dgux*) version_type=linux need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname$shared_ext' soname_spec='${libname}${release}${shared_ext}$major' shlibpath_var=LD_LIBRARY_PATH ;; freebsd1*) dynamic_linker=no ;; kfreebsd*-gnu) version_type=linux need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major ${libname}${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=no hardcode_into_libs=yes dynamic_linker='GNU ld.so' ;; freebsd*) objformat=`test -x /usr/bin/objformat && /usr/bin/objformat || echo aout` version_type=freebsd-$objformat case $version_type in freebsd-elf*) library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext} $libname${shared_ext}' need_version=no need_lib_prefix=no ;; freebsd-*) library_names_spec='${libname}${release}${shared_ext}$versuffix $libname${shared_ext}$versuffix' need_version=yes ;; esac shlibpath_var=LD_LIBRARY_PATH case $host_os in freebsd2*) shlibpath_overrides_runpath=yes ;; freebsd3.01* | freebsdelf3.01*) shlibpath_overrides_runpath=yes hardcode_into_libs=yes ;; *) # from 3.2 on shlibpath_overrides_runpath=no hardcode_into_libs=yes ;; esac ;; gnu*) version_type=linux need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}${major} ${libname}${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' shlibpath_var=LD_LIBRARY_PATH hardcode_into_libs=yes ;; hpux9* | hpux10* | hpux11*) # Give a soname corresponding to the major version so that dld.sl refuses to # link against other versions. version_type=sunos need_lib_prefix=no need_version=no case "$host_cpu" in ia64*) shrext_cmds='.so' hardcode_into_libs=yes dynamic_linker="$host_os dld.so" shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=yes # Unless +noenvvar is specified. library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' if test "X$HPUX_IA64_MODE" = X32; then sys_lib_search_path_spec="/usr/lib/hpux32 /usr/local/lib/hpux32 /usr/local/lib" else sys_lib_search_path_spec="/usr/lib/hpux64 /usr/local/lib/hpux64" fi sys_lib_dlsearch_path_spec=$sys_lib_search_path_spec ;; hppa*64*) shrext_cmds='.sl' hardcode_into_libs=yes dynamic_linker="$host_os dld.sl" shlibpath_var=LD_LIBRARY_PATH # How should we handle SHLIB_PATH shlibpath_overrides_runpath=yes # Unless +noenvvar is specified. library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' sys_lib_search_path_spec="/usr/lib/pa20_64 /usr/ccs/lib/pa20_64" sys_lib_dlsearch_path_spec=$sys_lib_search_path_spec ;; *) shrext_cmds='.sl' dynamic_linker="$host_os dld.sl" shlibpath_var=SHLIB_PATH shlibpath_overrides_runpath=no # +s is required to enable SHLIB_PATH library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' ;; esac # HP-UX runs *really* slowly unless shared libraries are mode 555. postinstall_cmds='chmod 555 $lib' ;; irix5* | irix6* | nonstopux*) case $host_os in nonstopux*) version_type=nonstopux ;; *) if test "$lt_cv_prog_gnu_ld" = yes; then version_type=linux else version_type=irix fi ;; esac need_lib_prefix=no need_version=no soname_spec='${libname}${release}${shared_ext}$major' library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major ${libname}${release}${shared_ext} $libname${shared_ext}' case $host_os in irix5* | nonstopux*) libsuff= shlibsuff= ;; *) case $LD in # libtool.m4 will add one of these switches to LD *-32|*"-32 "|*-melf32bsmip|*"-melf32bsmip ") libsuff= shlibsuff= libmagic=32-bit;; *-n32|*"-n32 "|*-melf32bmipn32|*"-melf32bmipn32 ") libsuff=32 shlibsuff=N32 libmagic=N32;; *-64|*"-64 "|*-melf64bmip|*"-melf64bmip ") libsuff=64 shlibsuff=64 libmagic=64-bit;; *) libsuff= shlibsuff= libmagic=never-match;; esac ;; esac shlibpath_var=LD_LIBRARY${shlibsuff}_PATH shlibpath_overrides_runpath=no sys_lib_search_path_spec="/usr/lib${libsuff} /lib${libsuff} /usr/local/lib${libsuff}" sys_lib_dlsearch_path_spec="/usr/lib${libsuff} /lib${libsuff}" hardcode_into_libs=yes ;; # No shared lib support for Linux oldld, aout, or coff. linux*oldld* | linux*aout* | linux*coff*) dynamic_linker=no ;; # This must be Linux ELF. linux*) version_type=linux need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' finish_cmds='PATH="\$PATH:/sbin" ldconfig -n $libdir' shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=no # This implies no fast_install, which is unacceptable. # Some rework will be needed to allow for fast_install # before this can be enabled. hardcode_into_libs=yes # Append ld.so.conf contents to the search path if test -f /etc/ld.so.conf; then lt_ld_extra=`$SED -e 's/:,\t/ /g;s/=^=*$//;s/=^= * / /g' /etc/ld.so.conf | tr '\n' ' '` sys_lib_dlsearch_path_spec="/lib /usr/lib $lt_ld_extra" fi # We used to test for /lib/ld.so.1 and disable shared libraries on # powerpc, because MkLinux only supported shared libraries with the # GNU dynamic linker. Since this was broken with cross compilers, # most powerpc-linux boxes support dynamic linking these days and # people can always --disable-shared, the test was removed, and we # assume the GNU/Linux dynamic linker is in use. dynamic_linker='GNU/Linux ld.so' ;; knetbsd*-gnu) version_type=linux need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major ${libname}${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=no hardcode_into_libs=yes dynamic_linker='GNU ld.so' ;; netbsd*) version_type=sunos need_lib_prefix=no need_version=no if echo __ELF__ | $CC -E - | grep __ELF__ >/dev/null; then library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${shared_ext}$versuffix' finish_cmds='PATH="\$PATH:/sbin" ldconfig -m $libdir' dynamic_linker='NetBSD (a.out) ld.so' else library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major ${libname}${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' dynamic_linker='NetBSD ld.elf_so' fi shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=yes hardcode_into_libs=yes ;; newsos6) version_type=linux library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=yes ;; nto-qnx*) version_type=linux need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=yes ;; openbsd*) version_type=sunos need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${shared_ext}$versuffix' finish_cmds='PATH="\$PATH:/sbin" ldconfig -m $libdir' shlibpath_var=LD_LIBRARY_PATH if test -z "`echo __ELF__ | $CC -E - | grep __ELF__`" || test "$host_os-$host_cpu" = "openbsd2.8-powerpc"; then case $host_os in openbsd2.[89] | openbsd2.[89].*) shlibpath_overrides_runpath=no ;; *) shlibpath_overrides_runpath=yes ;; esac else shlibpath_overrides_runpath=yes fi ;; os2*) libname_spec='$name' shrext_cmds=".dll" need_lib_prefix=no library_names_spec='$libname${shared_ext} $libname.a' dynamic_linker='OS/2 ld.exe' shlibpath_var=LIBPATH ;; osf3* | osf4* | osf5*) version_type=osf need_lib_prefix=no need_version=no soname_spec='${libname}${release}${shared_ext}$major' library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' shlibpath_var=LD_LIBRARY_PATH sys_lib_search_path_spec="/usr/shlib /usr/ccs/lib /usr/lib/cmplrs/cc /usr/lib /usr/local/lib /var/shlib" sys_lib_dlsearch_path_spec="$sys_lib_search_path_spec" ;; sco3.2v5*) version_type=osf soname_spec='${libname}${release}${shared_ext}$major' library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' shlibpath_var=LD_LIBRARY_PATH ;; solaris*) version_type=linux need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=yes hardcode_into_libs=yes # ldd complains unless libraries are executable postinstall_cmds='chmod +x $lib' ;; sunos4*) version_type=sunos library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${shared_ext}$versuffix' finish_cmds='PATH="\$PATH:/usr/etc" ldconfig $libdir' shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=yes if test "$with_gnu_ld" = yes; then need_lib_prefix=no fi need_version=yes ;; sysv4 | sysv4.2uw2* | sysv4.3* | sysv5*) version_type=linux library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' shlibpath_var=LD_LIBRARY_PATH case $host_vendor in sni) shlibpath_overrides_runpath=no need_lib_prefix=no export_dynamic_flag_spec='${wl}-Blargedynsym' runpath_var=LD_RUN_PATH ;; siemens) need_lib_prefix=no ;; motorola) need_lib_prefix=no need_version=no shlibpath_overrides_runpath=no sys_lib_search_path_spec='/lib /usr/lib /usr/ccs/lib' ;; esac ;; sysv4*MP*) if test -d /usr/nec ;then version_type=linux library_names_spec='$libname${shared_ext}.$versuffix $libname${shared_ext}.$major $libname${shared_ext}' soname_spec='$libname${shared_ext}.$major' shlibpath_var=LD_LIBRARY_PATH fi ;; uts4*) version_type=linux library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' shlibpath_var=LD_LIBRARY_PATH ;; *) dynamic_linker=no ;; esac echo "$as_me:$LINENO: result: $dynamic_linker" >&5 echo "${ECHO_T}$dynamic_linker" >&6 test "$dynamic_linker" = no && can_build_shared=no echo "$as_me:$LINENO: checking how to hardcode library paths into programs" >&5 echo $ECHO_N "checking how to hardcode library paths into programs... $ECHO_C" >&6 hardcode_action_CXX= if test -n "$hardcode_libdir_flag_spec_CXX" || \ test -n "$runpath_var_CXX" || \ test "X$hardcode_automatic_CXX" = "Xyes" ; then # We can hardcode non-existant directories. if test "$hardcode_direct_CXX" != no && # If the only mechanism to avoid hardcoding is shlibpath_var, we # have to relink, otherwise we might link with an installed library # when we should be linking with a yet-to-be-installed one ## test "$_LT_AC_TAGVAR(hardcode_shlibpath_var, CXX)" != no && test "$hardcode_minus_L_CXX" != no; then # Linking always hardcodes the temporary library directory. hardcode_action_CXX=relink else # We can link without hardcoding, and we can hardcode nonexisting dirs. hardcode_action_CXX=immediate fi else # We cannot hardcode anything, or else we can only hardcode existing # directories. hardcode_action_CXX=unsupported fi echo "$as_me:$LINENO: result: $hardcode_action_CXX" >&5 echo "${ECHO_T}$hardcode_action_CXX" >&6 if test "$hardcode_action_CXX" = relink; then # Fast installation is not supported enable_fast_install=no elif test "$shlibpath_overrides_runpath" = yes || test "$enable_shared" = no; then # Fast installation is not necessary enable_fast_install=needless fi striplib= old_striplib= echo "$as_me:$LINENO: checking whether stripping libraries is possible" >&5 echo $ECHO_N "checking whether stripping libraries is possible... $ECHO_C" >&6 if test -n "$STRIP" && $STRIP -V 2>&1 | grep "GNU strip" >/dev/null; then test -z "$old_striplib" && old_striplib="$STRIP --strip-debug" test -z "$striplib" && striplib="$STRIP --strip-unneeded" echo "$as_me:$LINENO: result: yes" >&5 echo "${ECHO_T}yes" >&6 else # FIXME - insert some real tests, host_os isn't really good enough case $host_os in darwin*) if test -n "$STRIP" ; then striplib="$STRIP -x" echo "$as_me:$LINENO: result: yes" >&5 echo "${ECHO_T}yes" >&6 else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 fi ;; *) echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 ;; esac fi if test "x$enable_dlopen" != xyes; then enable_dlopen=unknown enable_dlopen_self=unknown enable_dlopen_self_static=unknown else lt_cv_dlopen=no lt_cv_dlopen_libs= case $host_os in beos*) lt_cv_dlopen="load_add_on" lt_cv_dlopen_libs= lt_cv_dlopen_self=yes ;; mingw* | pw32*) lt_cv_dlopen="LoadLibrary" lt_cv_dlopen_libs= ;; cygwin*) lt_cv_dlopen="dlopen" lt_cv_dlopen_libs= ;; darwin*) # if libdl is installed we need to link against it echo "$as_me:$LINENO: checking for dlopen in -ldl" >&5 echo $ECHO_N "checking for dlopen in -ldl... $ECHO_C" >&6 if test "${ac_cv_lib_dl_dlopen+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else ac_check_lib_save_LIBS=$LIBS LIBS="-ldl $LIBS" cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ /* Override any gcc2 internal prototype to avoid an error. */ #ifdef __cplusplus extern "C" #endif /* We use char because int might match the return type of a gcc2 builtin and then its argument prototype would still apply. */ char dlopen (); int main () { dlopen (); ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_cxx_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then ac_cv_lib_dl_dlopen=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_cv_lib_dl_dlopen=no fi rm -f conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext LIBS=$ac_check_lib_save_LIBS fi echo "$as_me:$LINENO: result: $ac_cv_lib_dl_dlopen" >&5 echo "${ECHO_T}$ac_cv_lib_dl_dlopen" >&6 if test $ac_cv_lib_dl_dlopen = yes; then lt_cv_dlopen="dlopen" lt_cv_dlopen_libs="-ldl" else lt_cv_dlopen="dyld" lt_cv_dlopen_libs= lt_cv_dlopen_self=yes fi ;; *) echo "$as_me:$LINENO: checking for shl_load" >&5 echo $ECHO_N "checking for shl_load... $ECHO_C" >&6 if test "${ac_cv_func_shl_load+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ /* Define shl_load to an innocuous variant, in case declares shl_load. For example, HP-UX 11i declares gettimeofday. */ #define shl_load innocuous_shl_load /* System header to define __stub macros and hopefully few prototypes, which can conflict with char shl_load (); below. Prefer to if __STDC__ is defined, since exists even on freestanding compilers. */ #ifdef __STDC__ # include #else # include #endif #undef shl_load /* Override any gcc2 internal prototype to avoid an error. */ #ifdef __cplusplus extern "C" { #endif /* We use char because int might match the return type of a gcc2 builtin and then its argument prototype would still apply. */ char shl_load (); /* The GNU C library defines this for functions which it implements to always fail with ENOSYS. Some functions are actually named something starting with __ and the normal name is an alias. */ #if defined (__stub_shl_load) || defined (__stub___shl_load) choke me #else char (*f) () = shl_load; #endif #ifdef __cplusplus } #endif int main () { return f != shl_load; ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_cxx_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then ac_cv_func_shl_load=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_cv_func_shl_load=no fi rm -f conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext fi echo "$as_me:$LINENO: result: $ac_cv_func_shl_load" >&5 echo "${ECHO_T}$ac_cv_func_shl_load" >&6 if test $ac_cv_func_shl_load = yes; then lt_cv_dlopen="shl_load" else echo "$as_me:$LINENO: checking for shl_load in -ldld" >&5 echo $ECHO_N "checking for shl_load in -ldld... $ECHO_C" >&6 if test "${ac_cv_lib_dld_shl_load+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else ac_check_lib_save_LIBS=$LIBS LIBS="-ldld $LIBS" cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ /* Override any gcc2 internal prototype to avoid an error. */ #ifdef __cplusplus extern "C" #endif /* We use char because int might match the return type of a gcc2 builtin and then its argument prototype would still apply. */ char shl_load (); int main () { shl_load (); ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_cxx_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then ac_cv_lib_dld_shl_load=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_cv_lib_dld_shl_load=no fi rm -f conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext LIBS=$ac_check_lib_save_LIBS fi echo "$as_me:$LINENO: result: $ac_cv_lib_dld_shl_load" >&5 echo "${ECHO_T}$ac_cv_lib_dld_shl_load" >&6 if test $ac_cv_lib_dld_shl_load = yes; then lt_cv_dlopen="shl_load" lt_cv_dlopen_libs="-dld" else echo "$as_me:$LINENO: checking for dlopen" >&5 echo $ECHO_N "checking for dlopen... $ECHO_C" >&6 if test "${ac_cv_func_dlopen+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ /* Define dlopen to an innocuous variant, in case declares dlopen. For example, HP-UX 11i declares gettimeofday. */ #define dlopen innocuous_dlopen /* System header to define __stub macros and hopefully few prototypes, which can conflict with char dlopen (); below. Prefer to if __STDC__ is defined, since exists even on freestanding compilers. */ #ifdef __STDC__ # include #else # include #endif #undef dlopen /* Override any gcc2 internal prototype to avoid an error. */ #ifdef __cplusplus extern "C" { #endif /* We use char because int might match the return type of a gcc2 builtin and then its argument prototype would still apply. */ char dlopen (); /* The GNU C library defines this for functions which it implements to always fail with ENOSYS. Some functions are actually named something starting with __ and the normal name is an alias. */ #if defined (__stub_dlopen) || defined (__stub___dlopen) choke me #else char (*f) () = dlopen; #endif #ifdef __cplusplus } #endif int main () { return f != dlopen; ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_cxx_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then ac_cv_func_dlopen=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_cv_func_dlopen=no fi rm -f conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext fi echo "$as_me:$LINENO: result: $ac_cv_func_dlopen" >&5 echo "${ECHO_T}$ac_cv_func_dlopen" >&6 if test $ac_cv_func_dlopen = yes; then lt_cv_dlopen="dlopen" else echo "$as_me:$LINENO: checking for dlopen in -ldl" >&5 echo $ECHO_N "checking for dlopen in -ldl... $ECHO_C" >&6 if test "${ac_cv_lib_dl_dlopen+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else ac_check_lib_save_LIBS=$LIBS LIBS="-ldl $LIBS" cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ /* Override any gcc2 internal prototype to avoid an error. */ #ifdef __cplusplus extern "C" #endif /* We use char because int might match the return type of a gcc2 builtin and then its argument prototype would still apply. */ char dlopen (); int main () { dlopen (); ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_cxx_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then ac_cv_lib_dl_dlopen=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_cv_lib_dl_dlopen=no fi rm -f conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext LIBS=$ac_check_lib_save_LIBS fi echo "$as_me:$LINENO: result: $ac_cv_lib_dl_dlopen" >&5 echo "${ECHO_T}$ac_cv_lib_dl_dlopen" >&6 if test $ac_cv_lib_dl_dlopen = yes; then lt_cv_dlopen="dlopen" lt_cv_dlopen_libs="-ldl" else echo "$as_me:$LINENO: checking for dlopen in -lsvld" >&5 echo $ECHO_N "checking for dlopen in -lsvld... $ECHO_C" >&6 if test "${ac_cv_lib_svld_dlopen+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else ac_check_lib_save_LIBS=$LIBS LIBS="-lsvld $LIBS" cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ /* Override any gcc2 internal prototype to avoid an error. */ #ifdef __cplusplus extern "C" #endif /* We use char because int might match the return type of a gcc2 builtin and then its argument prototype would still apply. */ char dlopen (); int main () { dlopen (); ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_cxx_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then ac_cv_lib_svld_dlopen=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_cv_lib_svld_dlopen=no fi rm -f conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext LIBS=$ac_check_lib_save_LIBS fi echo "$as_me:$LINENO: result: $ac_cv_lib_svld_dlopen" >&5 echo "${ECHO_T}$ac_cv_lib_svld_dlopen" >&6 if test $ac_cv_lib_svld_dlopen = yes; then lt_cv_dlopen="dlopen" lt_cv_dlopen_libs="-lsvld" else echo "$as_me:$LINENO: checking for dld_link in -ldld" >&5 echo $ECHO_N "checking for dld_link in -ldld... $ECHO_C" >&6 if test "${ac_cv_lib_dld_dld_link+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else ac_check_lib_save_LIBS=$LIBS LIBS="-ldld $LIBS" cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ /* Override any gcc2 internal prototype to avoid an error. */ #ifdef __cplusplus extern "C" #endif /* We use char because int might match the return type of a gcc2 builtin and then its argument prototype would still apply. */ char dld_link (); int main () { dld_link (); ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_cxx_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then ac_cv_lib_dld_dld_link=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_cv_lib_dld_dld_link=no fi rm -f conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext LIBS=$ac_check_lib_save_LIBS fi echo "$as_me:$LINENO: result: $ac_cv_lib_dld_dld_link" >&5 echo "${ECHO_T}$ac_cv_lib_dld_dld_link" >&6 if test $ac_cv_lib_dld_dld_link = yes; then lt_cv_dlopen="dld_link" lt_cv_dlopen_libs="-dld" fi fi fi fi fi fi ;; esac if test "x$lt_cv_dlopen" != xno; then enable_dlopen=yes else enable_dlopen=no fi case $lt_cv_dlopen in dlopen) save_CPPFLAGS="$CPPFLAGS" test "x$ac_cv_header_dlfcn_h" = xyes && CPPFLAGS="$CPPFLAGS -DHAVE_DLFCN_H" save_LDFLAGS="$LDFLAGS" eval LDFLAGS=\"\$LDFLAGS $export_dynamic_flag_spec\" save_LIBS="$LIBS" LIBS="$lt_cv_dlopen_libs $LIBS" echo "$as_me:$LINENO: checking whether a program can dlopen itself" >&5 echo $ECHO_N "checking whether a program can dlopen itself... $ECHO_C" >&6 if test "${lt_cv_dlopen_self+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test "$cross_compiling" = yes; then : lt_cv_dlopen_self=cross else lt_dlunknown=0; lt_dlno_uscore=1; lt_dlneed_uscore=2 lt_status=$lt_dlunknown cat > conftest.$ac_ext < #endif #include #ifdef RTLD_GLOBAL # define LT_DLGLOBAL RTLD_GLOBAL #else # ifdef DL_GLOBAL # define LT_DLGLOBAL DL_GLOBAL # else # define LT_DLGLOBAL 0 # endif #endif /* We may have to define LT_DLLAZY_OR_NOW in the command line if we find out it does not work in some platform. */ #ifndef LT_DLLAZY_OR_NOW # ifdef RTLD_LAZY # define LT_DLLAZY_OR_NOW RTLD_LAZY # else # ifdef DL_LAZY # define LT_DLLAZY_OR_NOW DL_LAZY # else # ifdef RTLD_NOW # define LT_DLLAZY_OR_NOW RTLD_NOW # else # ifdef DL_NOW # define LT_DLLAZY_OR_NOW DL_NOW # else # define LT_DLLAZY_OR_NOW 0 # endif # endif # endif # endif #endif #ifdef __cplusplus extern "C" void exit (int); #endif void fnord() { int i=42;} int main () { void *self = dlopen (0, LT_DLGLOBAL|LT_DLLAZY_OR_NOW); int status = $lt_dlunknown; if (self) { if (dlsym (self,"fnord")) status = $lt_dlno_uscore; else if (dlsym( self,"_fnord")) status = $lt_dlneed_uscore; /* dlclose (self); */ } exit (status); } EOF if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && test -s conftest${ac_exeext} 2>/dev/null; then (./conftest; exit; ) 2>/dev/null lt_status=$? case x$lt_status in x$lt_dlno_uscore) lt_cv_dlopen_self=yes ;; x$lt_dlneed_uscore) lt_cv_dlopen_self=yes ;; x$lt_unknown|x*) lt_cv_dlopen_self=no ;; esac else : # compilation failed lt_cv_dlopen_self=no fi fi rm -fr conftest* fi echo "$as_me:$LINENO: result: $lt_cv_dlopen_self" >&5 echo "${ECHO_T}$lt_cv_dlopen_self" >&6 if test "x$lt_cv_dlopen_self" = xyes; then LDFLAGS="$LDFLAGS $link_static_flag" echo "$as_me:$LINENO: checking whether a statically linked program can dlopen itself" >&5 echo $ECHO_N "checking whether a statically linked program can dlopen itself... $ECHO_C" >&6 if test "${lt_cv_dlopen_self_static+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test "$cross_compiling" = yes; then : lt_cv_dlopen_self_static=cross else lt_dlunknown=0; lt_dlno_uscore=1; lt_dlneed_uscore=2 lt_status=$lt_dlunknown cat > conftest.$ac_ext < #endif #include #ifdef RTLD_GLOBAL # define LT_DLGLOBAL RTLD_GLOBAL #else # ifdef DL_GLOBAL # define LT_DLGLOBAL DL_GLOBAL # else # define LT_DLGLOBAL 0 # endif #endif /* We may have to define LT_DLLAZY_OR_NOW in the command line if we find out it does not work in some platform. */ #ifndef LT_DLLAZY_OR_NOW # ifdef RTLD_LAZY # define LT_DLLAZY_OR_NOW RTLD_LAZY # else # ifdef DL_LAZY # define LT_DLLAZY_OR_NOW DL_LAZY # else # ifdef RTLD_NOW # define LT_DLLAZY_OR_NOW RTLD_NOW # else # ifdef DL_NOW # define LT_DLLAZY_OR_NOW DL_NOW # else # define LT_DLLAZY_OR_NOW 0 # endif # endif # endif # endif #endif #ifdef __cplusplus extern "C" void exit (int); #endif void fnord() { int i=42;} int main () { void *self = dlopen (0, LT_DLGLOBAL|LT_DLLAZY_OR_NOW); int status = $lt_dlunknown; if (self) { if (dlsym (self,"fnord")) status = $lt_dlno_uscore; else if (dlsym( self,"_fnord")) status = $lt_dlneed_uscore; /* dlclose (self); */ } exit (status); } EOF if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && test -s conftest${ac_exeext} 2>/dev/null; then (./conftest; exit; ) 2>/dev/null lt_status=$? case x$lt_status in x$lt_dlno_uscore) lt_cv_dlopen_self_static=yes ;; x$lt_dlneed_uscore) lt_cv_dlopen_self_static=yes ;; x$lt_unknown|x*) lt_cv_dlopen_self_static=no ;; esac else : # compilation failed lt_cv_dlopen_self_static=no fi fi rm -fr conftest* fi echo "$as_me:$LINENO: result: $lt_cv_dlopen_self_static" >&5 echo "${ECHO_T}$lt_cv_dlopen_self_static" >&6 fi CPPFLAGS="$save_CPPFLAGS" LDFLAGS="$save_LDFLAGS" LIBS="$save_LIBS" ;; esac case $lt_cv_dlopen_self in yes|no) enable_dlopen_self=$lt_cv_dlopen_self ;; *) enable_dlopen_self=unknown ;; esac case $lt_cv_dlopen_self_static in yes|no) enable_dlopen_self_static=$lt_cv_dlopen_self_static ;; *) enable_dlopen_self_static=unknown ;; esac fi # The else clause should only fire when bootstrapping the # libtool distribution, otherwise you forgot to ship ltmain.sh # with your package, and you will get complaints that there are # no rules to generate ltmain.sh. if test -f "$ltmain"; then # See if we are running on zsh, and set the options which allow our commands through # without removal of \ escapes. if test -n "${ZSH_VERSION+set}" ; then setopt NO_GLOB_SUBST fi # Now quote all the things that may contain metacharacters while being # careful not to overquote the AC_SUBSTed values. We take copies of the # variables and quote the copies for generation of the libtool script. for var in echo old_CC old_CFLAGS AR AR_FLAGS EGREP RANLIB LN_S LTCC NM \ SED SHELL STRIP \ libname_spec library_names_spec soname_spec extract_expsyms_cmds \ old_striplib striplib file_magic_cmd finish_cmds finish_eval \ deplibs_check_method reload_flag reload_cmds need_locks \ lt_cv_sys_global_symbol_pipe lt_cv_sys_global_symbol_to_cdecl \ lt_cv_sys_global_symbol_to_c_name_address \ sys_lib_search_path_spec sys_lib_dlsearch_path_spec \ old_postinstall_cmds old_postuninstall_cmds \ compiler_CXX \ CC_CXX \ LD_CXX \ lt_prog_compiler_wl_CXX \ lt_prog_compiler_pic_CXX \ lt_prog_compiler_static_CXX \ lt_prog_compiler_no_builtin_flag_CXX \ export_dynamic_flag_spec_CXX \ thread_safe_flag_spec_CXX \ whole_archive_flag_spec_CXX \ enable_shared_with_static_runtimes_CXX \ old_archive_cmds_CXX \ old_archive_from_new_cmds_CXX \ predep_objects_CXX \ postdep_objects_CXX \ predeps_CXX \ postdeps_CXX \ compiler_lib_search_path_CXX \ archive_cmds_CXX \ archive_expsym_cmds_CXX \ postinstall_cmds_CXX \ postuninstall_cmds_CXX \ old_archive_from_expsyms_cmds_CXX \ allow_undefined_flag_CXX \ no_undefined_flag_CXX \ export_symbols_cmds_CXX \ hardcode_libdir_flag_spec_CXX \ hardcode_libdir_flag_spec_ld_CXX \ hardcode_libdir_separator_CXX \ hardcode_automatic_CXX \ module_cmds_CXX \ module_expsym_cmds_CXX \ lt_cv_prog_compiler_c_o_CXX \ exclude_expsyms_CXX \ include_expsyms_CXX; do case $var in old_archive_cmds_CXX | \ old_archive_from_new_cmds_CXX | \ archive_cmds_CXX | \ archive_expsym_cmds_CXX | \ module_cmds_CXX | \ module_expsym_cmds_CXX | \ old_archive_from_expsyms_cmds_CXX | \ export_symbols_cmds_CXX | \ extract_expsyms_cmds | reload_cmds | finish_cmds | \ postinstall_cmds | postuninstall_cmds | \ old_postinstall_cmds | old_postuninstall_cmds | \ sys_lib_search_path_spec | sys_lib_dlsearch_path_spec) # Double-quote double-evaled strings. eval "lt_$var=\\\"\`\$echo \"X\$$var\" | \$Xsed -e \"\$double_quote_subst\" -e \"\$sed_quote_subst\" -e \"\$delay_variable_subst\"\`\\\"" ;; *) eval "lt_$var=\\\"\`\$echo \"X\$$var\" | \$Xsed -e \"\$sed_quote_subst\"\`\\\"" ;; esac done case $lt_echo in *'\$0 --fallback-echo"') lt_echo=`$echo "X$lt_echo" | $Xsed -e 's/\\\\\\\$0 --fallback-echo"$/$0 --fallback-echo"/'` ;; esac cfgfile="$ofile" cat <<__EOF__ >> "$cfgfile" # ### BEGIN LIBTOOL TAG CONFIG: $tagname # Libtool was configured on host `(hostname || uname -n) 2>/dev/null | sed 1q`: # Shell to use when invoking shell scripts. SHELL=$lt_SHELL # Whether or not to build shared libraries. build_libtool_libs=$enable_shared # Whether or not to build static libraries. build_old_libs=$enable_static # Whether or not to add -lc for building shared libraries. build_libtool_need_lc=$archive_cmds_need_lc_CXX # Whether or not to disallow shared libs when runtime libs are static allow_libtool_libs_with_static_runtimes=$enable_shared_with_static_runtimes_CXX # Whether or not to optimize for fast installation. fast_install=$enable_fast_install # The host system. host_alias=$host_alias host=$host # An echo program that does not interpret backslashes. echo=$lt_echo # The archiver. AR=$lt_AR AR_FLAGS=$lt_AR_FLAGS # A C compiler. LTCC=$lt_LTCC # A language-specific compiler. CC=$lt_compiler_CXX # Is the compiler the GNU C compiler? with_gcc=$GCC_CXX # An ERE matcher. EGREP=$lt_EGREP # The linker used to build libraries. LD=$lt_LD_CXX # Whether we need hard or soft links. LN_S=$lt_LN_S # A BSD-compatible nm program. NM=$lt_NM # A symbol stripping program STRIP=$lt_STRIP # Used to examine libraries when file_magic_cmd begins "file" MAGIC_CMD=$MAGIC_CMD # Used on cygwin: DLL creation program. DLLTOOL="$DLLTOOL" # Used on cygwin: object dumper. OBJDUMP="$OBJDUMP" # Used on cygwin: assembler. AS="$AS" # The name of the directory that contains temporary libtool files. objdir=$objdir # How to create reloadable object files. reload_flag=$lt_reload_flag reload_cmds=$lt_reload_cmds # How to pass a linker flag through the compiler. wl=$lt_lt_prog_compiler_wl_CXX # Object file suffix (normally "o"). objext="$ac_objext" # Old archive suffix (normally "a"). libext="$libext" # Shared library suffix (normally ".so"). shrext_cmds='$shrext_cmds' # Executable file suffix (normally ""). exeext="$exeext" # Additional compiler flags for building library objects. pic_flag=$lt_lt_prog_compiler_pic_CXX pic_mode=$pic_mode # What is the maximum length of a command? max_cmd_len=$lt_cv_sys_max_cmd_len # Does compiler simultaneously support -c and -o options? compiler_c_o=$lt_lt_cv_prog_compiler_c_o_CXX # Must we lock files when doing compilation ? need_locks=$lt_need_locks # Do we need the lib prefix for modules? need_lib_prefix=$need_lib_prefix # Do we need a version for libraries? need_version=$need_version # Whether dlopen is supported. dlopen_support=$enable_dlopen # Whether dlopen of programs is supported. dlopen_self=$enable_dlopen_self # Whether dlopen of statically linked programs is supported. dlopen_self_static=$enable_dlopen_self_static # Compiler flag to prevent dynamic linking. link_static_flag=$lt_lt_prog_compiler_static_CXX # Compiler flag to turn off builtin functions. no_builtin_flag=$lt_lt_prog_compiler_no_builtin_flag_CXX # Compiler flag to allow reflexive dlopens. export_dynamic_flag_spec=$lt_export_dynamic_flag_spec_CXX # Compiler flag to generate shared objects directly from archives. whole_archive_flag_spec=$lt_whole_archive_flag_spec_CXX # Compiler flag to generate thread-safe objects. thread_safe_flag_spec=$lt_thread_safe_flag_spec_CXX # Library versioning type. version_type=$version_type # Format of library name prefix. libname_spec=$lt_libname_spec # List of archive names. First name is the real one, the rest are links. # The last name is the one that the linker finds with -lNAME. library_names_spec=$lt_library_names_spec # The coded name of the library, if different from the real name. soname_spec=$lt_soname_spec # Commands used to build and install an old-style archive. RANLIB=$lt_RANLIB old_archive_cmds=$lt_old_archive_cmds_CXX old_postinstall_cmds=$lt_old_postinstall_cmds old_postuninstall_cmds=$lt_old_postuninstall_cmds # Create an old-style archive from a shared archive. old_archive_from_new_cmds=$lt_old_archive_from_new_cmds_CXX # Create a temporary old-style archive to link instead of a shared archive. old_archive_from_expsyms_cmds=$lt_old_archive_from_expsyms_cmds_CXX # Commands used to build and install a shared archive. archive_cmds=$lt_archive_cmds_CXX archive_expsym_cmds=$lt_archive_expsym_cmds_CXX postinstall_cmds=$lt_postinstall_cmds postuninstall_cmds=$lt_postuninstall_cmds # Commands used to build a loadable module (assumed same as above if empty) module_cmds=$lt_module_cmds_CXX module_expsym_cmds=$lt_module_expsym_cmds_CXX # Commands to strip libraries. old_striplib=$lt_old_striplib striplib=$lt_striplib # Dependencies to place before the objects being linked to create a # shared library. predep_objects=$lt_predep_objects_CXX # Dependencies to place after the objects being linked to create a # shared library. postdep_objects=$lt_postdep_objects_CXX # Dependencies to place before the objects being linked to create a # shared library. predeps=$lt_predeps_CXX # Dependencies to place after the objects being linked to create a # shared library. postdeps=$lt_postdeps_CXX # The library search path used internally by the compiler when linking # a shared library. compiler_lib_search_path=$lt_compiler_lib_search_path_CXX # Method to check whether dependent libraries are shared objects. deplibs_check_method=$lt_deplibs_check_method # Command to use when deplibs_check_method == file_magic. file_magic_cmd=$lt_file_magic_cmd # Flag that allows shared libraries with undefined symbols to be built. allow_undefined_flag=$lt_allow_undefined_flag_CXX # Flag that forces no undefined symbols. no_undefined_flag=$lt_no_undefined_flag_CXX # Commands used to finish a libtool library installation in a directory. finish_cmds=$lt_finish_cmds # Same as above, but a single script fragment to be evaled but not shown. finish_eval=$lt_finish_eval # Take the output of nm and produce a listing of raw symbols and C names. global_symbol_pipe=$lt_lt_cv_sys_global_symbol_pipe # Transform the output of nm in a proper C declaration global_symbol_to_cdecl=$lt_lt_cv_sys_global_symbol_to_cdecl # Transform the output of nm in a C name address pair global_symbol_to_c_name_address=$lt_lt_cv_sys_global_symbol_to_c_name_address # This is the shared library runtime path variable. runpath_var=$runpath_var # This is the shared library path variable. shlibpath_var=$shlibpath_var # Is shlibpath searched before the hard-coded library search path? shlibpath_overrides_runpath=$shlibpath_overrides_runpath # How to hardcode a shared library path into an executable. hardcode_action=$hardcode_action_CXX # Whether we should hardcode library paths into libraries. hardcode_into_libs=$hardcode_into_libs # Flag to hardcode \$libdir into a binary during linking. # This must work even if \$libdir does not exist. hardcode_libdir_flag_spec=$lt_hardcode_libdir_flag_spec_CXX # If ld is used when linking, flag to hardcode \$libdir into # a binary during linking. This must work even if \$libdir does # not exist. hardcode_libdir_flag_spec_ld=$lt_hardcode_libdir_flag_spec_ld_CXX # Whether we need a single -rpath flag with a separated argument. hardcode_libdir_separator=$lt_hardcode_libdir_separator_CXX # Set to yes if using DIR/libNAME${shared_ext} during linking hardcodes DIR into the # resulting binary. hardcode_direct=$hardcode_direct_CXX # Set to yes if using the -LDIR flag during linking hardcodes DIR into the # resulting binary. hardcode_minus_L=$hardcode_minus_L_CXX # Set to yes if using SHLIBPATH_VAR=DIR during linking hardcodes DIR into # the resulting binary. hardcode_shlibpath_var=$hardcode_shlibpath_var_CXX # Set to yes if building a shared library automatically hardcodes DIR into the library # and all subsequent libraries and executables linked against it. hardcode_automatic=$hardcode_automatic_CXX # Variables whose values should be saved in libtool wrapper scripts and # restored at relink time. variables_saved_for_relink="$variables_saved_for_relink" # Whether libtool must link a program against all its dependency libraries. link_all_deplibs=$link_all_deplibs_CXX # Compile-time system search path for libraries sys_lib_search_path_spec=$lt_sys_lib_search_path_spec # Run-time system search path for libraries sys_lib_dlsearch_path_spec=$lt_sys_lib_dlsearch_path_spec # Fix the shell variable \$srcfile for the compiler. fix_srcfile_path="$fix_srcfile_path_CXX" # Set to yes if exported symbols are required. always_export_symbols=$always_export_symbols_CXX # The commands to list exported symbols. export_symbols_cmds=$lt_export_symbols_cmds_CXX # The commands to extract the exported symbol list from a shared archive. extract_expsyms_cmds=$lt_extract_expsyms_cmds # Symbols that should not be listed in the preloaded symbols. exclude_expsyms=$lt_exclude_expsyms_CXX # Symbols that must always be exported. include_expsyms=$lt_include_expsyms_CXX # ### END LIBTOOL TAG CONFIG: $tagname __EOF__ else # If there is no Makefile yet, we rely on a make rule to execute # `config.status --recheck' to rerun these tests and create the # libtool script then. ltmain_in=`echo $ltmain | sed -e 's/\.sh$/.in/'` if test -f "$ltmain_in"; then test -f Makefile && make "$ltmain" fi fi ac_ext=c ac_cpp='$CPP $CPPFLAGS' ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' ac_compiler_gnu=$ac_cv_c_compiler_gnu CC=$lt_save_CC LDCXX=$LD LD=$lt_save_LD GCC=$lt_save_GCC with_gnu_ldcxx=$with_gnu_ld with_gnu_ld=$lt_save_with_gnu_ld lt_cv_path_LDCXX=$lt_cv_path_LD lt_cv_path_LD=$lt_save_path_LD lt_cv_prog_gnu_ldcxx=$lt_cv_prog_gnu_ld lt_cv_prog_gnu_ld=$lt_save_with_gnu_ld else tagname="" fi ;; F77) if test -n "$F77" && test "X$F77" != "Xno"; then ac_ext=f ac_compile='$F77 -c $FFLAGS conftest.$ac_ext >&5' ac_link='$F77 -o conftest$ac_exeext $FFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' ac_compiler_gnu=$ac_cv_f77_compiler_gnu archive_cmds_need_lc_F77=no allow_undefined_flag_F77= always_export_symbols_F77=no archive_expsym_cmds_F77= export_dynamic_flag_spec_F77= hardcode_direct_F77=no hardcode_libdir_flag_spec_F77= hardcode_libdir_flag_spec_ld_F77= hardcode_libdir_separator_F77= hardcode_minus_L_F77=no hardcode_automatic_F77=no module_cmds_F77= module_expsym_cmds_F77= link_all_deplibs_F77=unknown old_archive_cmds_F77=$old_archive_cmds no_undefined_flag_F77= whole_archive_flag_spec_F77= enable_shared_with_static_runtimes_F77=no # Source file extension for f77 test sources. ac_ext=f # Object file extension for compiled f77 test sources. objext=o objext_F77=$objext # Code to be used in simple compile tests lt_simple_compile_test_code=" subroutine t\n return\n end\n" # Code to be used in simple link tests lt_simple_link_test_code=" program t\n end\n" # ltmain only uses $CC for tagged configurations so make sure $CC is set. # If no C compiler was specified, use CC. LTCC=${LTCC-"$CC"} # Allow CC to be a program name with arguments. compiler=$CC # Allow CC to be a program name with arguments. lt_save_CC="$CC" CC=${F77-"f77"} compiler=$CC compiler_F77=$CC cc_basename=`$echo X"$compiler" | $Xsed -e 's%^.*/%%'` echo "$as_me:$LINENO: checking if libtool supports shared libraries" >&5 echo $ECHO_N "checking if libtool supports shared libraries... $ECHO_C" >&6 echo "$as_me:$LINENO: result: $can_build_shared" >&5 echo "${ECHO_T}$can_build_shared" >&6 echo "$as_me:$LINENO: checking whether to build shared libraries" >&5 echo $ECHO_N "checking whether to build shared libraries... $ECHO_C" >&6 test "$can_build_shared" = "no" && enable_shared=no # On AIX, shared libraries and static libraries use the same namespace, and # are all built from PIC. case "$host_os" in aix3*) test "$enable_shared" = yes && enable_static=no if test -n "$RANLIB"; then archive_cmds="$archive_cmds~\$RANLIB \$lib" postinstall_cmds='$RANLIB $lib' fi ;; aix4* | aix5*) test "$enable_shared" = yes && enable_static=no ;; esac echo "$as_me:$LINENO: result: $enable_shared" >&5 echo "${ECHO_T}$enable_shared" >&6 echo "$as_me:$LINENO: checking whether to build static libraries" >&5 echo $ECHO_N "checking whether to build static libraries... $ECHO_C" >&6 # Make sure either enable_shared or enable_static is yes. test "$enable_shared" = yes || enable_static=yes echo "$as_me:$LINENO: result: $enable_static" >&5 echo "${ECHO_T}$enable_static" >&6 test "$ld_shlibs_F77" = no && can_build_shared=no GCC_F77="$G77" LD_F77="$LD" lt_prog_compiler_wl_F77= lt_prog_compiler_pic_F77= lt_prog_compiler_static_F77= echo "$as_me:$LINENO: checking for $compiler option to produce PIC" >&5 echo $ECHO_N "checking for $compiler option to produce PIC... $ECHO_C" >&6 if test "$GCC" = yes; then lt_prog_compiler_wl_F77='-Wl,' lt_prog_compiler_static_F77='-static' case $host_os in aix*) # All AIX code is PIC. if test "$host_cpu" = ia64; then # AIX 5 now supports IA64 processor lt_prog_compiler_static_F77='-Bstatic' fi ;; amigaos*) # FIXME: we need at least 68020 code to build shared libraries, but # adding the `-m68020' flag to GCC prevents building anything better, # like `-m68040'. lt_prog_compiler_pic_F77='-m68020 -resident32 -malways-restore-a4' ;; beos* | cygwin* | irix5* | irix6* | nonstopux* | osf3* | osf4* | osf5*) # PIC is the default for these OSes. ;; mingw* | pw32* | os2*) # This hack is so that the source file can tell whether it is being # built for inclusion in a dll (and should export symbols for example). lt_prog_compiler_pic_F77='-DDLL_EXPORT' ;; darwin* | rhapsody*) # PIC is the default on this platform # Common symbols not allowed in MH_DYLIB files lt_prog_compiler_pic_F77='-fno-common' ;; msdosdjgpp*) # Just because we use GCC doesn't mean we suddenly get shared libraries # on systems that don't support them. lt_prog_compiler_can_build_shared_F77=no enable_shared=no ;; sysv4*MP*) if test -d /usr/nec; then lt_prog_compiler_pic_F77=-Kconform_pic fi ;; hpux*) # PIC is the default for IA64 HP-UX and 64-bit HP-UX, but # not for PA HP-UX. case "$host_cpu" in hppa*64*|ia64*) # +Z the default ;; *) lt_prog_compiler_pic_F77='-fPIC' ;; esac ;; *) lt_prog_compiler_pic_F77='-fPIC' ;; esac else # PORTME Check for flag to pass linker flags through the system compiler. case $host_os in aix*) lt_prog_compiler_wl_F77='-Wl,' if test "$host_cpu" = ia64; then # AIX 5 now supports IA64 processor lt_prog_compiler_static_F77='-Bstatic' else lt_prog_compiler_static_F77='-bnso -bI:/lib/syscalls.exp' fi ;; darwin*) # PIC is the default on this platform # Common symbols not allowed in MH_DYLIB files case "$cc_basename" in xlc*) lt_prog_compiler_pic_F77='-qnocommon' lt_prog_compiler_wl_F77='-Wl,' ;; esac ;; mingw* | pw32* | os2*) # This hack is so that the source file can tell whether it is being # built for inclusion in a dll (and should export symbols for example). lt_prog_compiler_pic_F77='-DDLL_EXPORT' ;; hpux9* | hpux10* | hpux11*) lt_prog_compiler_wl_F77='-Wl,' # PIC is the default for IA64 HP-UX and 64-bit HP-UX, but # not for PA HP-UX. case "$host_cpu" in hppa*64*|ia64*) # +Z the default ;; *) lt_prog_compiler_pic_F77='+Z' ;; esac # Is there a better lt_prog_compiler_static that works with the bundled CC? lt_prog_compiler_static_F77='${wl}-a ${wl}archive' ;; irix5* | irix6* | nonstopux*) lt_prog_compiler_wl_F77='-Wl,' # PIC (with -KPIC) is the default. lt_prog_compiler_static_F77='-non_shared' ;; newsos6) lt_prog_compiler_pic_F77='-KPIC' lt_prog_compiler_static_F77='-Bstatic' ;; linux*) case $CC in icc* | ecc*) lt_prog_compiler_wl_F77='-Wl,' lt_prog_compiler_pic_F77='-KPIC' lt_prog_compiler_static_F77='-static' ;; ccc*) lt_prog_compiler_wl_F77='-Wl,' # All Alpha code is PIC. lt_prog_compiler_static_F77='-non_shared' ;; esac ;; osf3* | osf4* | osf5*) lt_prog_compiler_wl_F77='-Wl,' # All OSF/1 code is PIC. lt_prog_compiler_static_F77='-non_shared' ;; sco3.2v5*) lt_prog_compiler_pic_F77='-Kpic' lt_prog_compiler_static_F77='-dn' ;; solaris*) lt_prog_compiler_wl_F77='-Wl,' lt_prog_compiler_pic_F77='-KPIC' lt_prog_compiler_static_F77='-Bstatic' ;; sunos4*) lt_prog_compiler_wl_F77='-Qoption ld ' lt_prog_compiler_pic_F77='-PIC' lt_prog_compiler_static_F77='-Bstatic' ;; sysv4 | sysv4.2uw2* | sysv4.3* | sysv5*) lt_prog_compiler_wl_F77='-Wl,' lt_prog_compiler_pic_F77='-KPIC' lt_prog_compiler_static_F77='-Bstatic' ;; sysv4*MP*) if test -d /usr/nec ;then lt_prog_compiler_pic_F77='-Kconform_pic' lt_prog_compiler_static_F77='-Bstatic' fi ;; uts4*) lt_prog_compiler_pic_F77='-pic' lt_prog_compiler_static_F77='-Bstatic' ;; *) lt_prog_compiler_can_build_shared_F77=no ;; esac fi echo "$as_me:$LINENO: result: $lt_prog_compiler_pic_F77" >&5 echo "${ECHO_T}$lt_prog_compiler_pic_F77" >&6 # # Check to make sure the PIC flag actually works. # if test -n "$lt_prog_compiler_pic_F77"; then echo "$as_me:$LINENO: checking if $compiler PIC flag $lt_prog_compiler_pic_F77 works" >&5 echo $ECHO_N "checking if $compiler PIC flag $lt_prog_compiler_pic_F77 works... $ECHO_C" >&6 if test "${lt_prog_compiler_pic_works_F77+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else lt_prog_compiler_pic_works_F77=no ac_outfile=conftest.$ac_objext printf "$lt_simple_compile_test_code" > conftest.$ac_ext lt_compiler_flag="$lt_prog_compiler_pic_F77" # Insert the option either (1) after the last *FLAGS variable, or # (2) before a word containing "conftest.", or (3) at the end. # Note that $ac_compile itself does not contain backslashes and begins # with a dollar sign (not a hyphen), so the echo should work correctly. # The option is referenced via a variable to avoid confusing sed. lt_compile=`echo "$ac_compile" | $SED \ -e 's:.*FLAGS}? :&$lt_compiler_flag :; t' \ -e 's: [^ ]*conftest\.: $lt_compiler_flag&:; t' \ -e 's:$: $lt_compiler_flag:'` (eval echo "\"\$as_me:13550: $lt_compile\"" >&5) (eval "$lt_compile" 2>conftest.err) ac_status=$? cat conftest.err >&5 echo "$as_me:13554: \$? = $ac_status" >&5 if (exit $ac_status) && test -s "$ac_outfile"; then # The compiler can only warn and ignore the option if not recognized # So say no if there are warnings if test ! -s conftest.err; then lt_prog_compiler_pic_works_F77=yes fi fi $rm conftest* fi echo "$as_me:$LINENO: result: $lt_prog_compiler_pic_works_F77" >&5 echo "${ECHO_T}$lt_prog_compiler_pic_works_F77" >&6 if test x"$lt_prog_compiler_pic_works_F77" = xyes; then case $lt_prog_compiler_pic_F77 in "" | " "*) ;; *) lt_prog_compiler_pic_F77=" $lt_prog_compiler_pic_F77" ;; esac else lt_prog_compiler_pic_F77= lt_prog_compiler_can_build_shared_F77=no fi fi case "$host_os" in # For platforms which do not support PIC, -DPIC is meaningless: *djgpp*) lt_prog_compiler_pic_F77= ;; *) lt_prog_compiler_pic_F77="$lt_prog_compiler_pic_F77" ;; esac echo "$as_me:$LINENO: checking if $compiler supports -c -o file.$ac_objext" >&5 echo $ECHO_N "checking if $compiler supports -c -o file.$ac_objext... $ECHO_C" >&6 if test "${lt_cv_prog_compiler_c_o_F77+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else lt_cv_prog_compiler_c_o_F77=no $rm -r conftest 2>/dev/null mkdir conftest cd conftest mkdir out printf "$lt_simple_compile_test_code" > conftest.$ac_ext lt_compiler_flag="-o out/conftest2.$ac_objext" # Insert the option either (1) after the last *FLAGS variable, or # (2) before a word containing "conftest.", or (3) at the end. # Note that $ac_compile itself does not contain backslashes and begins # with a dollar sign (not a hyphen), so the echo should work correctly. lt_compile=`echo "$ac_compile" | $SED \ -e 's:.*FLAGS}? :&$lt_compiler_flag :; t' \ -e 's: [^ ]*conftest\.: $lt_compiler_flag&:; t' \ -e 's:$: $lt_compiler_flag:'` (eval echo "\"\$as_me:13610: $lt_compile\"" >&5) (eval "$lt_compile" 2>out/conftest.err) ac_status=$? cat out/conftest.err >&5 echo "$as_me:13614: \$? = $ac_status" >&5 if (exit $ac_status) && test -s out/conftest2.$ac_objext then # The compiler can only warn and ignore the option if not recognized # So say no if there are warnings if test ! -s out/conftest.err; then lt_cv_prog_compiler_c_o_F77=yes fi fi chmod u+w . $rm conftest* # SGI C++ compiler will create directory out/ii_files/ for # template instantiation test -d out/ii_files && $rm out/ii_files/* && rmdir out/ii_files $rm out/* && rmdir out cd .. rmdir conftest $rm conftest* fi echo "$as_me:$LINENO: result: $lt_cv_prog_compiler_c_o_F77" >&5 echo "${ECHO_T}$lt_cv_prog_compiler_c_o_F77" >&6 hard_links="nottested" if test "$lt_cv_prog_compiler_c_o_F77" = no && test "$need_locks" != no; then # do not overwrite the value of need_locks provided by the user echo "$as_me:$LINENO: checking if we can lock with hard links" >&5 echo $ECHO_N "checking if we can lock with hard links... $ECHO_C" >&6 hard_links=yes $rm conftest* ln conftest.a conftest.b 2>/dev/null && hard_links=no touch conftest.a ln conftest.a conftest.b 2>&5 || hard_links=no ln conftest.a conftest.b 2>/dev/null && hard_links=no echo "$as_me:$LINENO: result: $hard_links" >&5 echo "${ECHO_T}$hard_links" >&6 if test "$hard_links" = no; then { echo "$as_me:$LINENO: WARNING: \`$CC' does not support \`-c -o', so \`make -j' may be unsafe" >&5 echo "$as_me: WARNING: \`$CC' does not support \`-c -o', so \`make -j' may be unsafe" >&2;} need_locks=warn fi else need_locks=no fi echo "$as_me:$LINENO: checking whether the $compiler linker ($LD) supports shared libraries" >&5 echo $ECHO_N "checking whether the $compiler linker ($LD) supports shared libraries... $ECHO_C" >&6 runpath_var= allow_undefined_flag_F77= enable_shared_with_static_runtimes_F77=no archive_cmds_F77= archive_expsym_cmds_F77= old_archive_From_new_cmds_F77= old_archive_from_expsyms_cmds_F77= export_dynamic_flag_spec_F77= whole_archive_flag_spec_F77= thread_safe_flag_spec_F77= hardcode_libdir_flag_spec_F77= hardcode_libdir_flag_spec_ld_F77= hardcode_libdir_separator_F77= hardcode_direct_F77=no hardcode_minus_L_F77=no hardcode_shlibpath_var_F77=unsupported link_all_deplibs_F77=unknown hardcode_automatic_F77=no module_cmds_F77= module_expsym_cmds_F77= always_export_symbols_F77=no export_symbols_cmds_F77='$NM $libobjs $convenience | $global_symbol_pipe | $SED '\''s/.* //'\'' | sort | uniq > $export_symbols' # include_expsyms should be a list of space-separated symbols to be *always* # included in the symbol list include_expsyms_F77= # exclude_expsyms can be an extended regexp of symbols to exclude # it will be wrapped by ` (' and `)$', so one must not match beginning or # end of line. Example: `a|bc|.*d.*' will exclude the symbols `a' and `bc', # as well as any symbol that contains `d'. exclude_expsyms_F77="_GLOBAL_OFFSET_TABLE_" # Although _GLOBAL_OFFSET_TABLE_ is a valid symbol C name, most a.out # platforms (ab)use it in PIC code, but their linkers get confused if # the symbol is explicitly referenced. Since portable code cannot # rely on this symbol name, it's probably fine to never include it in # preloaded symbol tables. extract_expsyms_cmds= case $host_os in cygwin* | mingw* | pw32*) # FIXME: the MSVC++ port hasn't been tested in a loooong time # When not using gcc, we currently assume that we are using # Microsoft Visual C++. if test "$GCC" != yes; then with_gnu_ld=no fi ;; openbsd*) with_gnu_ld=no ;; esac ld_shlibs_F77=yes if test "$with_gnu_ld" = yes; then # If archive_cmds runs LD, not CC, wlarc should be empty wlarc='${wl}' # See if GNU ld supports shared libraries. case $host_os in aix3* | aix4* | aix5*) # On AIX/PPC, the GNU linker is very broken if test "$host_cpu" != ia64; then ld_shlibs_F77=no cat <&2 *** Warning: the GNU linker, at least up to release 2.9.1, is reported *** to be unable to reliably create shared libraries on AIX. *** Therefore, libtool is disabling shared libraries support. If you *** really care for shared libraries, you may want to modify your PATH *** so that a non-GNU linker is found, and then restart. EOF fi ;; amigaos*) archive_cmds_F77='$rm $output_objdir/a2ixlibrary.data~$echo "#define NAME $libname" > $output_objdir/a2ixlibrary.data~$echo "#define LIBRARY_ID 1" >> $output_objdir/a2ixlibrary.data~$echo "#define VERSION $major" >> $output_objdir/a2ixlibrary.data~$echo "#define REVISION $revision" >> $output_objdir/a2ixlibrary.data~$AR $AR_FLAGS $lib $libobjs~$RANLIB $lib~(cd $output_objdir && a2ixlibrary -32)' hardcode_libdir_flag_spec_F77='-L$libdir' hardcode_minus_L_F77=yes # Samuel A. Falvo II reports # that the semantics of dynamic libraries on AmigaOS, at least up # to version 4, is to share data among multiple programs linked # with the same dynamic library. Since this doesn't match the # behavior of shared libraries on other platforms, we can't use # them. ld_shlibs_F77=no ;; beos*) if $LD --help 2>&1 | grep ': supported targets:.* elf' > /dev/null; then allow_undefined_flag_F77=unsupported # Joseph Beckenbach says some releases of gcc # support --undefined. This deserves some investigation. FIXME archive_cmds_F77='$CC -nostart $libobjs $deplibs $compiler_flags ${wl}-soname $wl$soname -o $lib' else ld_shlibs_F77=no fi ;; cygwin* | mingw* | pw32*) # _LT_AC_TAGVAR(hardcode_libdir_flag_spec, F77) is actually meaningless, # as there is no search path for DLLs. hardcode_libdir_flag_spec_F77='-L$libdir' allow_undefined_flag_F77=unsupported always_export_symbols_F77=no enable_shared_with_static_runtimes_F77=yes export_symbols_cmds_F77='$NM $libobjs $convenience | $global_symbol_pipe | $SED -e '\''/^[BCDGS] /s/.* \([^ ]*\)/\1 DATA/'\'' | $SED -e '\''/^[AITW] /s/.* //'\'' | sort | uniq > $export_symbols' if $LD --help 2>&1 | grep 'auto-import' > /dev/null; then archive_cmds_F77='$CC -shared $libobjs $deplibs $compiler_flags -o $output_objdir/$soname ${wl}--image-base=0x10000000 ${wl}--out-implib,$lib' # If the export-symbols file already is a .def file (1st line # is EXPORTS), use it as is; otherwise, prepend... archive_expsym_cmds_F77='if test "x`$SED 1q $export_symbols`" = xEXPORTS; then cp $export_symbols $output_objdir/$soname.def; else echo EXPORTS > $output_objdir/$soname.def; cat $export_symbols >> $output_objdir/$soname.def; fi~ $CC -shared $output_objdir/$soname.def $libobjs $deplibs $compiler_flags -o $output_objdir/$soname ${wl}--image-base=0x10000000 ${wl}--out-implib,$lib' else ld_shlibs=no fi ;; netbsd*) if echo __ELF__ | $CC -E - | grep __ELF__ >/dev/null; then archive_cmds_F77='$LD -Bshareable $libobjs $deplibs $linker_flags -o $lib' wlarc= else archive_cmds_F77='$CC -shared $libobjs $deplibs $compiler_flags ${wl}-soname $wl$soname -o $lib' archive_expsym_cmds_F77='$CC -shared $libobjs $deplibs $compiler_flags ${wl}-soname $wl$soname ${wl}-retain-symbols-file $wl$export_symbols -o $lib' fi ;; solaris* | sysv5*) if $LD -v 2>&1 | grep 'BFD 2\.8' > /dev/null; then ld_shlibs_F77=no cat <&2 *** Warning: The releases 2.8.* of the GNU linker cannot reliably *** create shared libraries on Solaris systems. Therefore, libtool *** is disabling shared libraries support. We urge you to upgrade GNU *** binutils to release 2.9.1 or newer. Another option is to modify *** your PATH or compiler configuration so that the native linker is *** used, and then restart. EOF elif $LD --help 2>&1 | grep ': supported targets:.* elf' > /dev/null; then archive_cmds_F77='$CC -shared $libobjs $deplibs $compiler_flags ${wl}-soname $wl$soname -o $lib' archive_expsym_cmds_F77='$CC -shared $libobjs $deplibs $compiler_flags ${wl}-soname $wl$soname ${wl}-retain-symbols-file $wl$export_symbols -o $lib' else ld_shlibs_F77=no fi ;; sunos4*) archive_cmds_F77='$LD -assert pure-text -Bshareable -o $lib $libobjs $deplibs $linker_flags' wlarc= hardcode_direct_F77=yes hardcode_shlibpath_var_F77=no ;; linux*) if $LD --help 2>&1 | grep ': supported targets:.* elf' > /dev/null; then tmp_archive_cmds='$CC -shared $libobjs $deplibs $compiler_flags ${wl}-soname $wl$soname -o $lib' archive_cmds_F77="$tmp_archive_cmds" supports_anon_versioning=no case `$LD -v 2>/dev/null` in *\ 01.* | *\ 2.[0-9].* | *\ 2.10.*) ;; # catch versions < 2.11 *\ 2.11.93.0.2\ *) supports_anon_versioning=yes ;; # RH7.3 ... *\ 2.11.92.0.12\ *) supports_anon_versioning=yes ;; # Mandrake 8.2 ... *\ 2.11.*) ;; # other 2.11 versions *) supports_anon_versioning=yes ;; esac if test $supports_anon_versioning = yes; then archive_expsym_cmds_F77='$echo "{ global:" > $output_objdir/$libname.ver~ cat $export_symbols | sed -e "s/\(.*\)/\1;/" >> $output_objdir/$libname.ver~ $echo "local: *; };" >> $output_objdir/$libname.ver~ $CC -shared $libobjs $deplibs $compiler_flags ${wl}-soname $wl$soname ${wl}-version-script ${wl}$output_objdir/$libname.ver -o $lib' else archive_expsym_cmds_F77="$tmp_archive_cmds" fi else ld_shlibs_F77=no fi ;; *) if $LD --help 2>&1 | grep ': supported targets:.* elf' > /dev/null; then archive_cmds_F77='$CC -shared $libobjs $deplibs $compiler_flags ${wl}-soname $wl$soname -o $lib' archive_expsym_cmds_F77='$CC -shared $libobjs $deplibs $compiler_flags ${wl}-soname $wl$soname ${wl}-retain-symbols-file $wl$export_symbols -o $lib' else ld_shlibs_F77=no fi ;; esac if test "$ld_shlibs_F77" = yes; then runpath_var=LD_RUN_PATH hardcode_libdir_flag_spec_F77='${wl}--rpath ${wl}$libdir' export_dynamic_flag_spec_F77='${wl}--export-dynamic' # ancient GNU ld didn't support --whole-archive et. al. if $LD --help 2>&1 | grep 'no-whole-archive' > /dev/null; then whole_archive_flag_spec_F77="$wlarc"'--whole-archive$convenience '"$wlarc"'--no-whole-archive' else whole_archive_flag_spec_F77= fi fi else # PORTME fill in a description of your system's linker (not GNU ld) case $host_os in aix3*) allow_undefined_flag_F77=unsupported always_export_symbols_F77=yes archive_expsym_cmds_F77='$LD -o $output_objdir/$soname $libobjs $deplibs $linker_flags -bE:$export_symbols -T512 -H512 -bM:SRE~$AR $AR_FLAGS $lib $output_objdir/$soname' # Note: this linker hardcodes the directories in LIBPATH if there # are no directories specified by -L. hardcode_minus_L_F77=yes if test "$GCC" = yes && test -z "$link_static_flag"; then # Neither direct hardcoding nor static linking is supported with a # broken collect2. hardcode_direct_F77=unsupported fi ;; aix4* | aix5*) if test "$host_cpu" = ia64; then # On IA64, the linker does run time linking by default, so we don't # have to do anything special. aix_use_runtimelinking=no exp_sym_flag='-Bexport' no_entry_flag="" else # If we're using GNU nm, then we don't want the "-C" option. # -C means demangle to AIX nm, but means don't demangle with GNU nm if $NM -V 2>&1 | grep 'GNU' > /dev/null; then export_symbols_cmds_F77='$NM -Bpg $libobjs $convenience | awk '\''{ if (((\$2 == "T") || (\$2 == "D") || (\$2 == "B")) && (substr(\$3,1,1) != ".")) { print \$3 } }'\'' | sort -u > $export_symbols' else export_symbols_cmds_F77='$NM -BCpg $libobjs $convenience | awk '\''{ if (((\$2 == "T") || (\$2 == "D") || (\$2 == "B")) && (substr(\$3,1,1) != ".")) { print \$3 } }'\'' | sort -u > $export_symbols' fi aix_use_runtimelinking=no # Test if we are trying to use run time linking or normal # AIX style linking. If -brtl is somewhere in LDFLAGS, we # need to do runtime linking. case $host_os in aix4.[23]|aix4.[23].*|aix5*) for ld_flag in $LDFLAGS; do if (test $ld_flag = "-brtl" || test $ld_flag = "-Wl,-brtl"); then aix_use_runtimelinking=yes break fi done esac exp_sym_flag='-bexport' no_entry_flag='-bnoentry' fi # When large executables or shared objects are built, AIX ld can # have problems creating the table of contents. If linking a library # or program results in "error TOC overflow" add -mminimal-toc to # CXXFLAGS/CFLAGS for g++/gcc. In the cases where that is not # enough to fix the problem, add -Wl,-bbigtoc to LDFLAGS. archive_cmds_F77='' hardcode_direct_F77=yes hardcode_libdir_separator_F77=':' link_all_deplibs_F77=yes if test "$GCC" = yes; then case $host_os in aix4.012|aix4.012.*) # We only want to do this on AIX 4.2 and lower, the check # below for broken collect2 doesn't work under 4.3+ collect2name=`${CC} -print-prog-name=collect2` if test -f "$collect2name" && \ strings "$collect2name" | grep resolve_lib_name >/dev/null then # We have reworked collect2 hardcode_direct_F77=yes else # We have old collect2 hardcode_direct_F77=unsupported # It fails to find uninstalled libraries when the uninstalled # path is not listed in the libpath. Setting hardcode_minus_L # to unsupported forces relinking hardcode_minus_L_F77=yes hardcode_libdir_flag_spec_F77='-L$libdir' hardcode_libdir_separator_F77= fi esac shared_flag='-shared' else # not using gcc if test "$host_cpu" = ia64; then # VisualAge C++, Version 5.5 for AIX 5L for IA-64, Beta 3 Release # chokes on -Wl,-G. The following line is correct: shared_flag='-G' else if test "$aix_use_runtimelinking" = yes; then shared_flag='${wl}-G' else shared_flag='${wl}-bM:SRE' fi fi fi # It seems that -bexpall does not export symbols beginning with # underscore (_), so it is better to generate a list of symbols to export. always_export_symbols_F77=yes if test "$aix_use_runtimelinking" = yes; then # Warning - without using the other runtime loading flags (-brtl), # -berok will link without error, but may produce a broken library. allow_undefined_flag_F77='-berok' # Determine the default libpath from the value encoded in an empty executable. cat >conftest.$ac_ext <<_ACEOF program main end _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_f77_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then aix_libpath=`dump -H conftest$ac_exeext 2>/dev/null | $SED -n -e '/Import File Strings/,/^$/ { /^0/ { s/^0 *\(.*\)$/\1/; p; } }'` # Check for a 64-bit object if we didn't find anything. if test -z "$aix_libpath"; then aix_libpath=`dump -HX64 conftest$ac_exeext 2>/dev/null | $SED -n -e '/Import File Strings/,/^$/ { /^0/ { s/^0 *\(.*\)$/\1/; p; } }'`; fi else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 fi rm -f conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext if test -z "$aix_libpath"; then aix_libpath="/usr/lib:/lib"; fi hardcode_libdir_flag_spec_F77='${wl}-blibpath:$libdir:'"$aix_libpath" archive_expsym_cmds_F77="\$CC"' -o $output_objdir/$soname $libobjs $deplibs $compiler_flags `if test "x${allow_undefined_flag}" != "x"; then echo "${wl}${allow_undefined_flag}"; else :; fi` '"\${wl}$no_entry_flag \${wl}$exp_sym_flag:\$export_symbols $shared_flag" else if test "$host_cpu" = ia64; then hardcode_libdir_flag_spec_F77='${wl}-R $libdir:/usr/lib:/lib' allow_undefined_flag_F77="-z nodefs" archive_expsym_cmds_F77="\$CC $shared_flag"' -o $output_objdir/$soname $libobjs $deplibs $compiler_flags ${wl}${allow_undefined_flag} '"\${wl}$no_entry_flag \${wl}$exp_sym_flag:\$export_symbols" else # Determine the default libpath from the value encoded in an empty executable. cat >conftest.$ac_ext <<_ACEOF program main end _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_f77_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then aix_libpath=`dump -H conftest$ac_exeext 2>/dev/null | $SED -n -e '/Import File Strings/,/^$/ { /^0/ { s/^0 *\(.*\)$/\1/; p; } }'` # Check for a 64-bit object if we didn't find anything. if test -z "$aix_libpath"; then aix_libpath=`dump -HX64 conftest$ac_exeext 2>/dev/null | $SED -n -e '/Import File Strings/,/^$/ { /^0/ { s/^0 *\(.*\)$/\1/; p; } }'`; fi else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 fi rm -f conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext if test -z "$aix_libpath"; then aix_libpath="/usr/lib:/lib"; fi hardcode_libdir_flag_spec_F77='${wl}-blibpath:$libdir:'"$aix_libpath" # Warning - without using the other run time loading flags, # -berok will link without error, but may produce a broken library. no_undefined_flag_F77=' ${wl}-bernotok' allow_undefined_flag_F77=' ${wl}-berok' # -bexpall does not export symbols beginning with underscore (_) always_export_symbols_F77=yes # Exported symbols can be pulled into shared objects from archives whole_archive_flag_spec_F77=' ' archive_cmds_need_lc_F77=yes # This is similar to how AIX traditionally builds it's shared libraries. archive_expsym_cmds_F77="\$CC $shared_flag"' -o $output_objdir/$soname $libobjs $deplibs $compiler_flags ${wl}-bE:$export_symbols ${wl}-bnoentry${allow_undefined_flag}~$AR $AR_FLAGS $output_objdir/$libname$release.a $output_objdir/$soname' fi fi ;; amigaos*) archive_cmds_F77='$rm $output_objdir/a2ixlibrary.data~$echo "#define NAME $libname" > $output_objdir/a2ixlibrary.data~$echo "#define LIBRARY_ID 1" >> $output_objdir/a2ixlibrary.data~$echo "#define VERSION $major" >> $output_objdir/a2ixlibrary.data~$echo "#define REVISION $revision" >> $output_objdir/a2ixlibrary.data~$AR $AR_FLAGS $lib $libobjs~$RANLIB $lib~(cd $output_objdir && a2ixlibrary -32)' hardcode_libdir_flag_spec_F77='-L$libdir' hardcode_minus_L_F77=yes # see comment about different semantics on the GNU ld section ld_shlibs_F77=no ;; bsdi[45]*) export_dynamic_flag_spec_F77=-rdynamic ;; cygwin* | mingw* | pw32*) # When not using gcc, we currently assume that we are using # Microsoft Visual C++. # hardcode_libdir_flag_spec is actually meaningless, as there is # no search path for DLLs. hardcode_libdir_flag_spec_F77=' ' allow_undefined_flag_F77=unsupported # Tell ltmain to make .lib files, not .a files. libext=lib # Tell ltmain to make .dll files, not .so files. shrext_cmds=".dll" # FIXME: Setting linknames here is a bad hack. archive_cmds_F77='$CC -o $lib $libobjs $compiler_flags `echo "$deplibs" | $SED -e '\''s/ -lc$//'\''` -link -dll~linknames=' # The linker will automatically build a .lib file if we build a DLL. old_archive_From_new_cmds_F77='true' # FIXME: Should let the user specify the lib program. old_archive_cmds_F77='lib /OUT:$oldlib$oldobjs$old_deplibs' fix_srcfile_path='`cygpath -w "$srcfile"`' enable_shared_with_static_runtimes_F77=yes ;; darwin* | rhapsody*) case "$host_os" in rhapsody* | darwin1.[012]) allow_undefined_flag_F77='${wl}-undefined ${wl}suppress' ;; *) # Darwin 1.3 on if test -z ${MACOSX_DEPLOYMENT_TARGET} ; then allow_undefined_flag_F77='${wl}-flat_namespace ${wl}-undefined ${wl}suppress' else case ${MACOSX_DEPLOYMENT_TARGET} in 10.[012]) allow_undefined_flag_F77='${wl}-flat_namespace ${wl}-undefined ${wl}suppress' ;; 10.*) allow_undefined_flag_F77='${wl}-undefined ${wl}dynamic_lookup' ;; esac fi ;; esac archive_cmds_need_lc_F77=no hardcode_direct_F77=no hardcode_automatic_F77=yes hardcode_shlibpath_var_F77=unsupported whole_archive_flag_spec_F77='' link_all_deplibs_F77=yes if test "$GCC" = yes ; then output_verbose_link_cmd='echo' archive_cmds_F77='$CC -dynamiclib $allow_undefined_flag -o $lib $libobjs $deplibs $compiler_flags -install_name $rpath/$soname $verstring' module_cmds_F77='$CC $allow_undefined_flag -o $lib -bundle $libobjs $deplibs$compiler_flags' # Don't fix this by using the ld -exported_symbols_list flag, it doesn't exist in older darwin ld's archive_expsym_cmds_F77='sed -e "s,#.*,," -e "s,^[ ]*,," -e "s,^\(..*\),_&," < $export_symbols > $output_objdir/${libname}-symbols.expsym~$CC -dynamiclib $allow_undefined_flag -o $lib $libobjs $deplibs $compiler_flags -install_name $rpath/$soname $verstring~nmedit -s $output_objdir/${libname}-symbols.expsym ${lib}' module_expsym_cmds_F77='sed -e "s,#.*,," -e "s,^[ ]*,," -e "s,^\(..*\),_&," < $export_symbols > $output_objdir/${libname}-symbols.expsym~$CC $allow_undefined_flag -o $lib -bundle $libobjs $deplibs$compiler_flags~nmedit -s $output_objdir/${libname}-symbols.expsym ${lib}' else case "$cc_basename" in xlc*) output_verbose_link_cmd='echo' archive_cmds_F77='$CC -qmkshrobj $allow_undefined_flag -o $lib $libobjs $deplibs $compiler_flags ${wl}-install_name ${wl}`echo $rpath/$soname` $verstring' module_cmds_F77='$CC $allow_undefined_flag -o $lib -bundle $libobjs $deplibs$compiler_flags' # Don't fix this by using the ld -exported_symbols_list flag, it doesn't exist in older darwin ld's archive_expsym_cmds_F77='sed -e "s,#.*,," -e "s,^[ ]*,," -e "s,^\(..*\),_&," < $export_symbols > $output_objdir/${libname}-symbols.expsym~$CC -qmkshrobj $allow_undefined_flag -o $lib $libobjs $deplibs $compiler_flags ${wl}-install_name ${wl}$rpath/$soname $verstring~nmedit -s $output_objdir/${libname}-symbols.expsym ${lib}' module_expsym_cmds_F77='sed -e "s,#.*,," -e "s,^[ ]*,," -e "s,^\(..*\),_&," < $export_symbols > $output_objdir/${libname}-symbols.expsym~$CC $allow_undefined_flag -o $lib -bundle $libobjs $deplibs$compiler_flags~nmedit -s $output_objdir/${libname}-symbols.expsym ${lib}' ;; *) ld_shlibs_F77=no ;; esac fi ;; dgux*) archive_cmds_F77='$LD -G -h $soname -o $lib $libobjs $deplibs $linker_flags' hardcode_libdir_flag_spec_F77='-L$libdir' hardcode_shlibpath_var_F77=no ;; freebsd1*) ld_shlibs_F77=no ;; # FreeBSD 2.2.[012] allows us to include c++rt0.o to get C++ constructor # support. Future versions do this automatically, but an explicit c++rt0.o # does not break anything, and helps significantly (at the cost of a little # extra space). freebsd2.2*) archive_cmds_F77='$LD -Bshareable -o $lib $libobjs $deplibs $linker_flags /usr/lib/c++rt0.o' hardcode_libdir_flag_spec_F77='-R$libdir' hardcode_direct_F77=yes hardcode_shlibpath_var_F77=no ;; # Unfortunately, older versions of FreeBSD 2 do not have this feature. freebsd2*) archive_cmds_F77='$LD -Bshareable -o $lib $libobjs $deplibs $linker_flags' hardcode_direct_F77=yes hardcode_minus_L_F77=yes hardcode_shlibpath_var_F77=no ;; # FreeBSD 3 and greater uses gcc -shared to do shared libraries. freebsd* | kfreebsd*-gnu) archive_cmds_F77='$CC -shared -o $lib $libobjs $deplibs $compiler_flags' hardcode_libdir_flag_spec_F77='-R$libdir' hardcode_direct_F77=yes hardcode_shlibpath_var_F77=no ;; hpux9*) if test "$GCC" = yes; then archive_cmds_F77='$rm $output_objdir/$soname~$CC -shared -fPIC ${wl}+b ${wl}$install_libdir -o $output_objdir/$soname $libobjs $deplibs $compiler_flags~test $output_objdir/$soname = $lib || mv $output_objdir/$soname $lib' else archive_cmds_F77='$rm $output_objdir/$soname~$LD -b +b $install_libdir -o $output_objdir/$soname $libobjs $deplibs $linker_flags~test $output_objdir/$soname = $lib || mv $output_objdir/$soname $lib' fi hardcode_libdir_flag_spec_F77='${wl}+b ${wl}$libdir' hardcode_libdir_separator_F77=: hardcode_direct_F77=yes # hardcode_minus_L: Not really in the search PATH, # but as the default location of the library. hardcode_minus_L_F77=yes export_dynamic_flag_spec_F77='${wl}-E' ;; hpux10* | hpux11*) if test "$GCC" = yes -a "$with_gnu_ld" = no; then case "$host_cpu" in hppa*64*|ia64*) archive_cmds_F77='$CC -shared ${wl}+h ${wl}$soname -o $lib $libobjs $deplibs $compiler_flags' ;; *) archive_cmds_F77='$CC -shared -fPIC ${wl}+h ${wl}$soname ${wl}+b ${wl}$install_libdir -o $lib $libobjs $deplibs $compiler_flags' ;; esac else case "$host_cpu" in hppa*64*|ia64*) archive_cmds_F77='$LD -b +h $soname -o $lib $libobjs $deplibs $linker_flags' ;; *) archive_cmds_F77='$LD -b +h $soname +b $install_libdir -o $lib $libobjs $deplibs $linker_flags' ;; esac fi if test "$with_gnu_ld" = no; then case "$host_cpu" in hppa*64*) hardcode_libdir_flag_spec_F77='${wl}+b ${wl}$libdir' hardcode_libdir_flag_spec_ld_F77='+b $libdir' hardcode_libdir_separator_F77=: hardcode_direct_F77=no hardcode_shlibpath_var_F77=no ;; ia64*) hardcode_libdir_flag_spec_F77='-L$libdir' hardcode_direct_F77=no hardcode_shlibpath_var_F77=no # hardcode_minus_L: Not really in the search PATH, # but as the default location of the library. hardcode_minus_L_F77=yes ;; *) hardcode_libdir_flag_spec_F77='${wl}+b ${wl}$libdir' hardcode_libdir_separator_F77=: hardcode_direct_F77=yes export_dynamic_flag_spec_F77='${wl}-E' # hardcode_minus_L: Not really in the search PATH, # but as the default location of the library. hardcode_minus_L_F77=yes ;; esac fi ;; irix5* | irix6* | nonstopux*) if test "$GCC" = yes; then archive_cmds_F77='$CC -shared $libobjs $deplibs $compiler_flags ${wl}-soname ${wl}$soname `test -n "$verstring" && echo ${wl}-set_version ${wl}$verstring` ${wl}-update_registry ${wl}${output_objdir}/so_locations -o $lib' else archive_cmds_F77='$LD -shared $libobjs $deplibs $linker_flags -soname $soname `test -n "$verstring" && echo -set_version $verstring` -update_registry ${output_objdir}/so_locations -o $lib' hardcode_libdir_flag_spec_ld_F77='-rpath $libdir' fi hardcode_libdir_flag_spec_F77='${wl}-rpath ${wl}$libdir' hardcode_libdir_separator_F77=: link_all_deplibs_F77=yes ;; netbsd*) if echo __ELF__ | $CC -E - | grep __ELF__ >/dev/null; then archive_cmds_F77='$LD -Bshareable -o $lib $libobjs $deplibs $linker_flags' # a.out else archive_cmds_F77='$LD -shared -o $lib $libobjs $deplibs $linker_flags' # ELF fi hardcode_libdir_flag_spec_F77='-R$libdir' hardcode_direct_F77=yes hardcode_shlibpath_var_F77=no ;; newsos6) archive_cmds_F77='$LD -G -h $soname -o $lib $libobjs $deplibs $linker_flags' hardcode_direct_F77=yes hardcode_libdir_flag_spec_F77='${wl}-rpath ${wl}$libdir' hardcode_libdir_separator_F77=: hardcode_shlibpath_var_F77=no ;; openbsd*) hardcode_direct_F77=yes hardcode_shlibpath_var_F77=no if test -z "`echo __ELF__ | $CC -E - | grep __ELF__`" || test "$host_os-$host_cpu" = "openbsd2.8-powerpc"; then archive_cmds_F77='$CC -shared $pic_flag -o $lib $libobjs $deplibs $compiler_flags' archive_expsym_cmds_F77='$CC -shared $pic_flag -o $lib $libobjs $deplibs $compiler_flags ${wl}-retain-symbols-file,$export_symbols' hardcode_libdir_flag_spec_F77='${wl}-rpath,$libdir' export_dynamic_flag_spec_F77='${wl}-E' else case $host_os in openbsd[01].* | openbsd2.[0-7] | openbsd2.[0-7].*) archive_cmds_F77='$LD -Bshareable -o $lib $libobjs $deplibs $linker_flags' hardcode_libdir_flag_spec_F77='-R$libdir' ;; *) archive_cmds_F77='$CC -shared $pic_flag -o $lib $libobjs $deplibs $compiler_flags' hardcode_libdir_flag_spec_F77='${wl}-rpath,$libdir' ;; esac fi ;; os2*) hardcode_libdir_flag_spec_F77='-L$libdir' hardcode_minus_L_F77=yes allow_undefined_flag_F77=unsupported archive_cmds_F77='$echo "LIBRARY $libname INITINSTANCE" > $output_objdir/$libname.def~$echo "DESCRIPTION \"$libname\"" >> $output_objdir/$libname.def~$echo DATA >> $output_objdir/$libname.def~$echo " SINGLE NONSHARED" >> $output_objdir/$libname.def~$echo EXPORTS >> $output_objdir/$libname.def~emxexp $libobjs >> $output_objdir/$libname.def~$CC -Zdll -Zcrtdll -o $lib $libobjs $deplibs $compiler_flags $output_objdir/$libname.def' old_archive_From_new_cmds_F77='emximp -o $output_objdir/$libname.a $output_objdir/$libname.def' ;; osf3*) if test "$GCC" = yes; then allow_undefined_flag_F77=' ${wl}-expect_unresolved ${wl}\*' archive_cmds_F77='$CC -shared${allow_undefined_flag} $libobjs $deplibs $compiler_flags ${wl}-soname ${wl}$soname `test -n "$verstring" && echo ${wl}-set_version ${wl}$verstring` ${wl}-update_registry ${wl}${output_objdir}/so_locations -o $lib' else allow_undefined_flag_F77=' -expect_unresolved \*' archive_cmds_F77='$LD -shared${allow_undefined_flag} $libobjs $deplibs $linker_flags -soname $soname `test -n "$verstring" && echo -set_version $verstring` -update_registry ${output_objdir}/so_locations -o $lib' fi hardcode_libdir_flag_spec_F77='${wl}-rpath ${wl}$libdir' hardcode_libdir_separator_F77=: ;; osf4* | osf5*) # as osf3* with the addition of -msym flag if test "$GCC" = yes; then allow_undefined_flag_F77=' ${wl}-expect_unresolved ${wl}\*' archive_cmds_F77='$CC -shared${allow_undefined_flag} $libobjs $deplibs $compiler_flags ${wl}-msym ${wl}-soname ${wl}$soname `test -n "$verstring" && echo ${wl}-set_version ${wl}$verstring` ${wl}-update_registry ${wl}${output_objdir}/so_locations -o $lib' hardcode_libdir_flag_spec_F77='${wl}-rpath ${wl}$libdir' else allow_undefined_flag_F77=' -expect_unresolved \*' archive_cmds_F77='$LD -shared${allow_undefined_flag} $libobjs $deplibs $linker_flags -msym -soname $soname `test -n "$verstring" && echo -set_version $verstring` -update_registry ${output_objdir}/so_locations -o $lib' archive_expsym_cmds_F77='for i in `cat $export_symbols`; do printf "%s %s\\n" -exported_symbol "\$i" >> $lib.exp; done; echo "-hidden">> $lib.exp~ $LD -shared${allow_undefined_flag} -input $lib.exp $linker_flags $libobjs $deplibs -soname $soname `test -n "$verstring" && echo -set_version $verstring` -update_registry ${objdir}/so_locations -o $lib~$rm $lib.exp' # Both c and cxx compiler support -rpath directly hardcode_libdir_flag_spec_F77='-rpath $libdir' fi hardcode_libdir_separator_F77=: ;; sco3.2v5*) archive_cmds_F77='$LD -G -h $soname -o $lib $libobjs $deplibs $linker_flags' hardcode_shlibpath_var_F77=no export_dynamic_flag_spec_F77='${wl}-Bexport' runpath_var=LD_RUN_PATH hardcode_runpath_var=yes ;; solaris*) no_undefined_flag_F77=' -z text' if test "$GCC" = yes; then archive_cmds_F77='$CC -shared ${wl}-h ${wl}$soname -o $lib $libobjs $deplibs $compiler_flags' archive_expsym_cmds_F77='$echo "{ global:" > $lib.exp~cat $export_symbols | $SED -e "s/\(.*\)/\1;/" >> $lib.exp~$echo "local: *; };" >> $lib.exp~ $CC -shared ${wl}-M ${wl}$lib.exp ${wl}-h ${wl}$soname -o $lib $libobjs $deplibs $compiler_flags~$rm $lib.exp' else archive_cmds_F77='$LD -G${allow_undefined_flag} -h $soname -o $lib $libobjs $deplibs $linker_flags' archive_expsym_cmds_F77='$echo "{ global:" > $lib.exp~cat $export_symbols | $SED -e "s/\(.*\)/\1;/" >> $lib.exp~$echo "local: *; };" >> $lib.exp~ $LD -G${allow_undefined_flag} -M $lib.exp -h $soname -o $lib $libobjs $deplibs $linker_flags~$rm $lib.exp' fi hardcode_libdir_flag_spec_F77='-R$libdir' hardcode_shlibpath_var_F77=no case $host_os in solaris2.[0-5] | solaris2.[0-5].*) ;; *) # Supported since Solaris 2.6 (maybe 2.5.1?) whole_archive_flag_spec_F77='-z allextract$convenience -z defaultextract' ;; esac link_all_deplibs_F77=yes ;; sunos4*) if test "x$host_vendor" = xsequent; then # Use $CC to link under sequent, because it throws in some extra .o # files that make .init and .fini sections work. archive_cmds_F77='$CC -G ${wl}-h $soname -o $lib $libobjs $deplibs $compiler_flags' else archive_cmds_F77='$LD -assert pure-text -Bstatic -o $lib $libobjs $deplibs $linker_flags' fi hardcode_libdir_flag_spec_F77='-L$libdir' hardcode_direct_F77=yes hardcode_minus_L_F77=yes hardcode_shlibpath_var_F77=no ;; sysv4) case $host_vendor in sni) archive_cmds_F77='$LD -G -h $soname -o $lib $libobjs $deplibs $linker_flags' hardcode_direct_F77=yes # is this really true??? ;; siemens) ## LD is ld it makes a PLAMLIB ## CC just makes a GrossModule. archive_cmds_F77='$LD -G -o $lib $libobjs $deplibs $linker_flags' reload_cmds_F77='$CC -r -o $output$reload_objs' hardcode_direct_F77=no ;; motorola) archive_cmds_F77='$LD -G -h $soname -o $lib $libobjs $deplibs $linker_flags' hardcode_direct_F77=no #Motorola manual says yes, but my tests say they lie ;; esac runpath_var='LD_RUN_PATH' hardcode_shlibpath_var_F77=no ;; sysv4.3*) archive_cmds_F77='$LD -G -h $soname -o $lib $libobjs $deplibs $linker_flags' hardcode_shlibpath_var_F77=no export_dynamic_flag_spec_F77='-Bexport' ;; sysv4*MP*) if test -d /usr/nec; then archive_cmds_F77='$LD -G -h $soname -o $lib $libobjs $deplibs $linker_flags' hardcode_shlibpath_var_F77=no runpath_var=LD_RUN_PATH hardcode_runpath_var=yes ld_shlibs_F77=yes fi ;; sysv4.2uw2*) archive_cmds_F77='$LD -G -o $lib $libobjs $deplibs $linker_flags' hardcode_direct_F77=yes hardcode_minus_L_F77=no hardcode_shlibpath_var_F77=no hardcode_runpath_var=yes runpath_var=LD_RUN_PATH ;; sysv5OpenUNIX8* | sysv5UnixWare7* | sysv5uw[78]* | unixware7*) no_undefined_flag_F77='${wl}-z ${wl}text' if test "$GCC" = yes; then archive_cmds_F77='$CC -shared ${wl}-h ${wl}$soname -o $lib $libobjs $deplibs $compiler_flags' else archive_cmds_F77='$CC -G ${wl}-h ${wl}$soname -o $lib $libobjs $deplibs $compiler_flags' fi runpath_var='LD_RUN_PATH' hardcode_shlibpath_var_F77=no ;; sysv5*) no_undefined_flag_F77=' -z text' # $CC -shared without GNU ld will not create a library from C++ # object files and a static libstdc++, better avoid it by now archive_cmds_F77='$LD -G${allow_undefined_flag} -h $soname -o $lib $libobjs $deplibs $linker_flags' archive_expsym_cmds_F77='$echo "{ global:" > $lib.exp~cat $export_symbols | $SED -e "s/\(.*\)/\1;/" >> $lib.exp~$echo "local: *; };" >> $lib.exp~ $LD -G${allow_undefined_flag} -M $lib.exp -h $soname -o $lib $libobjs $deplibs $linker_flags~$rm $lib.exp' hardcode_libdir_flag_spec_F77= hardcode_shlibpath_var_F77=no runpath_var='LD_RUN_PATH' ;; uts4*) archive_cmds_F77='$LD -G -h $soname -o $lib $libobjs $deplibs $linker_flags' hardcode_libdir_flag_spec_F77='-L$libdir' hardcode_shlibpath_var_F77=no ;; *) ld_shlibs_F77=no ;; esac fi echo "$as_me:$LINENO: result: $ld_shlibs_F77" >&5 echo "${ECHO_T}$ld_shlibs_F77" >&6 test "$ld_shlibs_F77" = no && can_build_shared=no variables_saved_for_relink="PATH $shlibpath_var $runpath_var" if test "$GCC" = yes; then variables_saved_for_relink="$variables_saved_for_relink GCC_EXEC_PREFIX COMPILER_PATH LIBRARY_PATH" fi # # Do we need to explicitly link libc? # case "x$archive_cmds_need_lc_F77" in x|xyes) # Assume -lc should be added archive_cmds_need_lc_F77=yes if test "$enable_shared" = yes && test "$GCC" = yes; then case $archive_cmds_F77 in *'~'*) # FIXME: we may have to deal with multi-command sequences. ;; '$CC '*) # Test whether the compiler implicitly links with -lc since on some # systems, -lgcc has to come before -lc. If gcc already passes -lc # to ld, don't add -lc before -lgcc. echo "$as_me:$LINENO: checking whether -lc should be explicitly linked in" >&5 echo $ECHO_N "checking whether -lc should be explicitly linked in... $ECHO_C" >&6 $rm conftest* printf "$lt_simple_compile_test_code" > conftest.$ac_ext if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5 (eval $ac_compile) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } 2>conftest.err; then soname=conftest lib=conftest libobjs=conftest.$ac_objext deplibs= wl=$lt_prog_compiler_wl_F77 compiler_flags=-v linker_flags=-v verstring= output_objdir=. libname=conftest lt_save_allow_undefined_flag=$allow_undefined_flag_F77 allow_undefined_flag_F77= if { (eval echo "$as_me:$LINENO: \"$archive_cmds_F77 2\>\&1 \| grep \" -lc \" \>/dev/null 2\>\&1\"") >&5 (eval $archive_cmds_F77 2\>\&1 \| grep \" -lc \" \>/dev/null 2\>\&1) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } then archive_cmds_need_lc_F77=no else archive_cmds_need_lc_F77=yes fi allow_undefined_flag_F77=$lt_save_allow_undefined_flag else cat conftest.err 1>&5 fi $rm conftest* echo "$as_me:$LINENO: result: $archive_cmds_need_lc_F77" >&5 echo "${ECHO_T}$archive_cmds_need_lc_F77" >&6 ;; esac fi ;; esac echo "$as_me:$LINENO: checking dynamic linker characteristics" >&5 echo $ECHO_N "checking dynamic linker characteristics... $ECHO_C" >&6 library_names_spec= libname_spec='lib$name' soname_spec= shrext_cmds=".so" postinstall_cmds= postuninstall_cmds= finish_cmds= finish_eval= shlibpath_var= shlibpath_overrides_runpath=unknown version_type=none dynamic_linker="$host_os ld.so" sys_lib_dlsearch_path_spec="/lib /usr/lib" if test "$GCC" = yes; then sys_lib_search_path_spec=`$CC -print-search-dirs | grep "^libraries:" | $SED -e "s/^libraries://" -e "s,=/,/,g"` if echo "$sys_lib_search_path_spec" | grep ';' >/dev/null ; then # if the path contains ";" then we assume it to be the separator # otherwise default to the standard path separator (i.e. ":") - it is # assumed that no part of a normal pathname contains ";" but that should # okay in the real world where ";" in dirpaths is itself problematic. sys_lib_search_path_spec=`echo "$sys_lib_search_path_spec" | $SED -e 's/;/ /g'` else sys_lib_search_path_spec=`echo "$sys_lib_search_path_spec" | $SED -e "s/$PATH_SEPARATOR/ /g"` fi else sys_lib_search_path_spec="/lib /usr/lib /usr/local/lib" fi need_lib_prefix=unknown hardcode_into_libs=no # when you set need_version to no, make sure it does not cause -set_version # flags to be left without arguments need_version=unknown case $host_os in aix3*) version_type=linux library_names_spec='${libname}${release}${shared_ext}$versuffix $libname.a' shlibpath_var=LIBPATH # AIX 3 has no versioning support, so we append a major version to the name. soname_spec='${libname}${release}${shared_ext}$major' ;; aix4* | aix5*) version_type=linux need_lib_prefix=no need_version=no hardcode_into_libs=yes if test "$host_cpu" = ia64; then # AIX 5 supports IA64 library_names_spec='${libname}${release}${shared_ext}$major ${libname}${release}${shared_ext}$versuffix $libname${shared_ext}' shlibpath_var=LD_LIBRARY_PATH else # With GCC up to 2.95.x, collect2 would create an import file # for dependence libraries. The import file would start with # the line `#! .'. This would cause the generated library to # depend on `.', always an invalid library. This was fixed in # development snapshots of GCC prior to 3.0. case $host_os in aix4 | aix4.[01] | aix4.[01].*) if { echo '#if __GNUC__ > 2 || (__GNUC__ == 2 && __GNUC_MINOR__ >= 97)' echo ' yes ' echo '#endif'; } | ${CC} -E - | grep yes > /dev/null; then : else can_build_shared=no fi ;; esac # AIX (on Power*) has no versioning support, so currently we can not hardcode correct # soname into executable. Probably we can add versioning support to # collect2, so additional links can be useful in future. if test "$aix_use_runtimelinking" = yes; then # If using run time linking (on AIX 4.2 or later) use lib.so # instead of lib.a to let people know that these are not # typical AIX shared libraries. library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' else # We preserve .a as extension for shared libraries through AIX4.2 # and later when we are not doing run time linking. library_names_spec='${libname}${release}.a $libname.a' soname_spec='${libname}${release}${shared_ext}$major' fi shlibpath_var=LIBPATH fi ;; amigaos*) library_names_spec='$libname.ixlibrary $libname.a' # Create ${libname}_ixlibrary.a entries in /sys/libs. finish_eval='for lib in `ls $libdir/*.ixlibrary 2>/dev/null`; do libname=`$echo "X$lib" | $Xsed -e '\''s%^.*/\([^/]*\)\.ixlibrary$%\1%'\''`; test $rm /sys/libs/${libname}_ixlibrary.a; $show "cd /sys/libs && $LN_S $lib ${libname}_ixlibrary.a"; cd /sys/libs && $LN_S $lib ${libname}_ixlibrary.a || exit 1; done' ;; beos*) library_names_spec='${libname}${shared_ext}' dynamic_linker="$host_os ld.so" shlibpath_var=LIBRARY_PATH ;; bsdi[45]*) version_type=linux need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' finish_cmds='PATH="\$PATH:/sbin" ldconfig $libdir' shlibpath_var=LD_LIBRARY_PATH sys_lib_search_path_spec="/shlib /usr/lib /usr/X11/lib /usr/contrib/lib /lib /usr/local/lib" sys_lib_dlsearch_path_spec="/shlib /usr/lib /usr/local/lib" # the default ld.so.conf also contains /usr/contrib/lib and # /usr/X11R6/lib (/usr/X11 is a link to /usr/X11R6), but let us allow # libtool to hard-code these into programs ;; cygwin* | mingw* | pw32*) version_type=windows shrext_cmds=".dll" need_version=no need_lib_prefix=no case $GCC,$host_os in yes,cygwin* | yes,mingw* | yes,pw32*) library_names_spec='$libname.dll.a' # DLL is installed to $(libdir)/../bin by postinstall_cmds postinstall_cmds='base_file=`basename \${file}`~ dlpath=`$SHELL 2>&1 -c '\''. $dir/'\''\${base_file}'\''i;echo \$dlname'\''`~ dldir=$destdir/`dirname \$dlpath`~ test -d \$dldir || mkdir -p \$dldir~ $install_prog $dir/$dlname \$dldir/$dlname' postuninstall_cmds='dldll=`$SHELL 2>&1 -c '\''. $file; echo \$dlname'\''`~ dlpath=$dir/\$dldll~ $rm \$dlpath' shlibpath_overrides_runpath=yes case $host_os in cygwin*) # Cygwin DLLs use 'cyg' prefix rather than 'lib' soname_spec='`echo ${libname} | sed -e 's/^lib/cyg/'``echo ${release} | $SED -e 's/[.]/-/g'`${versuffix}${shared_ext}' sys_lib_search_path_spec="/usr/lib /lib/w32api /lib /usr/local/lib" ;; mingw*) # MinGW DLLs use traditional 'lib' prefix soname_spec='${libname}`echo ${release} | $SED -e 's/[.]/-/g'`${versuffix}${shared_ext}' sys_lib_search_path_spec=`$CC -print-search-dirs | grep "^libraries:" | $SED -e "s/^libraries://" -e "s,=/,/,g"` if echo "$sys_lib_search_path_spec" | grep ';[c-zC-Z]:/' >/dev/null; then # It is most probably a Windows format PATH printed by # mingw gcc, but we are running on Cygwin. Gcc prints its search # path with ; separators, and with drive letters. We can handle the # drive letters (cygwin fileutils understands them), so leave them, # especially as we might pass files found there to a mingw objdump, # which wouldn't understand a cygwinified path. Ahh. sys_lib_search_path_spec=`echo "$sys_lib_search_path_spec" | $SED -e 's/;/ /g'` else sys_lib_search_path_spec=`echo "$sys_lib_search_path_spec" | $SED -e "s/$PATH_SEPARATOR/ /g"` fi ;; pw32*) # pw32 DLLs use 'pw' prefix rather than 'lib' library_names_spec='`echo ${libname} | sed -e 's/^lib/pw/'``echo ${release} | $SED -e 's/./-/g'`${versuffix}${shared_ext}' ;; esac ;; *) library_names_spec='${libname}`echo ${release} | $SED -e 's/[.]/-/g'`${versuffix}${shared_ext} $libname.lib' ;; esac dynamic_linker='Win32 ld.exe' # FIXME: first we should search . and the directory the executable is in shlibpath_var=PATH ;; darwin* | rhapsody*) dynamic_linker="$host_os dyld" version_type=darwin need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${versuffix}$shared_ext ${libname}${release}${major}$shared_ext ${libname}$shared_ext' soname_spec='${libname}${release}${major}$shared_ext' shlibpath_overrides_runpath=yes shlibpath_var=DYLD_LIBRARY_PATH shrext_cmds='$(test .$module = .yes && echo .so || echo .dylib)' # Apple's gcc prints 'gcc -print-search-dirs' doesn't operate the same. if test "$GCC" = yes; then sys_lib_search_path_spec=`$CC -print-search-dirs | tr "\n" "$PATH_SEPARATOR" | sed -e 's/libraries:/@libraries:/' | tr "@" "\n" | grep "^libraries:" | sed -e "s/^libraries://" -e "s,=/,/,g" -e "s,$PATH_SEPARATOR, ,g" -e "s,.*,& /lib /usr/lib /usr/local/lib,g"` else sys_lib_search_path_spec='/lib /usr/lib /usr/local/lib' fi sys_lib_dlsearch_path_spec='/usr/local/lib /lib /usr/lib' ;; dgux*) version_type=linux need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname$shared_ext' soname_spec='${libname}${release}${shared_ext}$major' shlibpath_var=LD_LIBRARY_PATH ;; freebsd1*) dynamic_linker=no ;; kfreebsd*-gnu) version_type=linux need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major ${libname}${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=no hardcode_into_libs=yes dynamic_linker='GNU ld.so' ;; freebsd*) objformat=`test -x /usr/bin/objformat && /usr/bin/objformat || echo aout` version_type=freebsd-$objformat case $version_type in freebsd-elf*) library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext} $libname${shared_ext}' need_version=no need_lib_prefix=no ;; freebsd-*) library_names_spec='${libname}${release}${shared_ext}$versuffix $libname${shared_ext}$versuffix' need_version=yes ;; esac shlibpath_var=LD_LIBRARY_PATH case $host_os in freebsd2*) shlibpath_overrides_runpath=yes ;; freebsd3.01* | freebsdelf3.01*) shlibpath_overrides_runpath=yes hardcode_into_libs=yes ;; *) # from 3.2 on shlibpath_overrides_runpath=no hardcode_into_libs=yes ;; esac ;; gnu*) version_type=linux need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}${major} ${libname}${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' shlibpath_var=LD_LIBRARY_PATH hardcode_into_libs=yes ;; hpux9* | hpux10* | hpux11*) # Give a soname corresponding to the major version so that dld.sl refuses to # link against other versions. version_type=sunos need_lib_prefix=no need_version=no case "$host_cpu" in ia64*) shrext_cmds='.so' hardcode_into_libs=yes dynamic_linker="$host_os dld.so" shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=yes # Unless +noenvvar is specified. library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' if test "X$HPUX_IA64_MODE" = X32; then sys_lib_search_path_spec="/usr/lib/hpux32 /usr/local/lib/hpux32 /usr/local/lib" else sys_lib_search_path_spec="/usr/lib/hpux64 /usr/local/lib/hpux64" fi sys_lib_dlsearch_path_spec=$sys_lib_search_path_spec ;; hppa*64*) shrext_cmds='.sl' hardcode_into_libs=yes dynamic_linker="$host_os dld.sl" shlibpath_var=LD_LIBRARY_PATH # How should we handle SHLIB_PATH shlibpath_overrides_runpath=yes # Unless +noenvvar is specified. library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' sys_lib_search_path_spec="/usr/lib/pa20_64 /usr/ccs/lib/pa20_64" sys_lib_dlsearch_path_spec=$sys_lib_search_path_spec ;; *) shrext_cmds='.sl' dynamic_linker="$host_os dld.sl" shlibpath_var=SHLIB_PATH shlibpath_overrides_runpath=no # +s is required to enable SHLIB_PATH library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' ;; esac # HP-UX runs *really* slowly unless shared libraries are mode 555. postinstall_cmds='chmod 555 $lib' ;; irix5* | irix6* | nonstopux*) case $host_os in nonstopux*) version_type=nonstopux ;; *) if test "$lt_cv_prog_gnu_ld" = yes; then version_type=linux else version_type=irix fi ;; esac need_lib_prefix=no need_version=no soname_spec='${libname}${release}${shared_ext}$major' library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major ${libname}${release}${shared_ext} $libname${shared_ext}' case $host_os in irix5* | nonstopux*) libsuff= shlibsuff= ;; *) case $LD in # libtool.m4 will add one of these switches to LD *-32|*"-32 "|*-melf32bsmip|*"-melf32bsmip ") libsuff= shlibsuff= libmagic=32-bit;; *-n32|*"-n32 "|*-melf32bmipn32|*"-melf32bmipn32 ") libsuff=32 shlibsuff=N32 libmagic=N32;; *-64|*"-64 "|*-melf64bmip|*"-melf64bmip ") libsuff=64 shlibsuff=64 libmagic=64-bit;; *) libsuff= shlibsuff= libmagic=never-match;; esac ;; esac shlibpath_var=LD_LIBRARY${shlibsuff}_PATH shlibpath_overrides_runpath=no sys_lib_search_path_spec="/usr/lib${libsuff} /lib${libsuff} /usr/local/lib${libsuff}" sys_lib_dlsearch_path_spec="/usr/lib${libsuff} /lib${libsuff}" hardcode_into_libs=yes ;; # No shared lib support for Linux oldld, aout, or coff. linux*oldld* | linux*aout* | linux*coff*) dynamic_linker=no ;; # This must be Linux ELF. linux*) version_type=linux need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' finish_cmds='PATH="\$PATH:/sbin" ldconfig -n $libdir' shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=no # This implies no fast_install, which is unacceptable. # Some rework will be needed to allow for fast_install # before this can be enabled. hardcode_into_libs=yes # Append ld.so.conf contents to the search path if test -f /etc/ld.so.conf; then lt_ld_extra=`$SED -e 's/:,\t/ /g;s/=^=*$//;s/=^= * / /g' /etc/ld.so.conf | tr '\n' ' '` sys_lib_dlsearch_path_spec="/lib /usr/lib $lt_ld_extra" fi # We used to test for /lib/ld.so.1 and disable shared libraries on # powerpc, because MkLinux only supported shared libraries with the # GNU dynamic linker. Since this was broken with cross compilers, # most powerpc-linux boxes support dynamic linking these days and # people can always --disable-shared, the test was removed, and we # assume the GNU/Linux dynamic linker is in use. dynamic_linker='GNU/Linux ld.so' ;; knetbsd*-gnu) version_type=linux need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major ${libname}${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=no hardcode_into_libs=yes dynamic_linker='GNU ld.so' ;; netbsd*) version_type=sunos need_lib_prefix=no need_version=no if echo __ELF__ | $CC -E - | grep __ELF__ >/dev/null; then library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${shared_ext}$versuffix' finish_cmds='PATH="\$PATH:/sbin" ldconfig -m $libdir' dynamic_linker='NetBSD (a.out) ld.so' else library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major ${libname}${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' dynamic_linker='NetBSD ld.elf_so' fi shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=yes hardcode_into_libs=yes ;; newsos6) version_type=linux library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=yes ;; nto-qnx*) version_type=linux need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=yes ;; openbsd*) version_type=sunos need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${shared_ext}$versuffix' finish_cmds='PATH="\$PATH:/sbin" ldconfig -m $libdir' shlibpath_var=LD_LIBRARY_PATH if test -z "`echo __ELF__ | $CC -E - | grep __ELF__`" || test "$host_os-$host_cpu" = "openbsd2.8-powerpc"; then case $host_os in openbsd2.[89] | openbsd2.[89].*) shlibpath_overrides_runpath=no ;; *) shlibpath_overrides_runpath=yes ;; esac else shlibpath_overrides_runpath=yes fi ;; os2*) libname_spec='$name' shrext_cmds=".dll" need_lib_prefix=no library_names_spec='$libname${shared_ext} $libname.a' dynamic_linker='OS/2 ld.exe' shlibpath_var=LIBPATH ;; osf3* | osf4* | osf5*) version_type=osf need_lib_prefix=no need_version=no soname_spec='${libname}${release}${shared_ext}$major' library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' shlibpath_var=LD_LIBRARY_PATH sys_lib_search_path_spec="/usr/shlib /usr/ccs/lib /usr/lib/cmplrs/cc /usr/lib /usr/local/lib /var/shlib" sys_lib_dlsearch_path_spec="$sys_lib_search_path_spec" ;; sco3.2v5*) version_type=osf soname_spec='${libname}${release}${shared_ext}$major' library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' shlibpath_var=LD_LIBRARY_PATH ;; solaris*) version_type=linux need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=yes hardcode_into_libs=yes # ldd complains unless libraries are executable postinstall_cmds='chmod +x $lib' ;; sunos4*) version_type=sunos library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${shared_ext}$versuffix' finish_cmds='PATH="\$PATH:/usr/etc" ldconfig $libdir' shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=yes if test "$with_gnu_ld" = yes; then need_lib_prefix=no fi need_version=yes ;; sysv4 | sysv4.2uw2* | sysv4.3* | sysv5*) version_type=linux library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' shlibpath_var=LD_LIBRARY_PATH case $host_vendor in sni) shlibpath_overrides_runpath=no need_lib_prefix=no export_dynamic_flag_spec='${wl}-Blargedynsym' runpath_var=LD_RUN_PATH ;; siemens) need_lib_prefix=no ;; motorola) need_lib_prefix=no need_version=no shlibpath_overrides_runpath=no sys_lib_search_path_spec='/lib /usr/lib /usr/ccs/lib' ;; esac ;; sysv4*MP*) if test -d /usr/nec ;then version_type=linux library_names_spec='$libname${shared_ext}.$versuffix $libname${shared_ext}.$major $libname${shared_ext}' soname_spec='$libname${shared_ext}.$major' shlibpath_var=LD_LIBRARY_PATH fi ;; uts4*) version_type=linux library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' shlibpath_var=LD_LIBRARY_PATH ;; *) dynamic_linker=no ;; esac echo "$as_me:$LINENO: result: $dynamic_linker" >&5 echo "${ECHO_T}$dynamic_linker" >&6 test "$dynamic_linker" = no && can_build_shared=no echo "$as_me:$LINENO: checking how to hardcode library paths into programs" >&5 echo $ECHO_N "checking how to hardcode library paths into programs... $ECHO_C" >&6 hardcode_action_F77= if test -n "$hardcode_libdir_flag_spec_F77" || \ test -n "$runpath_var_F77" || \ test "X$hardcode_automatic_F77" = "Xyes" ; then # We can hardcode non-existant directories. if test "$hardcode_direct_F77" != no && # If the only mechanism to avoid hardcoding is shlibpath_var, we # have to relink, otherwise we might link with an installed library # when we should be linking with a yet-to-be-installed one ## test "$_LT_AC_TAGVAR(hardcode_shlibpath_var, F77)" != no && test "$hardcode_minus_L_F77" != no; then # Linking always hardcodes the temporary library directory. hardcode_action_F77=relink else # We can link without hardcoding, and we can hardcode nonexisting dirs. hardcode_action_F77=immediate fi else # We cannot hardcode anything, or else we can only hardcode existing # directories. hardcode_action_F77=unsupported fi echo "$as_me:$LINENO: result: $hardcode_action_F77" >&5 echo "${ECHO_T}$hardcode_action_F77" >&6 if test "$hardcode_action_F77" = relink; then # Fast installation is not supported enable_fast_install=no elif test "$shlibpath_overrides_runpath" = yes || test "$enable_shared" = no; then # Fast installation is not necessary enable_fast_install=needless fi striplib= old_striplib= echo "$as_me:$LINENO: checking whether stripping libraries is possible" >&5 echo $ECHO_N "checking whether stripping libraries is possible... $ECHO_C" >&6 if test -n "$STRIP" && $STRIP -V 2>&1 | grep "GNU strip" >/dev/null; then test -z "$old_striplib" && old_striplib="$STRIP --strip-debug" test -z "$striplib" && striplib="$STRIP --strip-unneeded" echo "$as_me:$LINENO: result: yes" >&5 echo "${ECHO_T}yes" >&6 else # FIXME - insert some real tests, host_os isn't really good enough case $host_os in darwin*) if test -n "$STRIP" ; then striplib="$STRIP -x" echo "$as_me:$LINENO: result: yes" >&5 echo "${ECHO_T}yes" >&6 else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 fi ;; *) echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 ;; esac fi # The else clause should only fire when bootstrapping the # libtool distribution, otherwise you forgot to ship ltmain.sh # with your package, and you will get complaints that there are # no rules to generate ltmain.sh. if test -f "$ltmain"; then # See if we are running on zsh, and set the options which allow our commands through # without removal of \ escapes. if test -n "${ZSH_VERSION+set}" ; then setopt NO_GLOB_SUBST fi # Now quote all the things that may contain metacharacters while being # careful not to overquote the AC_SUBSTed values. We take copies of the # variables and quote the copies for generation of the libtool script. for var in echo old_CC old_CFLAGS AR AR_FLAGS EGREP RANLIB LN_S LTCC NM \ SED SHELL STRIP \ libname_spec library_names_spec soname_spec extract_expsyms_cmds \ old_striplib striplib file_magic_cmd finish_cmds finish_eval \ deplibs_check_method reload_flag reload_cmds need_locks \ lt_cv_sys_global_symbol_pipe lt_cv_sys_global_symbol_to_cdecl \ lt_cv_sys_global_symbol_to_c_name_address \ sys_lib_search_path_spec sys_lib_dlsearch_path_spec \ old_postinstall_cmds old_postuninstall_cmds \ compiler_F77 \ CC_F77 \ LD_F77 \ lt_prog_compiler_wl_F77 \ lt_prog_compiler_pic_F77 \ lt_prog_compiler_static_F77 \ lt_prog_compiler_no_builtin_flag_F77 \ export_dynamic_flag_spec_F77 \ thread_safe_flag_spec_F77 \ whole_archive_flag_spec_F77 \ enable_shared_with_static_runtimes_F77 \ old_archive_cmds_F77 \ old_archive_from_new_cmds_F77 \ predep_objects_F77 \ postdep_objects_F77 \ predeps_F77 \ postdeps_F77 \ compiler_lib_search_path_F77 \ archive_cmds_F77 \ archive_expsym_cmds_F77 \ postinstall_cmds_F77 \ postuninstall_cmds_F77 \ old_archive_from_expsyms_cmds_F77 \ allow_undefined_flag_F77 \ no_undefined_flag_F77 \ export_symbols_cmds_F77 \ hardcode_libdir_flag_spec_F77 \ hardcode_libdir_flag_spec_ld_F77 \ hardcode_libdir_separator_F77 \ hardcode_automatic_F77 \ module_cmds_F77 \ module_expsym_cmds_F77 \ lt_cv_prog_compiler_c_o_F77 \ exclude_expsyms_F77 \ include_expsyms_F77; do case $var in old_archive_cmds_F77 | \ old_archive_from_new_cmds_F77 | \ archive_cmds_F77 | \ archive_expsym_cmds_F77 | \ module_cmds_F77 | \ module_expsym_cmds_F77 | \ old_archive_from_expsyms_cmds_F77 | \ export_symbols_cmds_F77 | \ extract_expsyms_cmds | reload_cmds | finish_cmds | \ postinstall_cmds | postuninstall_cmds | \ old_postinstall_cmds | old_postuninstall_cmds | \ sys_lib_search_path_spec | sys_lib_dlsearch_path_spec) # Double-quote double-evaled strings. eval "lt_$var=\\\"\`\$echo \"X\$$var\" | \$Xsed -e \"\$double_quote_subst\" -e \"\$sed_quote_subst\" -e \"\$delay_variable_subst\"\`\\\"" ;; *) eval "lt_$var=\\\"\`\$echo \"X\$$var\" | \$Xsed -e \"\$sed_quote_subst\"\`\\\"" ;; esac done case $lt_echo in *'\$0 --fallback-echo"') lt_echo=`$echo "X$lt_echo" | $Xsed -e 's/\\\\\\\$0 --fallback-echo"$/$0 --fallback-echo"/'` ;; esac cfgfile="$ofile" cat <<__EOF__ >> "$cfgfile" # ### BEGIN LIBTOOL TAG CONFIG: $tagname # Libtool was configured on host `(hostname || uname -n) 2>/dev/null | sed 1q`: # Shell to use when invoking shell scripts. SHELL=$lt_SHELL # Whether or not to build shared libraries. build_libtool_libs=$enable_shared # Whether or not to build static libraries. build_old_libs=$enable_static # Whether or not to add -lc for building shared libraries. build_libtool_need_lc=$archive_cmds_need_lc_F77 # Whether or not to disallow shared libs when runtime libs are static allow_libtool_libs_with_static_runtimes=$enable_shared_with_static_runtimes_F77 # Whether or not to optimize for fast installation. fast_install=$enable_fast_install # The host system. host_alias=$host_alias host=$host # An echo program that does not interpret backslashes. echo=$lt_echo # The archiver. AR=$lt_AR AR_FLAGS=$lt_AR_FLAGS # A C compiler. LTCC=$lt_LTCC # A language-specific compiler. CC=$lt_compiler_F77 # Is the compiler the GNU C compiler? with_gcc=$GCC_F77 # An ERE matcher. EGREP=$lt_EGREP # The linker used to build libraries. LD=$lt_LD_F77 # Whether we need hard or soft links. LN_S=$lt_LN_S # A BSD-compatible nm program. NM=$lt_NM # A symbol stripping program STRIP=$lt_STRIP # Used to examine libraries when file_magic_cmd begins "file" MAGIC_CMD=$MAGIC_CMD # Used on cygwin: DLL creation program. DLLTOOL="$DLLTOOL" # Used on cygwin: object dumper. OBJDUMP="$OBJDUMP" # Used on cygwin: assembler. AS="$AS" # The name of the directory that contains temporary libtool files. objdir=$objdir # How to create reloadable object files. reload_flag=$lt_reload_flag reload_cmds=$lt_reload_cmds # How to pass a linker flag through the compiler. wl=$lt_lt_prog_compiler_wl_F77 # Object file suffix (normally "o"). objext="$ac_objext" # Old archive suffix (normally "a"). libext="$libext" # Shared library suffix (normally ".so"). shrext_cmds='$shrext_cmds' # Executable file suffix (normally ""). exeext="$exeext" # Additional compiler flags for building library objects. pic_flag=$lt_lt_prog_compiler_pic_F77 pic_mode=$pic_mode # What is the maximum length of a command? max_cmd_len=$lt_cv_sys_max_cmd_len # Does compiler simultaneously support -c and -o options? compiler_c_o=$lt_lt_cv_prog_compiler_c_o_F77 # Must we lock files when doing compilation ? need_locks=$lt_need_locks # Do we need the lib prefix for modules? need_lib_prefix=$need_lib_prefix # Do we need a version for libraries? need_version=$need_version # Whether dlopen is supported. dlopen_support=$enable_dlopen # Whether dlopen of programs is supported. dlopen_self=$enable_dlopen_self # Whether dlopen of statically linked programs is supported. dlopen_self_static=$enable_dlopen_self_static # Compiler flag to prevent dynamic linking. link_static_flag=$lt_lt_prog_compiler_static_F77 # Compiler flag to turn off builtin functions. no_builtin_flag=$lt_lt_prog_compiler_no_builtin_flag_F77 # Compiler flag to allow reflexive dlopens. export_dynamic_flag_spec=$lt_export_dynamic_flag_spec_F77 # Compiler flag to generate shared objects directly from archives. whole_archive_flag_spec=$lt_whole_archive_flag_spec_F77 # Compiler flag to generate thread-safe objects. thread_safe_flag_spec=$lt_thread_safe_flag_spec_F77 # Library versioning type. version_type=$version_type # Format of library name prefix. libname_spec=$lt_libname_spec # List of archive names. First name is the real one, the rest are links. # The last name is the one that the linker finds with -lNAME. library_names_spec=$lt_library_names_spec # The coded name of the library, if different from the real name. soname_spec=$lt_soname_spec # Commands used to build and install an old-style archive. RANLIB=$lt_RANLIB old_archive_cmds=$lt_old_archive_cmds_F77 old_postinstall_cmds=$lt_old_postinstall_cmds old_postuninstall_cmds=$lt_old_postuninstall_cmds # Create an old-style archive from a shared archive. old_archive_from_new_cmds=$lt_old_archive_from_new_cmds_F77 # Create a temporary old-style archive to link instead of a shared archive. old_archive_from_expsyms_cmds=$lt_old_archive_from_expsyms_cmds_F77 # Commands used to build and install a shared archive. archive_cmds=$lt_archive_cmds_F77 archive_expsym_cmds=$lt_archive_expsym_cmds_F77 postinstall_cmds=$lt_postinstall_cmds postuninstall_cmds=$lt_postuninstall_cmds # Commands used to build a loadable module (assumed same as above if empty) module_cmds=$lt_module_cmds_F77 module_expsym_cmds=$lt_module_expsym_cmds_F77 # Commands to strip libraries. old_striplib=$lt_old_striplib striplib=$lt_striplib # Dependencies to place before the objects being linked to create a # shared library. predep_objects=$lt_predep_objects_F77 # Dependencies to place after the objects being linked to create a # shared library. postdep_objects=$lt_postdep_objects_F77 # Dependencies to place before the objects being linked to create a # shared library. predeps=$lt_predeps_F77 # Dependencies to place after the objects being linked to create a # shared library. postdeps=$lt_postdeps_F77 # The library search path used internally by the compiler when linking # a shared library. compiler_lib_search_path=$lt_compiler_lib_search_path_F77 # Method to check whether dependent libraries are shared objects. deplibs_check_method=$lt_deplibs_check_method # Command to use when deplibs_check_method == file_magic. file_magic_cmd=$lt_file_magic_cmd # Flag that allows shared libraries with undefined symbols to be built. allow_undefined_flag=$lt_allow_undefined_flag_F77 # Flag that forces no undefined symbols. no_undefined_flag=$lt_no_undefined_flag_F77 # Commands used to finish a libtool library installation in a directory. finish_cmds=$lt_finish_cmds # Same as above, but a single script fragment to be evaled but not shown. finish_eval=$lt_finish_eval # Take the output of nm and produce a listing of raw symbols and C names. global_symbol_pipe=$lt_lt_cv_sys_global_symbol_pipe # Transform the output of nm in a proper C declaration global_symbol_to_cdecl=$lt_lt_cv_sys_global_symbol_to_cdecl # Transform the output of nm in a C name address pair global_symbol_to_c_name_address=$lt_lt_cv_sys_global_symbol_to_c_name_address # This is the shared library runtime path variable. runpath_var=$runpath_var # This is the shared library path variable. shlibpath_var=$shlibpath_var # Is shlibpath searched before the hard-coded library search path? shlibpath_overrides_runpath=$shlibpath_overrides_runpath # How to hardcode a shared library path into an executable. hardcode_action=$hardcode_action_F77 # Whether we should hardcode library paths into libraries. hardcode_into_libs=$hardcode_into_libs # Flag to hardcode \$libdir into a binary during linking. # This must work even if \$libdir does not exist. hardcode_libdir_flag_spec=$lt_hardcode_libdir_flag_spec_F77 # If ld is used when linking, flag to hardcode \$libdir into # a binary during linking. This must work even if \$libdir does # not exist. hardcode_libdir_flag_spec_ld=$lt_hardcode_libdir_flag_spec_ld_F77 # Whether we need a single -rpath flag with a separated argument. hardcode_libdir_separator=$lt_hardcode_libdir_separator_F77 # Set to yes if using DIR/libNAME${shared_ext} during linking hardcodes DIR into the # resulting binary. hardcode_direct=$hardcode_direct_F77 # Set to yes if using the -LDIR flag during linking hardcodes DIR into the # resulting binary. hardcode_minus_L=$hardcode_minus_L_F77 # Set to yes if using SHLIBPATH_VAR=DIR during linking hardcodes DIR into # the resulting binary. hardcode_shlibpath_var=$hardcode_shlibpath_var_F77 # Set to yes if building a shared library automatically hardcodes DIR into the library # and all subsequent libraries and executables linked against it. hardcode_automatic=$hardcode_automatic_F77 # Variables whose values should be saved in libtool wrapper scripts and # restored at relink time. variables_saved_for_relink="$variables_saved_for_relink" # Whether libtool must link a program against all its dependency libraries. link_all_deplibs=$link_all_deplibs_F77 # Compile-time system search path for libraries sys_lib_search_path_spec=$lt_sys_lib_search_path_spec # Run-time system search path for libraries sys_lib_dlsearch_path_spec=$lt_sys_lib_dlsearch_path_spec # Fix the shell variable \$srcfile for the compiler. fix_srcfile_path="$fix_srcfile_path_F77" # Set to yes if exported symbols are required. always_export_symbols=$always_export_symbols_F77 # The commands to list exported symbols. export_symbols_cmds=$lt_export_symbols_cmds_F77 # The commands to extract the exported symbol list from a shared archive. extract_expsyms_cmds=$lt_extract_expsyms_cmds # Symbols that should not be listed in the preloaded symbols. exclude_expsyms=$lt_exclude_expsyms_F77 # Symbols that must always be exported. include_expsyms=$lt_include_expsyms_F77 # ### END LIBTOOL TAG CONFIG: $tagname __EOF__ else # If there is no Makefile yet, we rely on a make rule to execute # `config.status --recheck' to rerun these tests and create the # libtool script then. ltmain_in=`echo $ltmain | sed -e 's/\.sh$/.in/'` if test -f "$ltmain_in"; then test -f Makefile && make "$ltmain" fi fi ac_ext=c ac_cpp='$CPP $CPPFLAGS' ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' ac_compiler_gnu=$ac_cv_c_compiler_gnu CC="$lt_save_CC" else tagname="" fi ;; GCJ) if test -n "$GCJ" && test "X$GCJ" != "Xno"; then # Source file extension for Java test sources. ac_ext=java # Object file extension for compiled Java test sources. objext=o objext_GCJ=$objext # Code to be used in simple compile tests lt_simple_compile_test_code="class foo {}\n" # Code to be used in simple link tests lt_simple_link_test_code='public class conftest { public static void main(String argv) {}; }\n' # ltmain only uses $CC for tagged configurations so make sure $CC is set. # If no C compiler was specified, use CC. LTCC=${LTCC-"$CC"} # Allow CC to be a program name with arguments. compiler=$CC # Allow CC to be a program name with arguments. lt_save_CC="$CC" CC=${GCJ-"gcj"} compiler=$CC compiler_GCJ=$CC # GCJ did not exist at the time GCC didn't implicitly link libc in. archive_cmds_need_lc_GCJ=no lt_prog_compiler_no_builtin_flag_GCJ= if test "$GCC" = yes; then lt_prog_compiler_no_builtin_flag_GCJ=' -fno-builtin' echo "$as_me:$LINENO: checking if $compiler supports -fno-rtti -fno-exceptions" >&5 echo $ECHO_N "checking if $compiler supports -fno-rtti -fno-exceptions... $ECHO_C" >&6 if test "${lt_cv_prog_compiler_rtti_exceptions+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else lt_cv_prog_compiler_rtti_exceptions=no ac_outfile=conftest.$ac_objext printf "$lt_simple_compile_test_code" > conftest.$ac_ext lt_compiler_flag="-fno-rtti -fno-exceptions" # Insert the option either (1) after the last *FLAGS variable, or # (2) before a word containing "conftest.", or (3) at the end. # Note that $ac_compile itself does not contain backslashes and begins # with a dollar sign (not a hyphen), so the echo should work correctly. # The option is referenced via a variable to avoid confusing sed. lt_compile=`echo "$ac_compile" | $SED \ -e 's:.*FLAGS}? :&$lt_compiler_flag :; t' \ -e 's: [^ ]*conftest\.: $lt_compiler_flag&:; t' \ -e 's:$: $lt_compiler_flag:'` (eval echo "\"\$as_me:15645: $lt_compile\"" >&5) (eval "$lt_compile" 2>conftest.err) ac_status=$? cat conftest.err >&5 echo "$as_me:15649: \$? = $ac_status" >&5 if (exit $ac_status) && test -s "$ac_outfile"; then # The compiler can only warn and ignore the option if not recognized # So say no if there are warnings if test ! -s conftest.err; then lt_cv_prog_compiler_rtti_exceptions=yes fi fi $rm conftest* fi echo "$as_me:$LINENO: result: $lt_cv_prog_compiler_rtti_exceptions" >&5 echo "${ECHO_T}$lt_cv_prog_compiler_rtti_exceptions" >&6 if test x"$lt_cv_prog_compiler_rtti_exceptions" = xyes; then lt_prog_compiler_no_builtin_flag_GCJ="$lt_prog_compiler_no_builtin_flag_GCJ -fno-rtti -fno-exceptions" else : fi fi lt_prog_compiler_wl_GCJ= lt_prog_compiler_pic_GCJ= lt_prog_compiler_static_GCJ= echo "$as_me:$LINENO: checking for $compiler option to produce PIC" >&5 echo $ECHO_N "checking for $compiler option to produce PIC... $ECHO_C" >&6 if test "$GCC" = yes; then lt_prog_compiler_wl_GCJ='-Wl,' lt_prog_compiler_static_GCJ='-static' case $host_os in aix*) # All AIX code is PIC. if test "$host_cpu" = ia64; then # AIX 5 now supports IA64 processor lt_prog_compiler_static_GCJ='-Bstatic' fi ;; amigaos*) # FIXME: we need at least 68020 code to build shared libraries, but # adding the `-m68020' flag to GCC prevents building anything better, # like `-m68040'. lt_prog_compiler_pic_GCJ='-m68020 -resident32 -malways-restore-a4' ;; beos* | cygwin* | irix5* | irix6* | nonstopux* | osf3* | osf4* | osf5*) # PIC is the default for these OSes. ;; mingw* | pw32* | os2*) # This hack is so that the source file can tell whether it is being # built for inclusion in a dll (and should export symbols for example). lt_prog_compiler_pic_GCJ='-DDLL_EXPORT' ;; darwin* | rhapsody*) # PIC is the default on this platform # Common symbols not allowed in MH_DYLIB files lt_prog_compiler_pic_GCJ='-fno-common' ;; msdosdjgpp*) # Just because we use GCC doesn't mean we suddenly get shared libraries # on systems that don't support them. lt_prog_compiler_can_build_shared_GCJ=no enable_shared=no ;; sysv4*MP*) if test -d /usr/nec; then lt_prog_compiler_pic_GCJ=-Kconform_pic fi ;; hpux*) # PIC is the default for IA64 HP-UX and 64-bit HP-UX, but # not for PA HP-UX. case "$host_cpu" in hppa*64*|ia64*) # +Z the default ;; *) lt_prog_compiler_pic_GCJ='-fPIC' ;; esac ;; *) lt_prog_compiler_pic_GCJ='-fPIC' ;; esac else # PORTME Check for flag to pass linker flags through the system compiler. case $host_os in aix*) lt_prog_compiler_wl_GCJ='-Wl,' if test "$host_cpu" = ia64; then # AIX 5 now supports IA64 processor lt_prog_compiler_static_GCJ='-Bstatic' else lt_prog_compiler_static_GCJ='-bnso -bI:/lib/syscalls.exp' fi ;; darwin*) # PIC is the default on this platform # Common symbols not allowed in MH_DYLIB files case "$cc_basename" in xlc*) lt_prog_compiler_pic_GCJ='-qnocommon' lt_prog_compiler_wl_GCJ='-Wl,' ;; esac ;; mingw* | pw32* | os2*) # This hack is so that the source file can tell whether it is being # built for inclusion in a dll (and should export symbols for example). lt_prog_compiler_pic_GCJ='-DDLL_EXPORT' ;; hpux9* | hpux10* | hpux11*) lt_prog_compiler_wl_GCJ='-Wl,' # PIC is the default for IA64 HP-UX and 64-bit HP-UX, but # not for PA HP-UX. case "$host_cpu" in hppa*64*|ia64*) # +Z the default ;; *) lt_prog_compiler_pic_GCJ='+Z' ;; esac # Is there a better lt_prog_compiler_static that works with the bundled CC? lt_prog_compiler_static_GCJ='${wl}-a ${wl}archive' ;; irix5* | irix6* | nonstopux*) lt_prog_compiler_wl_GCJ='-Wl,' # PIC (with -KPIC) is the default. lt_prog_compiler_static_GCJ='-non_shared' ;; newsos6) lt_prog_compiler_pic_GCJ='-KPIC' lt_prog_compiler_static_GCJ='-Bstatic' ;; linux*) case $CC in icc* | ecc*) lt_prog_compiler_wl_GCJ='-Wl,' lt_prog_compiler_pic_GCJ='-KPIC' lt_prog_compiler_static_GCJ='-static' ;; ccc*) lt_prog_compiler_wl_GCJ='-Wl,' # All Alpha code is PIC. lt_prog_compiler_static_GCJ='-non_shared' ;; esac ;; osf3* | osf4* | osf5*) lt_prog_compiler_wl_GCJ='-Wl,' # All OSF/1 code is PIC. lt_prog_compiler_static_GCJ='-non_shared' ;; sco3.2v5*) lt_prog_compiler_pic_GCJ='-Kpic' lt_prog_compiler_static_GCJ='-dn' ;; solaris*) lt_prog_compiler_wl_GCJ='-Wl,' lt_prog_compiler_pic_GCJ='-KPIC' lt_prog_compiler_static_GCJ='-Bstatic' ;; sunos4*) lt_prog_compiler_wl_GCJ='-Qoption ld ' lt_prog_compiler_pic_GCJ='-PIC' lt_prog_compiler_static_GCJ='-Bstatic' ;; sysv4 | sysv4.2uw2* | sysv4.3* | sysv5*) lt_prog_compiler_wl_GCJ='-Wl,' lt_prog_compiler_pic_GCJ='-KPIC' lt_prog_compiler_static_GCJ='-Bstatic' ;; sysv4*MP*) if test -d /usr/nec ;then lt_prog_compiler_pic_GCJ='-Kconform_pic' lt_prog_compiler_static_GCJ='-Bstatic' fi ;; uts4*) lt_prog_compiler_pic_GCJ='-pic' lt_prog_compiler_static_GCJ='-Bstatic' ;; *) lt_prog_compiler_can_build_shared_GCJ=no ;; esac fi echo "$as_me:$LINENO: result: $lt_prog_compiler_pic_GCJ" >&5 echo "${ECHO_T}$lt_prog_compiler_pic_GCJ" >&6 # # Check to make sure the PIC flag actually works. # if test -n "$lt_prog_compiler_pic_GCJ"; then echo "$as_me:$LINENO: checking if $compiler PIC flag $lt_prog_compiler_pic_GCJ works" >&5 echo $ECHO_N "checking if $compiler PIC flag $lt_prog_compiler_pic_GCJ works... $ECHO_C" >&6 if test "${lt_prog_compiler_pic_works_GCJ+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else lt_prog_compiler_pic_works_GCJ=no ac_outfile=conftest.$ac_objext printf "$lt_simple_compile_test_code" > conftest.$ac_ext lt_compiler_flag="$lt_prog_compiler_pic_GCJ" # Insert the option either (1) after the last *FLAGS variable, or # (2) before a word containing "conftest.", or (3) at the end. # Note that $ac_compile itself does not contain backslashes and begins # with a dollar sign (not a hyphen), so the echo should work correctly. # The option is referenced via a variable to avoid confusing sed. lt_compile=`echo "$ac_compile" | $SED \ -e 's:.*FLAGS}? :&$lt_compiler_flag :; t' \ -e 's: [^ ]*conftest\.: $lt_compiler_flag&:; t' \ -e 's:$: $lt_compiler_flag:'` (eval echo "\"\$as_me:15888: $lt_compile\"" >&5) (eval "$lt_compile" 2>conftest.err) ac_status=$? cat conftest.err >&5 echo "$as_me:15892: \$? = $ac_status" >&5 if (exit $ac_status) && test -s "$ac_outfile"; then # The compiler can only warn and ignore the option if not recognized # So say no if there are warnings if test ! -s conftest.err; then lt_prog_compiler_pic_works_GCJ=yes fi fi $rm conftest* fi echo "$as_me:$LINENO: result: $lt_prog_compiler_pic_works_GCJ" >&5 echo "${ECHO_T}$lt_prog_compiler_pic_works_GCJ" >&6 if test x"$lt_prog_compiler_pic_works_GCJ" = xyes; then case $lt_prog_compiler_pic_GCJ in "" | " "*) ;; *) lt_prog_compiler_pic_GCJ=" $lt_prog_compiler_pic_GCJ" ;; esac else lt_prog_compiler_pic_GCJ= lt_prog_compiler_can_build_shared_GCJ=no fi fi case "$host_os" in # For platforms which do not support PIC, -DPIC is meaningless: *djgpp*) lt_prog_compiler_pic_GCJ= ;; *) lt_prog_compiler_pic_GCJ="$lt_prog_compiler_pic_GCJ" ;; esac echo "$as_me:$LINENO: checking if $compiler supports -c -o file.$ac_objext" >&5 echo $ECHO_N "checking if $compiler supports -c -o file.$ac_objext... $ECHO_C" >&6 if test "${lt_cv_prog_compiler_c_o_GCJ+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else lt_cv_prog_compiler_c_o_GCJ=no $rm -r conftest 2>/dev/null mkdir conftest cd conftest mkdir out printf "$lt_simple_compile_test_code" > conftest.$ac_ext lt_compiler_flag="-o out/conftest2.$ac_objext" # Insert the option either (1) after the last *FLAGS variable, or # (2) before a word containing "conftest.", or (3) at the end. # Note that $ac_compile itself does not contain backslashes and begins # with a dollar sign (not a hyphen), so the echo should work correctly. lt_compile=`echo "$ac_compile" | $SED \ -e 's:.*FLAGS}? :&$lt_compiler_flag :; t' \ -e 's: [^ ]*conftest\.: $lt_compiler_flag&:; t' \ -e 's:$: $lt_compiler_flag:'` (eval echo "\"\$as_me:15948: $lt_compile\"" >&5) (eval "$lt_compile" 2>out/conftest.err) ac_status=$? cat out/conftest.err >&5 echo "$as_me:15952: \$? = $ac_status" >&5 if (exit $ac_status) && test -s out/conftest2.$ac_objext then # The compiler can only warn and ignore the option if not recognized # So say no if there are warnings if test ! -s out/conftest.err; then lt_cv_prog_compiler_c_o_GCJ=yes fi fi chmod u+w . $rm conftest* # SGI C++ compiler will create directory out/ii_files/ for # template instantiation test -d out/ii_files && $rm out/ii_files/* && rmdir out/ii_files $rm out/* && rmdir out cd .. rmdir conftest $rm conftest* fi echo "$as_me:$LINENO: result: $lt_cv_prog_compiler_c_o_GCJ" >&5 echo "${ECHO_T}$lt_cv_prog_compiler_c_o_GCJ" >&6 hard_links="nottested" if test "$lt_cv_prog_compiler_c_o_GCJ" = no && test "$need_locks" != no; then # do not overwrite the value of need_locks provided by the user echo "$as_me:$LINENO: checking if we can lock with hard links" >&5 echo $ECHO_N "checking if we can lock with hard links... $ECHO_C" >&6 hard_links=yes $rm conftest* ln conftest.a conftest.b 2>/dev/null && hard_links=no touch conftest.a ln conftest.a conftest.b 2>&5 || hard_links=no ln conftest.a conftest.b 2>/dev/null && hard_links=no echo "$as_me:$LINENO: result: $hard_links" >&5 echo "${ECHO_T}$hard_links" >&6 if test "$hard_links" = no; then { echo "$as_me:$LINENO: WARNING: \`$CC' does not support \`-c -o', so \`make -j' may be unsafe" >&5 echo "$as_me: WARNING: \`$CC' does not support \`-c -o', so \`make -j' may be unsafe" >&2;} need_locks=warn fi else need_locks=no fi echo "$as_me:$LINENO: checking whether the $compiler linker ($LD) supports shared libraries" >&5 echo $ECHO_N "checking whether the $compiler linker ($LD) supports shared libraries... $ECHO_C" >&6 runpath_var= allow_undefined_flag_GCJ= enable_shared_with_static_runtimes_GCJ=no archive_cmds_GCJ= archive_expsym_cmds_GCJ= old_archive_From_new_cmds_GCJ= old_archive_from_expsyms_cmds_GCJ= export_dynamic_flag_spec_GCJ= whole_archive_flag_spec_GCJ= thread_safe_flag_spec_GCJ= hardcode_libdir_flag_spec_GCJ= hardcode_libdir_flag_spec_ld_GCJ= hardcode_libdir_separator_GCJ= hardcode_direct_GCJ=no hardcode_minus_L_GCJ=no hardcode_shlibpath_var_GCJ=unsupported link_all_deplibs_GCJ=unknown hardcode_automatic_GCJ=no module_cmds_GCJ= module_expsym_cmds_GCJ= always_export_symbols_GCJ=no export_symbols_cmds_GCJ='$NM $libobjs $convenience | $global_symbol_pipe | $SED '\''s/.* //'\'' | sort | uniq > $export_symbols' # include_expsyms should be a list of space-separated symbols to be *always* # included in the symbol list include_expsyms_GCJ= # exclude_expsyms can be an extended regexp of symbols to exclude # it will be wrapped by ` (' and `)$', so one must not match beginning or # end of line. Example: `a|bc|.*d.*' will exclude the symbols `a' and `bc', # as well as any symbol that contains `d'. exclude_expsyms_GCJ="_GLOBAL_OFFSET_TABLE_" # Although _GLOBAL_OFFSET_TABLE_ is a valid symbol C name, most a.out # platforms (ab)use it in PIC code, but their linkers get confused if # the symbol is explicitly referenced. Since portable code cannot # rely on this symbol name, it's probably fine to never include it in # preloaded symbol tables. extract_expsyms_cmds= case $host_os in cygwin* | mingw* | pw32*) # FIXME: the MSVC++ port hasn't been tested in a loooong time # When not using gcc, we currently assume that we are using # Microsoft Visual C++. if test "$GCC" != yes; then with_gnu_ld=no fi ;; openbsd*) with_gnu_ld=no ;; esac ld_shlibs_GCJ=yes if test "$with_gnu_ld" = yes; then # If archive_cmds runs LD, not CC, wlarc should be empty wlarc='${wl}' # See if GNU ld supports shared libraries. case $host_os in aix3* | aix4* | aix5*) # On AIX/PPC, the GNU linker is very broken if test "$host_cpu" != ia64; then ld_shlibs_GCJ=no cat <&2 *** Warning: the GNU linker, at least up to release 2.9.1, is reported *** to be unable to reliably create shared libraries on AIX. *** Therefore, libtool is disabling shared libraries support. If you *** really care for shared libraries, you may want to modify your PATH *** so that a non-GNU linker is found, and then restart. EOF fi ;; amigaos*) archive_cmds_GCJ='$rm $output_objdir/a2ixlibrary.data~$echo "#define NAME $libname" > $output_objdir/a2ixlibrary.data~$echo "#define LIBRARY_ID 1" >> $output_objdir/a2ixlibrary.data~$echo "#define VERSION $major" >> $output_objdir/a2ixlibrary.data~$echo "#define REVISION $revision" >> $output_objdir/a2ixlibrary.data~$AR $AR_FLAGS $lib $libobjs~$RANLIB $lib~(cd $output_objdir && a2ixlibrary -32)' hardcode_libdir_flag_spec_GCJ='-L$libdir' hardcode_minus_L_GCJ=yes # Samuel A. Falvo II reports # that the semantics of dynamic libraries on AmigaOS, at least up # to version 4, is to share data among multiple programs linked # with the same dynamic library. Since this doesn't match the # behavior of shared libraries on other platforms, we can't use # them. ld_shlibs_GCJ=no ;; beos*) if $LD --help 2>&1 | grep ': supported targets:.* elf' > /dev/null; then allow_undefined_flag_GCJ=unsupported # Joseph Beckenbach says some releases of gcc # support --undefined. This deserves some investigation. FIXME archive_cmds_GCJ='$CC -nostart $libobjs $deplibs $compiler_flags ${wl}-soname $wl$soname -o $lib' else ld_shlibs_GCJ=no fi ;; cygwin* | mingw* | pw32*) # _LT_AC_TAGVAR(hardcode_libdir_flag_spec, GCJ) is actually meaningless, # as there is no search path for DLLs. hardcode_libdir_flag_spec_GCJ='-L$libdir' allow_undefined_flag_GCJ=unsupported always_export_symbols_GCJ=no enable_shared_with_static_runtimes_GCJ=yes export_symbols_cmds_GCJ='$NM $libobjs $convenience | $global_symbol_pipe | $SED -e '\''/^[BCDGS] /s/.* \([^ ]*\)/\1 DATA/'\'' | $SED -e '\''/^[AITW] /s/.* //'\'' | sort | uniq > $export_symbols' if $LD --help 2>&1 | grep 'auto-import' > /dev/null; then archive_cmds_GCJ='$CC -shared $libobjs $deplibs $compiler_flags -o $output_objdir/$soname ${wl}--image-base=0x10000000 ${wl}--out-implib,$lib' # If the export-symbols file already is a .def file (1st line # is EXPORTS), use it as is; otherwise, prepend... archive_expsym_cmds_GCJ='if test "x`$SED 1q $export_symbols`" = xEXPORTS; then cp $export_symbols $output_objdir/$soname.def; else echo EXPORTS > $output_objdir/$soname.def; cat $export_symbols >> $output_objdir/$soname.def; fi~ $CC -shared $output_objdir/$soname.def $libobjs $deplibs $compiler_flags -o $output_objdir/$soname ${wl}--image-base=0x10000000 ${wl}--out-implib,$lib' else ld_shlibs=no fi ;; netbsd*) if echo __ELF__ | $CC -E - | grep __ELF__ >/dev/null; then archive_cmds_GCJ='$LD -Bshareable $libobjs $deplibs $linker_flags -o $lib' wlarc= else archive_cmds_GCJ='$CC -shared $libobjs $deplibs $compiler_flags ${wl}-soname $wl$soname -o $lib' archive_expsym_cmds_GCJ='$CC -shared $libobjs $deplibs $compiler_flags ${wl}-soname $wl$soname ${wl}-retain-symbols-file $wl$export_symbols -o $lib' fi ;; solaris* | sysv5*) if $LD -v 2>&1 | grep 'BFD 2\.8' > /dev/null; then ld_shlibs_GCJ=no cat <&2 *** Warning: The releases 2.8.* of the GNU linker cannot reliably *** create shared libraries on Solaris systems. Therefore, libtool *** is disabling shared libraries support. We urge you to upgrade GNU *** binutils to release 2.9.1 or newer. Another option is to modify *** your PATH or compiler configuration so that the native linker is *** used, and then restart. EOF elif $LD --help 2>&1 | grep ': supported targets:.* elf' > /dev/null; then archive_cmds_GCJ='$CC -shared $libobjs $deplibs $compiler_flags ${wl}-soname $wl$soname -o $lib' archive_expsym_cmds_GCJ='$CC -shared $libobjs $deplibs $compiler_flags ${wl}-soname $wl$soname ${wl}-retain-symbols-file $wl$export_symbols -o $lib' else ld_shlibs_GCJ=no fi ;; sunos4*) archive_cmds_GCJ='$LD -assert pure-text -Bshareable -o $lib $libobjs $deplibs $linker_flags' wlarc= hardcode_direct_GCJ=yes hardcode_shlibpath_var_GCJ=no ;; linux*) if $LD --help 2>&1 | grep ': supported targets:.* elf' > /dev/null; then tmp_archive_cmds='$CC -shared $libobjs $deplibs $compiler_flags ${wl}-soname $wl$soname -o $lib' archive_cmds_GCJ="$tmp_archive_cmds" supports_anon_versioning=no case `$LD -v 2>/dev/null` in *\ 01.* | *\ 2.[0-9].* | *\ 2.10.*) ;; # catch versions < 2.11 *\ 2.11.93.0.2\ *) supports_anon_versioning=yes ;; # RH7.3 ... *\ 2.11.92.0.12\ *) supports_anon_versioning=yes ;; # Mandrake 8.2 ... *\ 2.11.*) ;; # other 2.11 versions *) supports_anon_versioning=yes ;; esac if test $supports_anon_versioning = yes; then archive_expsym_cmds_GCJ='$echo "{ global:" > $output_objdir/$libname.ver~ cat $export_symbols | sed -e "s/\(.*\)/\1;/" >> $output_objdir/$libname.ver~ $echo "local: *; };" >> $output_objdir/$libname.ver~ $CC -shared $libobjs $deplibs $compiler_flags ${wl}-soname $wl$soname ${wl}-version-script ${wl}$output_objdir/$libname.ver -o $lib' else archive_expsym_cmds_GCJ="$tmp_archive_cmds" fi else ld_shlibs_GCJ=no fi ;; *) if $LD --help 2>&1 | grep ': supported targets:.* elf' > /dev/null; then archive_cmds_GCJ='$CC -shared $libobjs $deplibs $compiler_flags ${wl}-soname $wl$soname -o $lib' archive_expsym_cmds_GCJ='$CC -shared $libobjs $deplibs $compiler_flags ${wl}-soname $wl$soname ${wl}-retain-symbols-file $wl$export_symbols -o $lib' else ld_shlibs_GCJ=no fi ;; esac if test "$ld_shlibs_GCJ" = yes; then runpath_var=LD_RUN_PATH hardcode_libdir_flag_spec_GCJ='${wl}--rpath ${wl}$libdir' export_dynamic_flag_spec_GCJ='${wl}--export-dynamic' # ancient GNU ld didn't support --whole-archive et. al. if $LD --help 2>&1 | grep 'no-whole-archive' > /dev/null; then whole_archive_flag_spec_GCJ="$wlarc"'--whole-archive$convenience '"$wlarc"'--no-whole-archive' else whole_archive_flag_spec_GCJ= fi fi else # PORTME fill in a description of your system's linker (not GNU ld) case $host_os in aix3*) allow_undefined_flag_GCJ=unsupported always_export_symbols_GCJ=yes archive_expsym_cmds_GCJ='$LD -o $output_objdir/$soname $libobjs $deplibs $linker_flags -bE:$export_symbols -T512 -H512 -bM:SRE~$AR $AR_FLAGS $lib $output_objdir/$soname' # Note: this linker hardcodes the directories in LIBPATH if there # are no directories specified by -L. hardcode_minus_L_GCJ=yes if test "$GCC" = yes && test -z "$link_static_flag"; then # Neither direct hardcoding nor static linking is supported with a # broken collect2. hardcode_direct_GCJ=unsupported fi ;; aix4* | aix5*) if test "$host_cpu" = ia64; then # On IA64, the linker does run time linking by default, so we don't # have to do anything special. aix_use_runtimelinking=no exp_sym_flag='-Bexport' no_entry_flag="" else # If we're using GNU nm, then we don't want the "-C" option. # -C means demangle to AIX nm, but means don't demangle with GNU nm if $NM -V 2>&1 | grep 'GNU' > /dev/null; then export_symbols_cmds_GCJ='$NM -Bpg $libobjs $convenience | awk '\''{ if (((\$2 == "T") || (\$2 == "D") || (\$2 == "B")) && (substr(\$3,1,1) != ".")) { print \$3 } }'\'' | sort -u > $export_symbols' else export_symbols_cmds_GCJ='$NM -BCpg $libobjs $convenience | awk '\''{ if (((\$2 == "T") || (\$2 == "D") || (\$2 == "B")) && (substr(\$3,1,1) != ".")) { print \$3 } }'\'' | sort -u > $export_symbols' fi aix_use_runtimelinking=no # Test if we are trying to use run time linking or normal # AIX style linking. If -brtl is somewhere in LDFLAGS, we # need to do runtime linking. case $host_os in aix4.[23]|aix4.[23].*|aix5*) for ld_flag in $LDFLAGS; do if (test $ld_flag = "-brtl" || test $ld_flag = "-Wl,-brtl"); then aix_use_runtimelinking=yes break fi done esac exp_sym_flag='-bexport' no_entry_flag='-bnoentry' fi # When large executables or shared objects are built, AIX ld can # have problems creating the table of contents. If linking a library # or program results in "error TOC overflow" add -mminimal-toc to # CXXFLAGS/CFLAGS for g++/gcc. In the cases where that is not # enough to fix the problem, add -Wl,-bbigtoc to LDFLAGS. archive_cmds_GCJ='' hardcode_direct_GCJ=yes hardcode_libdir_separator_GCJ=':' link_all_deplibs_GCJ=yes if test "$GCC" = yes; then case $host_os in aix4.012|aix4.012.*) # We only want to do this on AIX 4.2 and lower, the check # below for broken collect2 doesn't work under 4.3+ collect2name=`${CC} -print-prog-name=collect2` if test -f "$collect2name" && \ strings "$collect2name" | grep resolve_lib_name >/dev/null then # We have reworked collect2 hardcode_direct_GCJ=yes else # We have old collect2 hardcode_direct_GCJ=unsupported # It fails to find uninstalled libraries when the uninstalled # path is not listed in the libpath. Setting hardcode_minus_L # to unsupported forces relinking hardcode_minus_L_GCJ=yes hardcode_libdir_flag_spec_GCJ='-L$libdir' hardcode_libdir_separator_GCJ= fi esac shared_flag='-shared' else # not using gcc if test "$host_cpu" = ia64; then # VisualAge C++, Version 5.5 for AIX 5L for IA-64, Beta 3 Release # chokes on -Wl,-G. The following line is correct: shared_flag='-G' else if test "$aix_use_runtimelinking" = yes; then shared_flag='${wl}-G' else shared_flag='${wl}-bM:SRE' fi fi fi # It seems that -bexpall does not export symbols beginning with # underscore (_), so it is better to generate a list of symbols to export. always_export_symbols_GCJ=yes if test "$aix_use_runtimelinking" = yes; then # Warning - without using the other runtime loading flags (-brtl), # -berok will link without error, but may produce a broken library. allow_undefined_flag_GCJ='-berok' # Determine the default libpath from the value encoded in an empty executable. cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ int main () { ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then aix_libpath=`dump -H conftest$ac_exeext 2>/dev/null | $SED -n -e '/Import File Strings/,/^$/ { /^0/ { s/^0 *\(.*\)$/\1/; p; } }'` # Check for a 64-bit object if we didn't find anything. if test -z "$aix_libpath"; then aix_libpath=`dump -HX64 conftest$ac_exeext 2>/dev/null | $SED -n -e '/Import File Strings/,/^$/ { /^0/ { s/^0 *\(.*\)$/\1/; p; } }'`; fi else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 fi rm -f conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext if test -z "$aix_libpath"; then aix_libpath="/usr/lib:/lib"; fi hardcode_libdir_flag_spec_GCJ='${wl}-blibpath:$libdir:'"$aix_libpath" archive_expsym_cmds_GCJ="\$CC"' -o $output_objdir/$soname $libobjs $deplibs $compiler_flags `if test "x${allow_undefined_flag}" != "x"; then echo "${wl}${allow_undefined_flag}"; else :; fi` '"\${wl}$no_entry_flag \${wl}$exp_sym_flag:\$export_symbols $shared_flag" else if test "$host_cpu" = ia64; then hardcode_libdir_flag_spec_GCJ='${wl}-R $libdir:/usr/lib:/lib' allow_undefined_flag_GCJ="-z nodefs" archive_expsym_cmds_GCJ="\$CC $shared_flag"' -o $output_objdir/$soname $libobjs $deplibs $compiler_flags ${wl}${allow_undefined_flag} '"\${wl}$no_entry_flag \${wl}$exp_sym_flag:\$export_symbols" else # Determine the default libpath from the value encoded in an empty executable. cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ int main () { ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then aix_libpath=`dump -H conftest$ac_exeext 2>/dev/null | $SED -n -e '/Import File Strings/,/^$/ { /^0/ { s/^0 *\(.*\)$/\1/; p; } }'` # Check for a 64-bit object if we didn't find anything. if test -z "$aix_libpath"; then aix_libpath=`dump -HX64 conftest$ac_exeext 2>/dev/null | $SED -n -e '/Import File Strings/,/^$/ { /^0/ { s/^0 *\(.*\)$/\1/; p; } }'`; fi else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 fi rm -f conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext if test -z "$aix_libpath"; then aix_libpath="/usr/lib:/lib"; fi hardcode_libdir_flag_spec_GCJ='${wl}-blibpath:$libdir:'"$aix_libpath" # Warning - without using the other run time loading flags, # -berok will link without error, but may produce a broken library. no_undefined_flag_GCJ=' ${wl}-bernotok' allow_undefined_flag_GCJ=' ${wl}-berok' # -bexpall does not export symbols beginning with underscore (_) always_export_symbols_GCJ=yes # Exported symbols can be pulled into shared objects from archives whole_archive_flag_spec_GCJ=' ' archive_cmds_need_lc_GCJ=yes # This is similar to how AIX traditionally builds it's shared libraries. archive_expsym_cmds_GCJ="\$CC $shared_flag"' -o $output_objdir/$soname $libobjs $deplibs $compiler_flags ${wl}-bE:$export_symbols ${wl}-bnoentry${allow_undefined_flag}~$AR $AR_FLAGS $output_objdir/$libname$release.a $output_objdir/$soname' fi fi ;; amigaos*) archive_cmds_GCJ='$rm $output_objdir/a2ixlibrary.data~$echo "#define NAME $libname" > $output_objdir/a2ixlibrary.data~$echo "#define LIBRARY_ID 1" >> $output_objdir/a2ixlibrary.data~$echo "#define VERSION $major" >> $output_objdir/a2ixlibrary.data~$echo "#define REVISION $revision" >> $output_objdir/a2ixlibrary.data~$AR $AR_FLAGS $lib $libobjs~$RANLIB $lib~(cd $output_objdir && a2ixlibrary -32)' hardcode_libdir_flag_spec_GCJ='-L$libdir' hardcode_minus_L_GCJ=yes # see comment about different semantics on the GNU ld section ld_shlibs_GCJ=no ;; bsdi[45]*) export_dynamic_flag_spec_GCJ=-rdynamic ;; cygwin* | mingw* | pw32*) # When not using gcc, we currently assume that we are using # Microsoft Visual C++. # hardcode_libdir_flag_spec is actually meaningless, as there is # no search path for DLLs. hardcode_libdir_flag_spec_GCJ=' ' allow_undefined_flag_GCJ=unsupported # Tell ltmain to make .lib files, not .a files. libext=lib # Tell ltmain to make .dll files, not .so files. shrext_cmds=".dll" # FIXME: Setting linknames here is a bad hack. archive_cmds_GCJ='$CC -o $lib $libobjs $compiler_flags `echo "$deplibs" | $SED -e '\''s/ -lc$//'\''` -link -dll~linknames=' # The linker will automatically build a .lib file if we build a DLL. old_archive_From_new_cmds_GCJ='true' # FIXME: Should let the user specify the lib program. old_archive_cmds_GCJ='lib /OUT:$oldlib$oldobjs$old_deplibs' fix_srcfile_path='`cygpath -w "$srcfile"`' enable_shared_with_static_runtimes_GCJ=yes ;; darwin* | rhapsody*) case "$host_os" in rhapsody* | darwin1.[012]) allow_undefined_flag_GCJ='${wl}-undefined ${wl}suppress' ;; *) # Darwin 1.3 on if test -z ${MACOSX_DEPLOYMENT_TARGET} ; then allow_undefined_flag_GCJ='${wl}-flat_namespace ${wl}-undefined ${wl}suppress' else case ${MACOSX_DEPLOYMENT_TARGET} in 10.[012]) allow_undefined_flag_GCJ='${wl}-flat_namespace ${wl}-undefined ${wl}suppress' ;; 10.*) allow_undefined_flag_GCJ='${wl}-undefined ${wl}dynamic_lookup' ;; esac fi ;; esac archive_cmds_need_lc_GCJ=no hardcode_direct_GCJ=no hardcode_automatic_GCJ=yes hardcode_shlibpath_var_GCJ=unsupported whole_archive_flag_spec_GCJ='' link_all_deplibs_GCJ=yes if test "$GCC" = yes ; then output_verbose_link_cmd='echo' archive_cmds_GCJ='$CC -dynamiclib $allow_undefined_flag -o $lib $libobjs $deplibs $compiler_flags -install_name $rpath/$soname $verstring' module_cmds_GCJ='$CC $allow_undefined_flag -o $lib -bundle $libobjs $deplibs$compiler_flags' # Don't fix this by using the ld -exported_symbols_list flag, it doesn't exist in older darwin ld's archive_expsym_cmds_GCJ='sed -e "s,#.*,," -e "s,^[ ]*,," -e "s,^\(..*\),_&," < $export_symbols > $output_objdir/${libname}-symbols.expsym~$CC -dynamiclib $allow_undefined_flag -o $lib $libobjs $deplibs $compiler_flags -install_name $rpath/$soname $verstring~nmedit -s $output_objdir/${libname}-symbols.expsym ${lib}' module_expsym_cmds_GCJ='sed -e "s,#.*,," -e "s,^[ ]*,," -e "s,^\(..*\),_&," < $export_symbols > $output_objdir/${libname}-symbols.expsym~$CC $allow_undefined_flag -o $lib -bundle $libobjs $deplibs$compiler_flags~nmedit -s $output_objdir/${libname}-symbols.expsym ${lib}' else case "$cc_basename" in xlc*) output_verbose_link_cmd='echo' archive_cmds_GCJ='$CC -qmkshrobj $allow_undefined_flag -o $lib $libobjs $deplibs $compiler_flags ${wl}-install_name ${wl}`echo $rpath/$soname` $verstring' module_cmds_GCJ='$CC $allow_undefined_flag -o $lib -bundle $libobjs $deplibs$compiler_flags' # Don't fix this by using the ld -exported_symbols_list flag, it doesn't exist in older darwin ld's archive_expsym_cmds_GCJ='sed -e "s,#.*,," -e "s,^[ ]*,," -e "s,^\(..*\),_&," < $export_symbols > $output_objdir/${libname}-symbols.expsym~$CC -qmkshrobj $allow_undefined_flag -o $lib $libobjs $deplibs $compiler_flags ${wl}-install_name ${wl}$rpath/$soname $verstring~nmedit -s $output_objdir/${libname}-symbols.expsym ${lib}' module_expsym_cmds_GCJ='sed -e "s,#.*,," -e "s,^[ ]*,," -e "s,^\(..*\),_&," < $export_symbols > $output_objdir/${libname}-symbols.expsym~$CC $allow_undefined_flag -o $lib -bundle $libobjs $deplibs$compiler_flags~nmedit -s $output_objdir/${libname}-symbols.expsym ${lib}' ;; *) ld_shlibs_GCJ=no ;; esac fi ;; dgux*) archive_cmds_GCJ='$LD -G -h $soname -o $lib $libobjs $deplibs $linker_flags' hardcode_libdir_flag_spec_GCJ='-L$libdir' hardcode_shlibpath_var_GCJ=no ;; freebsd1*) ld_shlibs_GCJ=no ;; # FreeBSD 2.2.[012] allows us to include c++rt0.o to get C++ constructor # support. Future versions do this automatically, but an explicit c++rt0.o # does not break anything, and helps significantly (at the cost of a little # extra space). freebsd2.2*) archive_cmds_GCJ='$LD -Bshareable -o $lib $libobjs $deplibs $linker_flags /usr/lib/c++rt0.o' hardcode_libdir_flag_spec_GCJ='-R$libdir' hardcode_direct_GCJ=yes hardcode_shlibpath_var_GCJ=no ;; # Unfortunately, older versions of FreeBSD 2 do not have this feature. freebsd2*) archive_cmds_GCJ='$LD -Bshareable -o $lib $libobjs $deplibs $linker_flags' hardcode_direct_GCJ=yes hardcode_minus_L_GCJ=yes hardcode_shlibpath_var_GCJ=no ;; # FreeBSD 3 and greater uses gcc -shared to do shared libraries. freebsd* | kfreebsd*-gnu) archive_cmds_GCJ='$CC -shared -o $lib $libobjs $deplibs $compiler_flags' hardcode_libdir_flag_spec_GCJ='-R$libdir' hardcode_direct_GCJ=yes hardcode_shlibpath_var_GCJ=no ;; hpux9*) if test "$GCC" = yes; then archive_cmds_GCJ='$rm $output_objdir/$soname~$CC -shared -fPIC ${wl}+b ${wl}$install_libdir -o $output_objdir/$soname $libobjs $deplibs $compiler_flags~test $output_objdir/$soname = $lib || mv $output_objdir/$soname $lib' else archive_cmds_GCJ='$rm $output_objdir/$soname~$LD -b +b $install_libdir -o $output_objdir/$soname $libobjs $deplibs $linker_flags~test $output_objdir/$soname = $lib || mv $output_objdir/$soname $lib' fi hardcode_libdir_flag_spec_GCJ='${wl}+b ${wl}$libdir' hardcode_libdir_separator_GCJ=: hardcode_direct_GCJ=yes # hardcode_minus_L: Not really in the search PATH, # but as the default location of the library. hardcode_minus_L_GCJ=yes export_dynamic_flag_spec_GCJ='${wl}-E' ;; hpux10* | hpux11*) if test "$GCC" = yes -a "$with_gnu_ld" = no; then case "$host_cpu" in hppa*64*|ia64*) archive_cmds_GCJ='$CC -shared ${wl}+h ${wl}$soname -o $lib $libobjs $deplibs $compiler_flags' ;; *) archive_cmds_GCJ='$CC -shared -fPIC ${wl}+h ${wl}$soname ${wl}+b ${wl}$install_libdir -o $lib $libobjs $deplibs $compiler_flags' ;; esac else case "$host_cpu" in hppa*64*|ia64*) archive_cmds_GCJ='$LD -b +h $soname -o $lib $libobjs $deplibs $linker_flags' ;; *) archive_cmds_GCJ='$LD -b +h $soname +b $install_libdir -o $lib $libobjs $deplibs $linker_flags' ;; esac fi if test "$with_gnu_ld" = no; then case "$host_cpu" in hppa*64*) hardcode_libdir_flag_spec_GCJ='${wl}+b ${wl}$libdir' hardcode_libdir_flag_spec_ld_GCJ='+b $libdir' hardcode_libdir_separator_GCJ=: hardcode_direct_GCJ=no hardcode_shlibpath_var_GCJ=no ;; ia64*) hardcode_libdir_flag_spec_GCJ='-L$libdir' hardcode_direct_GCJ=no hardcode_shlibpath_var_GCJ=no # hardcode_minus_L: Not really in the search PATH, # but as the default location of the library. hardcode_minus_L_GCJ=yes ;; *) hardcode_libdir_flag_spec_GCJ='${wl}+b ${wl}$libdir' hardcode_libdir_separator_GCJ=: hardcode_direct_GCJ=yes export_dynamic_flag_spec_GCJ='${wl}-E' # hardcode_minus_L: Not really in the search PATH, # but as the default location of the library. hardcode_minus_L_GCJ=yes ;; esac fi ;; irix5* | irix6* | nonstopux*) if test "$GCC" = yes; then archive_cmds_GCJ='$CC -shared $libobjs $deplibs $compiler_flags ${wl}-soname ${wl}$soname `test -n "$verstring" && echo ${wl}-set_version ${wl}$verstring` ${wl}-update_registry ${wl}${output_objdir}/so_locations -o $lib' else archive_cmds_GCJ='$LD -shared $libobjs $deplibs $linker_flags -soname $soname `test -n "$verstring" && echo -set_version $verstring` -update_registry ${output_objdir}/so_locations -o $lib' hardcode_libdir_flag_spec_ld_GCJ='-rpath $libdir' fi hardcode_libdir_flag_spec_GCJ='${wl}-rpath ${wl}$libdir' hardcode_libdir_separator_GCJ=: link_all_deplibs_GCJ=yes ;; netbsd*) if echo __ELF__ | $CC -E - | grep __ELF__ >/dev/null; then archive_cmds_GCJ='$LD -Bshareable -o $lib $libobjs $deplibs $linker_flags' # a.out else archive_cmds_GCJ='$LD -shared -o $lib $libobjs $deplibs $linker_flags' # ELF fi hardcode_libdir_flag_spec_GCJ='-R$libdir' hardcode_direct_GCJ=yes hardcode_shlibpath_var_GCJ=no ;; newsos6) archive_cmds_GCJ='$LD -G -h $soname -o $lib $libobjs $deplibs $linker_flags' hardcode_direct_GCJ=yes hardcode_libdir_flag_spec_GCJ='${wl}-rpath ${wl}$libdir' hardcode_libdir_separator_GCJ=: hardcode_shlibpath_var_GCJ=no ;; openbsd*) hardcode_direct_GCJ=yes hardcode_shlibpath_var_GCJ=no if test -z "`echo __ELF__ | $CC -E - | grep __ELF__`" || test "$host_os-$host_cpu" = "openbsd2.8-powerpc"; then archive_cmds_GCJ='$CC -shared $pic_flag -o $lib $libobjs $deplibs $compiler_flags' archive_expsym_cmds_GCJ='$CC -shared $pic_flag -o $lib $libobjs $deplibs $compiler_flags ${wl}-retain-symbols-file,$export_symbols' hardcode_libdir_flag_spec_GCJ='${wl}-rpath,$libdir' export_dynamic_flag_spec_GCJ='${wl}-E' else case $host_os in openbsd[01].* | openbsd2.[0-7] | openbsd2.[0-7].*) archive_cmds_GCJ='$LD -Bshareable -o $lib $libobjs $deplibs $linker_flags' hardcode_libdir_flag_spec_GCJ='-R$libdir' ;; *) archive_cmds_GCJ='$CC -shared $pic_flag -o $lib $libobjs $deplibs $compiler_flags' hardcode_libdir_flag_spec_GCJ='${wl}-rpath,$libdir' ;; esac fi ;; os2*) hardcode_libdir_flag_spec_GCJ='-L$libdir' hardcode_minus_L_GCJ=yes allow_undefined_flag_GCJ=unsupported archive_cmds_GCJ='$echo "LIBRARY $libname INITINSTANCE" > $output_objdir/$libname.def~$echo "DESCRIPTION \"$libname\"" >> $output_objdir/$libname.def~$echo DATA >> $output_objdir/$libname.def~$echo " SINGLE NONSHARED" >> $output_objdir/$libname.def~$echo EXPORTS >> $output_objdir/$libname.def~emxexp $libobjs >> $output_objdir/$libname.def~$CC -Zdll -Zcrtdll -o $lib $libobjs $deplibs $compiler_flags $output_objdir/$libname.def' old_archive_From_new_cmds_GCJ='emximp -o $output_objdir/$libname.a $output_objdir/$libname.def' ;; osf3*) if test "$GCC" = yes; then allow_undefined_flag_GCJ=' ${wl}-expect_unresolved ${wl}\*' archive_cmds_GCJ='$CC -shared${allow_undefined_flag} $libobjs $deplibs $compiler_flags ${wl}-soname ${wl}$soname `test -n "$verstring" && echo ${wl}-set_version ${wl}$verstring` ${wl}-update_registry ${wl}${output_objdir}/so_locations -o $lib' else allow_undefined_flag_GCJ=' -expect_unresolved \*' archive_cmds_GCJ='$LD -shared${allow_undefined_flag} $libobjs $deplibs $linker_flags -soname $soname `test -n "$verstring" && echo -set_version $verstring` -update_registry ${output_objdir}/so_locations -o $lib' fi hardcode_libdir_flag_spec_GCJ='${wl}-rpath ${wl}$libdir' hardcode_libdir_separator_GCJ=: ;; osf4* | osf5*) # as osf3* with the addition of -msym flag if test "$GCC" = yes; then allow_undefined_flag_GCJ=' ${wl}-expect_unresolved ${wl}\*' archive_cmds_GCJ='$CC -shared${allow_undefined_flag} $libobjs $deplibs $compiler_flags ${wl}-msym ${wl}-soname ${wl}$soname `test -n "$verstring" && echo ${wl}-set_version ${wl}$verstring` ${wl}-update_registry ${wl}${output_objdir}/so_locations -o $lib' hardcode_libdir_flag_spec_GCJ='${wl}-rpath ${wl}$libdir' else allow_undefined_flag_GCJ=' -expect_unresolved \*' archive_cmds_GCJ='$LD -shared${allow_undefined_flag} $libobjs $deplibs $linker_flags -msym -soname $soname `test -n "$verstring" && echo -set_version $verstring` -update_registry ${output_objdir}/so_locations -o $lib' archive_expsym_cmds_GCJ='for i in `cat $export_symbols`; do printf "%s %s\\n" -exported_symbol "\$i" >> $lib.exp; done; echo "-hidden">> $lib.exp~ $LD -shared${allow_undefined_flag} -input $lib.exp $linker_flags $libobjs $deplibs -soname $soname `test -n "$verstring" && echo -set_version $verstring` -update_registry ${objdir}/so_locations -o $lib~$rm $lib.exp' # Both c and cxx compiler support -rpath directly hardcode_libdir_flag_spec_GCJ='-rpath $libdir' fi hardcode_libdir_separator_GCJ=: ;; sco3.2v5*) archive_cmds_GCJ='$LD -G -h $soname -o $lib $libobjs $deplibs $linker_flags' hardcode_shlibpath_var_GCJ=no export_dynamic_flag_spec_GCJ='${wl}-Bexport' runpath_var=LD_RUN_PATH hardcode_runpath_var=yes ;; solaris*) no_undefined_flag_GCJ=' -z text' if test "$GCC" = yes; then archive_cmds_GCJ='$CC -shared ${wl}-h ${wl}$soname -o $lib $libobjs $deplibs $compiler_flags' archive_expsym_cmds_GCJ='$echo "{ global:" > $lib.exp~cat $export_symbols | $SED -e "s/\(.*\)/\1;/" >> $lib.exp~$echo "local: *; };" >> $lib.exp~ $CC -shared ${wl}-M ${wl}$lib.exp ${wl}-h ${wl}$soname -o $lib $libobjs $deplibs $compiler_flags~$rm $lib.exp' else archive_cmds_GCJ='$LD -G${allow_undefined_flag} -h $soname -o $lib $libobjs $deplibs $linker_flags' archive_expsym_cmds_GCJ='$echo "{ global:" > $lib.exp~cat $export_symbols | $SED -e "s/\(.*\)/\1;/" >> $lib.exp~$echo "local: *; };" >> $lib.exp~ $LD -G${allow_undefined_flag} -M $lib.exp -h $soname -o $lib $libobjs $deplibs $linker_flags~$rm $lib.exp' fi hardcode_libdir_flag_spec_GCJ='-R$libdir' hardcode_shlibpath_var_GCJ=no case $host_os in solaris2.[0-5] | solaris2.[0-5].*) ;; *) # Supported since Solaris 2.6 (maybe 2.5.1?) whole_archive_flag_spec_GCJ='-z allextract$convenience -z defaultextract' ;; esac link_all_deplibs_GCJ=yes ;; sunos4*) if test "x$host_vendor" = xsequent; then # Use $CC to link under sequent, because it throws in some extra .o # files that make .init and .fini sections work. archive_cmds_GCJ='$CC -G ${wl}-h $soname -o $lib $libobjs $deplibs $compiler_flags' else archive_cmds_GCJ='$LD -assert pure-text -Bstatic -o $lib $libobjs $deplibs $linker_flags' fi hardcode_libdir_flag_spec_GCJ='-L$libdir' hardcode_direct_GCJ=yes hardcode_minus_L_GCJ=yes hardcode_shlibpath_var_GCJ=no ;; sysv4) case $host_vendor in sni) archive_cmds_GCJ='$LD -G -h $soname -o $lib $libobjs $deplibs $linker_flags' hardcode_direct_GCJ=yes # is this really true??? ;; siemens) ## LD is ld it makes a PLAMLIB ## CC just makes a GrossModule. archive_cmds_GCJ='$LD -G -o $lib $libobjs $deplibs $linker_flags' reload_cmds_GCJ='$CC -r -o $output$reload_objs' hardcode_direct_GCJ=no ;; motorola) archive_cmds_GCJ='$LD -G -h $soname -o $lib $libobjs $deplibs $linker_flags' hardcode_direct_GCJ=no #Motorola manual says yes, but my tests say they lie ;; esac runpath_var='LD_RUN_PATH' hardcode_shlibpath_var_GCJ=no ;; sysv4.3*) archive_cmds_GCJ='$LD -G -h $soname -o $lib $libobjs $deplibs $linker_flags' hardcode_shlibpath_var_GCJ=no export_dynamic_flag_spec_GCJ='-Bexport' ;; sysv4*MP*) if test -d /usr/nec; then archive_cmds_GCJ='$LD -G -h $soname -o $lib $libobjs $deplibs $linker_flags' hardcode_shlibpath_var_GCJ=no runpath_var=LD_RUN_PATH hardcode_runpath_var=yes ld_shlibs_GCJ=yes fi ;; sysv4.2uw2*) archive_cmds_GCJ='$LD -G -o $lib $libobjs $deplibs $linker_flags' hardcode_direct_GCJ=yes hardcode_minus_L_GCJ=no hardcode_shlibpath_var_GCJ=no hardcode_runpath_var=yes runpath_var=LD_RUN_PATH ;; sysv5OpenUNIX8* | sysv5UnixWare7* | sysv5uw[78]* | unixware7*) no_undefined_flag_GCJ='${wl}-z ${wl}text' if test "$GCC" = yes; then archive_cmds_GCJ='$CC -shared ${wl}-h ${wl}$soname -o $lib $libobjs $deplibs $compiler_flags' else archive_cmds_GCJ='$CC -G ${wl}-h ${wl}$soname -o $lib $libobjs $deplibs $compiler_flags' fi runpath_var='LD_RUN_PATH' hardcode_shlibpath_var_GCJ=no ;; sysv5*) no_undefined_flag_GCJ=' -z text' # $CC -shared without GNU ld will not create a library from C++ # object files and a static libstdc++, better avoid it by now archive_cmds_GCJ='$LD -G${allow_undefined_flag} -h $soname -o $lib $libobjs $deplibs $linker_flags' archive_expsym_cmds_GCJ='$echo "{ global:" > $lib.exp~cat $export_symbols | $SED -e "s/\(.*\)/\1;/" >> $lib.exp~$echo "local: *; };" >> $lib.exp~ $LD -G${allow_undefined_flag} -M $lib.exp -h $soname -o $lib $libobjs $deplibs $linker_flags~$rm $lib.exp' hardcode_libdir_flag_spec_GCJ= hardcode_shlibpath_var_GCJ=no runpath_var='LD_RUN_PATH' ;; uts4*) archive_cmds_GCJ='$LD -G -h $soname -o $lib $libobjs $deplibs $linker_flags' hardcode_libdir_flag_spec_GCJ='-L$libdir' hardcode_shlibpath_var_GCJ=no ;; *) ld_shlibs_GCJ=no ;; esac fi echo "$as_me:$LINENO: result: $ld_shlibs_GCJ" >&5 echo "${ECHO_T}$ld_shlibs_GCJ" >&6 test "$ld_shlibs_GCJ" = no && can_build_shared=no variables_saved_for_relink="PATH $shlibpath_var $runpath_var" if test "$GCC" = yes; then variables_saved_for_relink="$variables_saved_for_relink GCC_EXEC_PREFIX COMPILER_PATH LIBRARY_PATH" fi # # Do we need to explicitly link libc? # case "x$archive_cmds_need_lc_GCJ" in x|xyes) # Assume -lc should be added archive_cmds_need_lc_GCJ=yes if test "$enable_shared" = yes && test "$GCC" = yes; then case $archive_cmds_GCJ in *'~'*) # FIXME: we may have to deal with multi-command sequences. ;; '$CC '*) # Test whether the compiler implicitly links with -lc since on some # systems, -lgcc has to come before -lc. If gcc already passes -lc # to ld, don't add -lc before -lgcc. echo "$as_me:$LINENO: checking whether -lc should be explicitly linked in" >&5 echo $ECHO_N "checking whether -lc should be explicitly linked in... $ECHO_C" >&6 $rm conftest* printf "$lt_simple_compile_test_code" > conftest.$ac_ext if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5 (eval $ac_compile) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } 2>conftest.err; then soname=conftest lib=conftest libobjs=conftest.$ac_objext deplibs= wl=$lt_prog_compiler_wl_GCJ compiler_flags=-v linker_flags=-v verstring= output_objdir=. libname=conftest lt_save_allow_undefined_flag=$allow_undefined_flag_GCJ allow_undefined_flag_GCJ= if { (eval echo "$as_me:$LINENO: \"$archive_cmds_GCJ 2\>\&1 \| grep \" -lc \" \>/dev/null 2\>\&1\"") >&5 (eval $archive_cmds_GCJ 2\>\&1 \| grep \" -lc \" \>/dev/null 2\>\&1) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } then archive_cmds_need_lc_GCJ=no else archive_cmds_need_lc_GCJ=yes fi allow_undefined_flag_GCJ=$lt_save_allow_undefined_flag else cat conftest.err 1>&5 fi $rm conftest* echo "$as_me:$LINENO: result: $archive_cmds_need_lc_GCJ" >&5 echo "${ECHO_T}$archive_cmds_need_lc_GCJ" >&6 ;; esac fi ;; esac echo "$as_me:$LINENO: checking dynamic linker characteristics" >&5 echo $ECHO_N "checking dynamic linker characteristics... $ECHO_C" >&6 library_names_spec= libname_spec='lib$name' soname_spec= shrext_cmds=".so" postinstall_cmds= postuninstall_cmds= finish_cmds= finish_eval= shlibpath_var= shlibpath_overrides_runpath=unknown version_type=none dynamic_linker="$host_os ld.so" sys_lib_dlsearch_path_spec="/lib /usr/lib" if test "$GCC" = yes; then sys_lib_search_path_spec=`$CC -print-search-dirs | grep "^libraries:" | $SED -e "s/^libraries://" -e "s,=/,/,g"` if echo "$sys_lib_search_path_spec" | grep ';' >/dev/null ; then # if the path contains ";" then we assume it to be the separator # otherwise default to the standard path separator (i.e. ":") - it is # assumed that no part of a normal pathname contains ";" but that should # okay in the real world where ";" in dirpaths is itself problematic. sys_lib_search_path_spec=`echo "$sys_lib_search_path_spec" | $SED -e 's/;/ /g'` else sys_lib_search_path_spec=`echo "$sys_lib_search_path_spec" | $SED -e "s/$PATH_SEPARATOR/ /g"` fi else sys_lib_search_path_spec="/lib /usr/lib /usr/local/lib" fi need_lib_prefix=unknown hardcode_into_libs=no # when you set need_version to no, make sure it does not cause -set_version # flags to be left without arguments need_version=unknown case $host_os in aix3*) version_type=linux library_names_spec='${libname}${release}${shared_ext}$versuffix $libname.a' shlibpath_var=LIBPATH # AIX 3 has no versioning support, so we append a major version to the name. soname_spec='${libname}${release}${shared_ext}$major' ;; aix4* | aix5*) version_type=linux need_lib_prefix=no need_version=no hardcode_into_libs=yes if test "$host_cpu" = ia64; then # AIX 5 supports IA64 library_names_spec='${libname}${release}${shared_ext}$major ${libname}${release}${shared_ext}$versuffix $libname${shared_ext}' shlibpath_var=LD_LIBRARY_PATH else # With GCC up to 2.95.x, collect2 would create an import file # for dependence libraries. The import file would start with # the line `#! .'. This would cause the generated library to # depend on `.', always an invalid library. This was fixed in # development snapshots of GCC prior to 3.0. case $host_os in aix4 | aix4.[01] | aix4.[01].*) if { echo '#if __GNUC__ > 2 || (__GNUC__ == 2 && __GNUC_MINOR__ >= 97)' echo ' yes ' echo '#endif'; } | ${CC} -E - | grep yes > /dev/null; then : else can_build_shared=no fi ;; esac # AIX (on Power*) has no versioning support, so currently we can not hardcode correct # soname into executable. Probably we can add versioning support to # collect2, so additional links can be useful in future. if test "$aix_use_runtimelinking" = yes; then # If using run time linking (on AIX 4.2 or later) use lib.so # instead of lib.a to let people know that these are not # typical AIX shared libraries. library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' else # We preserve .a as extension for shared libraries through AIX4.2 # and later when we are not doing run time linking. library_names_spec='${libname}${release}.a $libname.a' soname_spec='${libname}${release}${shared_ext}$major' fi shlibpath_var=LIBPATH fi ;; amigaos*) library_names_spec='$libname.ixlibrary $libname.a' # Create ${libname}_ixlibrary.a entries in /sys/libs. finish_eval='for lib in `ls $libdir/*.ixlibrary 2>/dev/null`; do libname=`$echo "X$lib" | $Xsed -e '\''s%^.*/\([^/]*\)\.ixlibrary$%\1%'\''`; test $rm /sys/libs/${libname}_ixlibrary.a; $show "cd /sys/libs && $LN_S $lib ${libname}_ixlibrary.a"; cd /sys/libs && $LN_S $lib ${libname}_ixlibrary.a || exit 1; done' ;; beos*) library_names_spec='${libname}${shared_ext}' dynamic_linker="$host_os ld.so" shlibpath_var=LIBRARY_PATH ;; bsdi[45]*) version_type=linux need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' finish_cmds='PATH="\$PATH:/sbin" ldconfig $libdir' shlibpath_var=LD_LIBRARY_PATH sys_lib_search_path_spec="/shlib /usr/lib /usr/X11/lib /usr/contrib/lib /lib /usr/local/lib" sys_lib_dlsearch_path_spec="/shlib /usr/lib /usr/local/lib" # the default ld.so.conf also contains /usr/contrib/lib and # /usr/X11R6/lib (/usr/X11 is a link to /usr/X11R6), but let us allow # libtool to hard-code these into programs ;; cygwin* | mingw* | pw32*) version_type=windows shrext_cmds=".dll" need_version=no need_lib_prefix=no case $GCC,$host_os in yes,cygwin* | yes,mingw* | yes,pw32*) library_names_spec='$libname.dll.a' # DLL is installed to $(libdir)/../bin by postinstall_cmds postinstall_cmds='base_file=`basename \${file}`~ dlpath=`$SHELL 2>&1 -c '\''. $dir/'\''\${base_file}'\''i;echo \$dlname'\''`~ dldir=$destdir/`dirname \$dlpath`~ test -d \$dldir || mkdir -p \$dldir~ $install_prog $dir/$dlname \$dldir/$dlname' postuninstall_cmds='dldll=`$SHELL 2>&1 -c '\''. $file; echo \$dlname'\''`~ dlpath=$dir/\$dldll~ $rm \$dlpath' shlibpath_overrides_runpath=yes case $host_os in cygwin*) # Cygwin DLLs use 'cyg' prefix rather than 'lib' soname_spec='`echo ${libname} | sed -e 's/^lib/cyg/'``echo ${release} | $SED -e 's/[.]/-/g'`${versuffix}${shared_ext}' sys_lib_search_path_spec="/usr/lib /lib/w32api /lib /usr/local/lib" ;; mingw*) # MinGW DLLs use traditional 'lib' prefix soname_spec='${libname}`echo ${release} | $SED -e 's/[.]/-/g'`${versuffix}${shared_ext}' sys_lib_search_path_spec=`$CC -print-search-dirs | grep "^libraries:" | $SED -e "s/^libraries://" -e "s,=/,/,g"` if echo "$sys_lib_search_path_spec" | grep ';[c-zC-Z]:/' >/dev/null; then # It is most probably a Windows format PATH printed by # mingw gcc, but we are running on Cygwin. Gcc prints its search # path with ; separators, and with drive letters. We can handle the # drive letters (cygwin fileutils understands them), so leave them, # especially as we might pass files found there to a mingw objdump, # which wouldn't understand a cygwinified path. Ahh. sys_lib_search_path_spec=`echo "$sys_lib_search_path_spec" | $SED -e 's/;/ /g'` else sys_lib_search_path_spec=`echo "$sys_lib_search_path_spec" | $SED -e "s/$PATH_SEPARATOR/ /g"` fi ;; pw32*) # pw32 DLLs use 'pw' prefix rather than 'lib' library_names_spec='`echo ${libname} | sed -e 's/^lib/pw/'``echo ${release} | $SED -e 's/./-/g'`${versuffix}${shared_ext}' ;; esac ;; *) library_names_spec='${libname}`echo ${release} | $SED -e 's/[.]/-/g'`${versuffix}${shared_ext} $libname.lib' ;; esac dynamic_linker='Win32 ld.exe' # FIXME: first we should search . and the directory the executable is in shlibpath_var=PATH ;; darwin* | rhapsody*) dynamic_linker="$host_os dyld" version_type=darwin need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${versuffix}$shared_ext ${libname}${release}${major}$shared_ext ${libname}$shared_ext' soname_spec='${libname}${release}${major}$shared_ext' shlibpath_overrides_runpath=yes shlibpath_var=DYLD_LIBRARY_PATH shrext_cmds='$(test .$module = .yes && echo .so || echo .dylib)' # Apple's gcc prints 'gcc -print-search-dirs' doesn't operate the same. if test "$GCC" = yes; then sys_lib_search_path_spec=`$CC -print-search-dirs | tr "\n" "$PATH_SEPARATOR" | sed -e 's/libraries:/@libraries:/' | tr "@" "\n" | grep "^libraries:" | sed -e "s/^libraries://" -e "s,=/,/,g" -e "s,$PATH_SEPARATOR, ,g" -e "s,.*,& /lib /usr/lib /usr/local/lib,g"` else sys_lib_search_path_spec='/lib /usr/lib /usr/local/lib' fi sys_lib_dlsearch_path_spec='/usr/local/lib /lib /usr/lib' ;; dgux*) version_type=linux need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname$shared_ext' soname_spec='${libname}${release}${shared_ext}$major' shlibpath_var=LD_LIBRARY_PATH ;; freebsd1*) dynamic_linker=no ;; kfreebsd*-gnu) version_type=linux need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major ${libname}${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=no hardcode_into_libs=yes dynamic_linker='GNU ld.so' ;; freebsd*) objformat=`test -x /usr/bin/objformat && /usr/bin/objformat || echo aout` version_type=freebsd-$objformat case $version_type in freebsd-elf*) library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext} $libname${shared_ext}' need_version=no need_lib_prefix=no ;; freebsd-*) library_names_spec='${libname}${release}${shared_ext}$versuffix $libname${shared_ext}$versuffix' need_version=yes ;; esac shlibpath_var=LD_LIBRARY_PATH case $host_os in freebsd2*) shlibpath_overrides_runpath=yes ;; freebsd3.01* | freebsdelf3.01*) shlibpath_overrides_runpath=yes hardcode_into_libs=yes ;; *) # from 3.2 on shlibpath_overrides_runpath=no hardcode_into_libs=yes ;; esac ;; gnu*) version_type=linux need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}${major} ${libname}${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' shlibpath_var=LD_LIBRARY_PATH hardcode_into_libs=yes ;; hpux9* | hpux10* | hpux11*) # Give a soname corresponding to the major version so that dld.sl refuses to # link against other versions. version_type=sunos need_lib_prefix=no need_version=no case "$host_cpu" in ia64*) shrext_cmds='.so' hardcode_into_libs=yes dynamic_linker="$host_os dld.so" shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=yes # Unless +noenvvar is specified. library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' if test "X$HPUX_IA64_MODE" = X32; then sys_lib_search_path_spec="/usr/lib/hpux32 /usr/local/lib/hpux32 /usr/local/lib" else sys_lib_search_path_spec="/usr/lib/hpux64 /usr/local/lib/hpux64" fi sys_lib_dlsearch_path_spec=$sys_lib_search_path_spec ;; hppa*64*) shrext_cmds='.sl' hardcode_into_libs=yes dynamic_linker="$host_os dld.sl" shlibpath_var=LD_LIBRARY_PATH # How should we handle SHLIB_PATH shlibpath_overrides_runpath=yes # Unless +noenvvar is specified. library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' sys_lib_search_path_spec="/usr/lib/pa20_64 /usr/ccs/lib/pa20_64" sys_lib_dlsearch_path_spec=$sys_lib_search_path_spec ;; *) shrext_cmds='.sl' dynamic_linker="$host_os dld.sl" shlibpath_var=SHLIB_PATH shlibpath_overrides_runpath=no # +s is required to enable SHLIB_PATH library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' ;; esac # HP-UX runs *really* slowly unless shared libraries are mode 555. postinstall_cmds='chmod 555 $lib' ;; irix5* | irix6* | nonstopux*) case $host_os in nonstopux*) version_type=nonstopux ;; *) if test "$lt_cv_prog_gnu_ld" = yes; then version_type=linux else version_type=irix fi ;; esac need_lib_prefix=no need_version=no soname_spec='${libname}${release}${shared_ext}$major' library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major ${libname}${release}${shared_ext} $libname${shared_ext}' case $host_os in irix5* | nonstopux*) libsuff= shlibsuff= ;; *) case $LD in # libtool.m4 will add one of these switches to LD *-32|*"-32 "|*-melf32bsmip|*"-melf32bsmip ") libsuff= shlibsuff= libmagic=32-bit;; *-n32|*"-n32 "|*-melf32bmipn32|*"-melf32bmipn32 ") libsuff=32 shlibsuff=N32 libmagic=N32;; *-64|*"-64 "|*-melf64bmip|*"-melf64bmip ") libsuff=64 shlibsuff=64 libmagic=64-bit;; *) libsuff= shlibsuff= libmagic=never-match;; esac ;; esac shlibpath_var=LD_LIBRARY${shlibsuff}_PATH shlibpath_overrides_runpath=no sys_lib_search_path_spec="/usr/lib${libsuff} /lib${libsuff} /usr/local/lib${libsuff}" sys_lib_dlsearch_path_spec="/usr/lib${libsuff} /lib${libsuff}" hardcode_into_libs=yes ;; # No shared lib support for Linux oldld, aout, or coff. linux*oldld* | linux*aout* | linux*coff*) dynamic_linker=no ;; # This must be Linux ELF. linux*) version_type=linux need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' finish_cmds='PATH="\$PATH:/sbin" ldconfig -n $libdir' shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=no # This implies no fast_install, which is unacceptable. # Some rework will be needed to allow for fast_install # before this can be enabled. hardcode_into_libs=yes # Append ld.so.conf contents to the search path if test -f /etc/ld.so.conf; then lt_ld_extra=`$SED -e 's/:,\t/ /g;s/=^=*$//;s/=^= * / /g' /etc/ld.so.conf | tr '\n' ' '` sys_lib_dlsearch_path_spec="/lib /usr/lib $lt_ld_extra" fi # We used to test for /lib/ld.so.1 and disable shared libraries on # powerpc, because MkLinux only supported shared libraries with the # GNU dynamic linker. Since this was broken with cross compilers, # most powerpc-linux boxes support dynamic linking these days and # people can always --disable-shared, the test was removed, and we # assume the GNU/Linux dynamic linker is in use. dynamic_linker='GNU/Linux ld.so' ;; knetbsd*-gnu) version_type=linux need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major ${libname}${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=no hardcode_into_libs=yes dynamic_linker='GNU ld.so' ;; netbsd*) version_type=sunos need_lib_prefix=no need_version=no if echo __ELF__ | $CC -E - | grep __ELF__ >/dev/null; then library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${shared_ext}$versuffix' finish_cmds='PATH="\$PATH:/sbin" ldconfig -m $libdir' dynamic_linker='NetBSD (a.out) ld.so' else library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major ${libname}${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' dynamic_linker='NetBSD ld.elf_so' fi shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=yes hardcode_into_libs=yes ;; newsos6) version_type=linux library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=yes ;; nto-qnx*) version_type=linux need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=yes ;; openbsd*) version_type=sunos need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${shared_ext}$versuffix' finish_cmds='PATH="\$PATH:/sbin" ldconfig -m $libdir' shlibpath_var=LD_LIBRARY_PATH if test -z "`echo __ELF__ | $CC -E - | grep __ELF__`" || test "$host_os-$host_cpu" = "openbsd2.8-powerpc"; then case $host_os in openbsd2.[89] | openbsd2.[89].*) shlibpath_overrides_runpath=no ;; *) shlibpath_overrides_runpath=yes ;; esac else shlibpath_overrides_runpath=yes fi ;; os2*) libname_spec='$name' shrext_cmds=".dll" need_lib_prefix=no library_names_spec='$libname${shared_ext} $libname.a' dynamic_linker='OS/2 ld.exe' shlibpath_var=LIBPATH ;; osf3* | osf4* | osf5*) version_type=osf need_lib_prefix=no need_version=no soname_spec='${libname}${release}${shared_ext}$major' library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' shlibpath_var=LD_LIBRARY_PATH sys_lib_search_path_spec="/usr/shlib /usr/ccs/lib /usr/lib/cmplrs/cc /usr/lib /usr/local/lib /var/shlib" sys_lib_dlsearch_path_spec="$sys_lib_search_path_spec" ;; sco3.2v5*) version_type=osf soname_spec='${libname}${release}${shared_ext}$major' library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' shlibpath_var=LD_LIBRARY_PATH ;; solaris*) version_type=linux need_lib_prefix=no need_version=no library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=yes hardcode_into_libs=yes # ldd complains unless libraries are executable postinstall_cmds='chmod +x $lib' ;; sunos4*) version_type=sunos library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${shared_ext}$versuffix' finish_cmds='PATH="\$PATH:/usr/etc" ldconfig $libdir' shlibpath_var=LD_LIBRARY_PATH shlibpath_overrides_runpath=yes if test "$with_gnu_ld" = yes; then need_lib_prefix=no fi need_version=yes ;; sysv4 | sysv4.2uw2* | sysv4.3* | sysv5*) version_type=linux library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' shlibpath_var=LD_LIBRARY_PATH case $host_vendor in sni) shlibpath_overrides_runpath=no need_lib_prefix=no export_dynamic_flag_spec='${wl}-Blargedynsym' runpath_var=LD_RUN_PATH ;; siemens) need_lib_prefix=no ;; motorola) need_lib_prefix=no need_version=no shlibpath_overrides_runpath=no sys_lib_search_path_spec='/lib /usr/lib /usr/ccs/lib' ;; esac ;; sysv4*MP*) if test -d /usr/nec ;then version_type=linux library_names_spec='$libname${shared_ext}.$versuffix $libname${shared_ext}.$major $libname${shared_ext}' soname_spec='$libname${shared_ext}.$major' shlibpath_var=LD_LIBRARY_PATH fi ;; uts4*) version_type=linux library_names_spec='${libname}${release}${shared_ext}$versuffix ${libname}${release}${shared_ext}$major $libname${shared_ext}' soname_spec='${libname}${release}${shared_ext}$major' shlibpath_var=LD_LIBRARY_PATH ;; *) dynamic_linker=no ;; esac echo "$as_me:$LINENO: result: $dynamic_linker" >&5 echo "${ECHO_T}$dynamic_linker" >&6 test "$dynamic_linker" = no && can_build_shared=no echo "$as_me:$LINENO: checking how to hardcode library paths into programs" >&5 echo $ECHO_N "checking how to hardcode library paths into programs... $ECHO_C" >&6 hardcode_action_GCJ= if test -n "$hardcode_libdir_flag_spec_GCJ" || \ test -n "$runpath_var_GCJ" || \ test "X$hardcode_automatic_GCJ" = "Xyes" ; then # We can hardcode non-existant directories. if test "$hardcode_direct_GCJ" != no && # If the only mechanism to avoid hardcoding is shlibpath_var, we # have to relink, otherwise we might link with an installed library # when we should be linking with a yet-to-be-installed one ## test "$_LT_AC_TAGVAR(hardcode_shlibpath_var, GCJ)" != no && test "$hardcode_minus_L_GCJ" != no; then # Linking always hardcodes the temporary library directory. hardcode_action_GCJ=relink else # We can link without hardcoding, and we can hardcode nonexisting dirs. hardcode_action_GCJ=immediate fi else # We cannot hardcode anything, or else we can only hardcode existing # directories. hardcode_action_GCJ=unsupported fi echo "$as_me:$LINENO: result: $hardcode_action_GCJ" >&5 echo "${ECHO_T}$hardcode_action_GCJ" >&6 if test "$hardcode_action_GCJ" = relink; then # Fast installation is not supported enable_fast_install=no elif test "$shlibpath_overrides_runpath" = yes || test "$enable_shared" = no; then # Fast installation is not necessary enable_fast_install=needless fi striplib= old_striplib= echo "$as_me:$LINENO: checking whether stripping libraries is possible" >&5 echo $ECHO_N "checking whether stripping libraries is possible... $ECHO_C" >&6 if test -n "$STRIP" && $STRIP -V 2>&1 | grep "GNU strip" >/dev/null; then test -z "$old_striplib" && old_striplib="$STRIP --strip-debug" test -z "$striplib" && striplib="$STRIP --strip-unneeded" echo "$as_me:$LINENO: result: yes" >&5 echo "${ECHO_T}yes" >&6 else # FIXME - insert some real tests, host_os isn't really good enough case $host_os in darwin*) if test -n "$STRIP" ; then striplib="$STRIP -x" echo "$as_me:$LINENO: result: yes" >&5 echo "${ECHO_T}yes" >&6 else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 fi ;; *) echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 ;; esac fi if test "x$enable_dlopen" != xyes; then enable_dlopen=unknown enable_dlopen_self=unknown enable_dlopen_self_static=unknown else lt_cv_dlopen=no lt_cv_dlopen_libs= case $host_os in beos*) lt_cv_dlopen="load_add_on" lt_cv_dlopen_libs= lt_cv_dlopen_self=yes ;; mingw* | pw32*) lt_cv_dlopen="LoadLibrary" lt_cv_dlopen_libs= ;; cygwin*) lt_cv_dlopen="dlopen" lt_cv_dlopen_libs= ;; darwin*) # if libdl is installed we need to link against it echo "$as_me:$LINENO: checking for dlopen in -ldl" >&5 echo $ECHO_N "checking for dlopen in -ldl... $ECHO_C" >&6 if test "${ac_cv_lib_dl_dlopen+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else ac_check_lib_save_LIBS=$LIBS LIBS="-ldl $LIBS" cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ /* Override any gcc2 internal prototype to avoid an error. */ #ifdef __cplusplus extern "C" #endif /* We use char because int might match the return type of a gcc2 builtin and then its argument prototype would still apply. */ char dlopen (); int main () { dlopen (); ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then ac_cv_lib_dl_dlopen=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_cv_lib_dl_dlopen=no fi rm -f conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext LIBS=$ac_check_lib_save_LIBS fi echo "$as_me:$LINENO: result: $ac_cv_lib_dl_dlopen" >&5 echo "${ECHO_T}$ac_cv_lib_dl_dlopen" >&6 if test $ac_cv_lib_dl_dlopen = yes; then lt_cv_dlopen="dlopen" lt_cv_dlopen_libs="-ldl" else lt_cv_dlopen="dyld" lt_cv_dlopen_libs= lt_cv_dlopen_self=yes fi ;; *) echo "$as_me:$LINENO: checking for shl_load" >&5 echo $ECHO_N "checking for shl_load... $ECHO_C" >&6 if test "${ac_cv_func_shl_load+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ /* Define shl_load to an innocuous variant, in case declares shl_load. For example, HP-UX 11i declares gettimeofday. */ #define shl_load innocuous_shl_load /* System header to define __stub macros and hopefully few prototypes, which can conflict with char shl_load (); below. Prefer to if __STDC__ is defined, since exists even on freestanding compilers. */ #ifdef __STDC__ # include #else # include #endif #undef shl_load /* Override any gcc2 internal prototype to avoid an error. */ #ifdef __cplusplus extern "C" { #endif /* We use char because int might match the return type of a gcc2 builtin and then its argument prototype would still apply. */ char shl_load (); /* The GNU C library defines this for functions which it implements to always fail with ENOSYS. Some functions are actually named something starting with __ and the normal name is an alias. */ #if defined (__stub_shl_load) || defined (__stub___shl_load) choke me #else char (*f) () = shl_load; #endif #ifdef __cplusplus } #endif int main () { return f != shl_load; ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then ac_cv_func_shl_load=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_cv_func_shl_load=no fi rm -f conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext fi echo "$as_me:$LINENO: result: $ac_cv_func_shl_load" >&5 echo "${ECHO_T}$ac_cv_func_shl_load" >&6 if test $ac_cv_func_shl_load = yes; then lt_cv_dlopen="shl_load" else echo "$as_me:$LINENO: checking for shl_load in -ldld" >&5 echo $ECHO_N "checking for shl_load in -ldld... $ECHO_C" >&6 if test "${ac_cv_lib_dld_shl_load+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else ac_check_lib_save_LIBS=$LIBS LIBS="-ldld $LIBS" cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ /* Override any gcc2 internal prototype to avoid an error. */ #ifdef __cplusplus extern "C" #endif /* We use char because int might match the return type of a gcc2 builtin and then its argument prototype would still apply. */ char shl_load (); int main () { shl_load (); ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then ac_cv_lib_dld_shl_load=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_cv_lib_dld_shl_load=no fi rm -f conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext LIBS=$ac_check_lib_save_LIBS fi echo "$as_me:$LINENO: result: $ac_cv_lib_dld_shl_load" >&5 echo "${ECHO_T}$ac_cv_lib_dld_shl_load" >&6 if test $ac_cv_lib_dld_shl_load = yes; then lt_cv_dlopen="shl_load" lt_cv_dlopen_libs="-dld" else echo "$as_me:$LINENO: checking for dlopen" >&5 echo $ECHO_N "checking for dlopen... $ECHO_C" >&6 if test "${ac_cv_func_dlopen+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ /* Define dlopen to an innocuous variant, in case declares dlopen. For example, HP-UX 11i declares gettimeofday. */ #define dlopen innocuous_dlopen /* System header to define __stub macros and hopefully few prototypes, which can conflict with char dlopen (); below. Prefer to if __STDC__ is defined, since exists even on freestanding compilers. */ #ifdef __STDC__ # include #else # include #endif #undef dlopen /* Override any gcc2 internal prototype to avoid an error. */ #ifdef __cplusplus extern "C" { #endif /* We use char because int might match the return type of a gcc2 builtin and then its argument prototype would still apply. */ char dlopen (); /* The GNU C library defines this for functions which it implements to always fail with ENOSYS. Some functions are actually named something starting with __ and the normal name is an alias. */ #if defined (__stub_dlopen) || defined (__stub___dlopen) choke me #else char (*f) () = dlopen; #endif #ifdef __cplusplus } #endif int main () { return f != dlopen; ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then ac_cv_func_dlopen=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_cv_func_dlopen=no fi rm -f conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext fi echo "$as_me:$LINENO: result: $ac_cv_func_dlopen" >&5 echo "${ECHO_T}$ac_cv_func_dlopen" >&6 if test $ac_cv_func_dlopen = yes; then lt_cv_dlopen="dlopen" else echo "$as_me:$LINENO: checking for dlopen in -ldl" >&5 echo $ECHO_N "checking for dlopen in -ldl... $ECHO_C" >&6 if test "${ac_cv_lib_dl_dlopen+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else ac_check_lib_save_LIBS=$LIBS LIBS="-ldl $LIBS" cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ /* Override any gcc2 internal prototype to avoid an error. */ #ifdef __cplusplus extern "C" #endif /* We use char because int might match the return type of a gcc2 builtin and then its argument prototype would still apply. */ char dlopen (); int main () { dlopen (); ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then ac_cv_lib_dl_dlopen=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_cv_lib_dl_dlopen=no fi rm -f conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext LIBS=$ac_check_lib_save_LIBS fi echo "$as_me:$LINENO: result: $ac_cv_lib_dl_dlopen" >&5 echo "${ECHO_T}$ac_cv_lib_dl_dlopen" >&6 if test $ac_cv_lib_dl_dlopen = yes; then lt_cv_dlopen="dlopen" lt_cv_dlopen_libs="-ldl" else echo "$as_me:$LINENO: checking for dlopen in -lsvld" >&5 echo $ECHO_N "checking for dlopen in -lsvld... $ECHO_C" >&6 if test "${ac_cv_lib_svld_dlopen+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else ac_check_lib_save_LIBS=$LIBS LIBS="-lsvld $LIBS" cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ /* Override any gcc2 internal prototype to avoid an error. */ #ifdef __cplusplus extern "C" #endif /* We use char because int might match the return type of a gcc2 builtin and then its argument prototype would still apply. */ char dlopen (); int main () { dlopen (); ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then ac_cv_lib_svld_dlopen=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_cv_lib_svld_dlopen=no fi rm -f conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext LIBS=$ac_check_lib_save_LIBS fi echo "$as_me:$LINENO: result: $ac_cv_lib_svld_dlopen" >&5 echo "${ECHO_T}$ac_cv_lib_svld_dlopen" >&6 if test $ac_cv_lib_svld_dlopen = yes; then lt_cv_dlopen="dlopen" lt_cv_dlopen_libs="-lsvld" else echo "$as_me:$LINENO: checking for dld_link in -ldld" >&5 echo $ECHO_N "checking for dld_link in -ldld... $ECHO_C" >&6 if test "${ac_cv_lib_dld_dld_link+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else ac_check_lib_save_LIBS=$LIBS LIBS="-ldld $LIBS" cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ /* Override any gcc2 internal prototype to avoid an error. */ #ifdef __cplusplus extern "C" #endif /* We use char because int might match the return type of a gcc2 builtin and then its argument prototype would still apply. */ char dld_link (); int main () { dld_link (); ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then ac_cv_lib_dld_dld_link=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_cv_lib_dld_dld_link=no fi rm -f conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext LIBS=$ac_check_lib_save_LIBS fi echo "$as_me:$LINENO: result: $ac_cv_lib_dld_dld_link" >&5 echo "${ECHO_T}$ac_cv_lib_dld_dld_link" >&6 if test $ac_cv_lib_dld_dld_link = yes; then lt_cv_dlopen="dld_link" lt_cv_dlopen_libs="-dld" fi fi fi fi fi fi ;; esac if test "x$lt_cv_dlopen" != xno; then enable_dlopen=yes else enable_dlopen=no fi case $lt_cv_dlopen in dlopen) save_CPPFLAGS="$CPPFLAGS" test "x$ac_cv_header_dlfcn_h" = xyes && CPPFLAGS="$CPPFLAGS -DHAVE_DLFCN_H" save_LDFLAGS="$LDFLAGS" eval LDFLAGS=\"\$LDFLAGS $export_dynamic_flag_spec\" save_LIBS="$LIBS" LIBS="$lt_cv_dlopen_libs $LIBS" echo "$as_me:$LINENO: checking whether a program can dlopen itself" >&5 echo $ECHO_N "checking whether a program can dlopen itself... $ECHO_C" >&6 if test "${lt_cv_dlopen_self+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test "$cross_compiling" = yes; then : lt_cv_dlopen_self=cross else lt_dlunknown=0; lt_dlno_uscore=1; lt_dlneed_uscore=2 lt_status=$lt_dlunknown cat > conftest.$ac_ext < #endif #include #ifdef RTLD_GLOBAL # define LT_DLGLOBAL RTLD_GLOBAL #else # ifdef DL_GLOBAL # define LT_DLGLOBAL DL_GLOBAL # else # define LT_DLGLOBAL 0 # endif #endif /* We may have to define LT_DLLAZY_OR_NOW in the command line if we find out it does not work in some platform. */ #ifndef LT_DLLAZY_OR_NOW # ifdef RTLD_LAZY # define LT_DLLAZY_OR_NOW RTLD_LAZY # else # ifdef DL_LAZY # define LT_DLLAZY_OR_NOW DL_LAZY # else # ifdef RTLD_NOW # define LT_DLLAZY_OR_NOW RTLD_NOW # else # ifdef DL_NOW # define LT_DLLAZY_OR_NOW DL_NOW # else # define LT_DLLAZY_OR_NOW 0 # endif # endif # endif # endif #endif #ifdef __cplusplus extern "C" void exit (int); #endif void fnord() { int i=42;} int main () { void *self = dlopen (0, LT_DLGLOBAL|LT_DLLAZY_OR_NOW); int status = $lt_dlunknown; if (self) { if (dlsym (self,"fnord")) status = $lt_dlno_uscore; else if (dlsym( self,"_fnord")) status = $lt_dlneed_uscore; /* dlclose (self); */ } exit (status); } EOF if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && test -s conftest${ac_exeext} 2>/dev/null; then (./conftest; exit; ) 2>/dev/null lt_status=$? case x$lt_status in x$lt_dlno_uscore) lt_cv_dlopen_self=yes ;; x$lt_dlneed_uscore) lt_cv_dlopen_self=yes ;; x$lt_unknown|x*) lt_cv_dlopen_self=no ;; esac else : # compilation failed lt_cv_dlopen_self=no fi fi rm -fr conftest* fi echo "$as_me:$LINENO: result: $lt_cv_dlopen_self" >&5 echo "${ECHO_T}$lt_cv_dlopen_self" >&6 if test "x$lt_cv_dlopen_self" = xyes; then LDFLAGS="$LDFLAGS $link_static_flag" echo "$as_me:$LINENO: checking whether a statically linked program can dlopen itself" >&5 echo $ECHO_N "checking whether a statically linked program can dlopen itself... $ECHO_C" >&6 if test "${lt_cv_dlopen_self_static+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else if test "$cross_compiling" = yes; then : lt_cv_dlopen_self_static=cross else lt_dlunknown=0; lt_dlno_uscore=1; lt_dlneed_uscore=2 lt_status=$lt_dlunknown cat > conftest.$ac_ext < #endif #include #ifdef RTLD_GLOBAL # define LT_DLGLOBAL RTLD_GLOBAL #else # ifdef DL_GLOBAL # define LT_DLGLOBAL DL_GLOBAL # else # define LT_DLGLOBAL 0 # endif #endif /* We may have to define LT_DLLAZY_OR_NOW in the command line if we find out it does not work in some platform. */ #ifndef LT_DLLAZY_OR_NOW # ifdef RTLD_LAZY # define LT_DLLAZY_OR_NOW RTLD_LAZY # else # ifdef DL_LAZY # define LT_DLLAZY_OR_NOW DL_LAZY # else # ifdef RTLD_NOW # define LT_DLLAZY_OR_NOW RTLD_NOW # else # ifdef DL_NOW # define LT_DLLAZY_OR_NOW DL_NOW # else # define LT_DLLAZY_OR_NOW 0 # endif # endif # endif # endif #endif #ifdef __cplusplus extern "C" void exit (int); #endif void fnord() { int i=42;} int main () { void *self = dlopen (0, LT_DLGLOBAL|LT_DLLAZY_OR_NOW); int status = $lt_dlunknown; if (self) { if (dlsym (self,"fnord")) status = $lt_dlno_uscore; else if (dlsym( self,"_fnord")) status = $lt_dlneed_uscore; /* dlclose (self); */ } exit (status); } EOF if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && test -s conftest${ac_exeext} 2>/dev/null; then (./conftest; exit; ) 2>/dev/null lt_status=$? case x$lt_status in x$lt_dlno_uscore) lt_cv_dlopen_self_static=yes ;; x$lt_dlneed_uscore) lt_cv_dlopen_self_static=yes ;; x$lt_unknown|x*) lt_cv_dlopen_self_static=no ;; esac else : # compilation failed lt_cv_dlopen_self_static=no fi fi rm -fr conftest* fi echo "$as_me:$LINENO: result: $lt_cv_dlopen_self_static" >&5 echo "${ECHO_T}$lt_cv_dlopen_self_static" >&6 fi CPPFLAGS="$save_CPPFLAGS" LDFLAGS="$save_LDFLAGS" LIBS="$save_LIBS" ;; esac case $lt_cv_dlopen_self in yes|no) enable_dlopen_self=$lt_cv_dlopen_self ;; *) enable_dlopen_self=unknown ;; esac case $lt_cv_dlopen_self_static in yes|no) enable_dlopen_self_static=$lt_cv_dlopen_self_static ;; *) enable_dlopen_self_static=unknown ;; esac fi # The else clause should only fire when bootstrapping the # libtool distribution, otherwise you forgot to ship ltmain.sh # with your package, and you will get complaints that there are # no rules to generate ltmain.sh. if test -f "$ltmain"; then # See if we are running on zsh, and set the options which allow our commands through # without removal of \ escapes. if test -n "${ZSH_VERSION+set}" ; then setopt NO_GLOB_SUBST fi # Now quote all the things that may contain metacharacters while being # careful not to overquote the AC_SUBSTed values. We take copies of the # variables and quote the copies for generation of the libtool script. for var in echo old_CC old_CFLAGS AR AR_FLAGS EGREP RANLIB LN_S LTCC NM \ SED SHELL STRIP \ libname_spec library_names_spec soname_spec extract_expsyms_cmds \ old_striplib striplib file_magic_cmd finish_cmds finish_eval \ deplibs_check_method reload_flag reload_cmds need_locks \ lt_cv_sys_global_symbol_pipe lt_cv_sys_global_symbol_to_cdecl \ lt_cv_sys_global_symbol_to_c_name_address \ sys_lib_search_path_spec sys_lib_dlsearch_path_spec \ old_postinstall_cmds old_postuninstall_cmds \ compiler_GCJ \ CC_GCJ \ LD_GCJ \ lt_prog_compiler_wl_GCJ \ lt_prog_compiler_pic_GCJ \ lt_prog_compiler_static_GCJ \ lt_prog_compiler_no_builtin_flag_GCJ \ export_dynamic_flag_spec_GCJ \ thread_safe_flag_spec_GCJ \ whole_archive_flag_spec_GCJ \ enable_shared_with_static_runtimes_GCJ \ old_archive_cmds_GCJ \ old_archive_from_new_cmds_GCJ \ predep_objects_GCJ \ postdep_objects_GCJ \ predeps_GCJ \ postdeps_GCJ \ compiler_lib_search_path_GCJ \ archive_cmds_GCJ \ archive_expsym_cmds_GCJ \ postinstall_cmds_GCJ \ postuninstall_cmds_GCJ \ old_archive_from_expsyms_cmds_GCJ \ allow_undefined_flag_GCJ \ no_undefined_flag_GCJ \ export_symbols_cmds_GCJ \ hardcode_libdir_flag_spec_GCJ \ hardcode_libdir_flag_spec_ld_GCJ \ hardcode_libdir_separator_GCJ \ hardcode_automatic_GCJ \ module_cmds_GCJ \ module_expsym_cmds_GCJ \ lt_cv_prog_compiler_c_o_GCJ \ exclude_expsyms_GCJ \ include_expsyms_GCJ; do case $var in old_archive_cmds_GCJ | \ old_archive_from_new_cmds_GCJ | \ archive_cmds_GCJ | \ archive_expsym_cmds_GCJ | \ module_cmds_GCJ | \ module_expsym_cmds_GCJ | \ old_archive_from_expsyms_cmds_GCJ | \ export_symbols_cmds_GCJ | \ extract_expsyms_cmds | reload_cmds | finish_cmds | \ postinstall_cmds | postuninstall_cmds | \ old_postinstall_cmds | old_postuninstall_cmds | \ sys_lib_search_path_spec | sys_lib_dlsearch_path_spec) # Double-quote double-evaled strings. eval "lt_$var=\\\"\`\$echo \"X\$$var\" | \$Xsed -e \"\$double_quote_subst\" -e \"\$sed_quote_subst\" -e \"\$delay_variable_subst\"\`\\\"" ;; *) eval "lt_$var=\\\"\`\$echo \"X\$$var\" | \$Xsed -e \"\$sed_quote_subst\"\`\\\"" ;; esac done case $lt_echo in *'\$0 --fallback-echo"') lt_echo=`$echo "X$lt_echo" | $Xsed -e 's/\\\\\\\$0 --fallback-echo"$/$0 --fallback-echo"/'` ;; esac cfgfile="$ofile" cat <<__EOF__ >> "$cfgfile" # ### BEGIN LIBTOOL TAG CONFIG: $tagname # Libtool was configured on host `(hostname || uname -n) 2>/dev/null | sed 1q`: # Shell to use when invoking shell scripts. SHELL=$lt_SHELL # Whether or not to build shared libraries. build_libtool_libs=$enable_shared # Whether or not to build static libraries. build_old_libs=$enable_static # Whether or not to add -lc for building shared libraries. build_libtool_need_lc=$archive_cmds_need_lc_GCJ # Whether or not to disallow shared libs when runtime libs are static allow_libtool_libs_with_static_runtimes=$enable_shared_with_static_runtimes_GCJ # Whether or not to optimize for fast installation. fast_install=$enable_fast_install # The host system. host_alias=$host_alias host=$host # An echo program that does not interpret backslashes. echo=$lt_echo # The archiver. AR=$lt_AR AR_FLAGS=$lt_AR_FLAGS # A C compiler. LTCC=$lt_LTCC # A language-specific compiler. CC=$lt_compiler_GCJ # Is the compiler the GNU C compiler? with_gcc=$GCC_GCJ # An ERE matcher. EGREP=$lt_EGREP # The linker used to build libraries. LD=$lt_LD_GCJ # Whether we need hard or soft links. LN_S=$lt_LN_S # A BSD-compatible nm program. NM=$lt_NM # A symbol stripping program STRIP=$lt_STRIP # Used to examine libraries when file_magic_cmd begins "file" MAGIC_CMD=$MAGIC_CMD # Used on cygwin: DLL creation program. DLLTOOL="$DLLTOOL" # Used on cygwin: object dumper. OBJDUMP="$OBJDUMP" # Used on cygwin: assembler. AS="$AS" # The name of the directory that contains temporary libtool files. objdir=$objdir # How to create reloadable object files. reload_flag=$lt_reload_flag reload_cmds=$lt_reload_cmds # How to pass a linker flag through the compiler. wl=$lt_lt_prog_compiler_wl_GCJ # Object file suffix (normally "o"). objext="$ac_objext" # Old archive suffix (normally "a"). libext="$libext" # Shared library suffix (normally ".so"). shrext_cmds='$shrext_cmds' # Executable file suffix (normally ""). exeext="$exeext" # Additional compiler flags for building library objects. pic_flag=$lt_lt_prog_compiler_pic_GCJ pic_mode=$pic_mode # What is the maximum length of a command? max_cmd_len=$lt_cv_sys_max_cmd_len # Does compiler simultaneously support -c and -o options? compiler_c_o=$lt_lt_cv_prog_compiler_c_o_GCJ # Must we lock files when doing compilation ? need_locks=$lt_need_locks # Do we need the lib prefix for modules? need_lib_prefix=$need_lib_prefix # Do we need a version for libraries? need_version=$need_version # Whether dlopen is supported. dlopen_support=$enable_dlopen # Whether dlopen of programs is supported. dlopen_self=$enable_dlopen_self # Whether dlopen of statically linked programs is supported. dlopen_self_static=$enable_dlopen_self_static # Compiler flag to prevent dynamic linking. link_static_flag=$lt_lt_prog_compiler_static_GCJ # Compiler flag to turn off builtin functions. no_builtin_flag=$lt_lt_prog_compiler_no_builtin_flag_GCJ # Compiler flag to allow reflexive dlopens. export_dynamic_flag_spec=$lt_export_dynamic_flag_spec_GCJ # Compiler flag to generate shared objects directly from archives. whole_archive_flag_spec=$lt_whole_archive_flag_spec_GCJ # Compiler flag to generate thread-safe objects. thread_safe_flag_spec=$lt_thread_safe_flag_spec_GCJ # Library versioning type. version_type=$version_type # Format of library name prefix. libname_spec=$lt_libname_spec # List of archive names. First name is the real one, the rest are links. # The last name is the one that the linker finds with -lNAME. library_names_spec=$lt_library_names_spec # The coded name of the library, if different from the real name. soname_spec=$lt_soname_spec # Commands used to build and install an old-style archive. RANLIB=$lt_RANLIB old_archive_cmds=$lt_old_archive_cmds_GCJ old_postinstall_cmds=$lt_old_postinstall_cmds old_postuninstall_cmds=$lt_old_postuninstall_cmds # Create an old-style archive from a shared archive. old_archive_from_new_cmds=$lt_old_archive_from_new_cmds_GCJ # Create a temporary old-style archive to link instead of a shared archive. old_archive_from_expsyms_cmds=$lt_old_archive_from_expsyms_cmds_GCJ # Commands used to build and install a shared archive. archive_cmds=$lt_archive_cmds_GCJ archive_expsym_cmds=$lt_archive_expsym_cmds_GCJ postinstall_cmds=$lt_postinstall_cmds postuninstall_cmds=$lt_postuninstall_cmds # Commands used to build a loadable module (assumed same as above if empty) module_cmds=$lt_module_cmds_GCJ module_expsym_cmds=$lt_module_expsym_cmds_GCJ # Commands to strip libraries. old_striplib=$lt_old_striplib striplib=$lt_striplib # Dependencies to place before the objects being linked to create a # shared library. predep_objects=$lt_predep_objects_GCJ # Dependencies to place after the objects being linked to create a # shared library. postdep_objects=$lt_postdep_objects_GCJ # Dependencies to place before the objects being linked to create a # shared library. predeps=$lt_predeps_GCJ # Dependencies to place after the objects being linked to create a # shared library. postdeps=$lt_postdeps_GCJ # The library search path used internally by the compiler when linking # a shared library. compiler_lib_search_path=$lt_compiler_lib_search_path_GCJ # Method to check whether dependent libraries are shared objects. deplibs_check_method=$lt_deplibs_check_method # Command to use when deplibs_check_method == file_magic. file_magic_cmd=$lt_file_magic_cmd # Flag that allows shared libraries with undefined symbols to be built. allow_undefined_flag=$lt_allow_undefined_flag_GCJ # Flag that forces no undefined symbols. no_undefined_flag=$lt_no_undefined_flag_GCJ # Commands used to finish a libtool library installation in a directory. finish_cmds=$lt_finish_cmds # Same as above, but a single script fragment to be evaled but not shown. finish_eval=$lt_finish_eval # Take the output of nm and produce a listing of raw symbols and C names. global_symbol_pipe=$lt_lt_cv_sys_global_symbol_pipe # Transform the output of nm in a proper C declaration global_symbol_to_cdecl=$lt_lt_cv_sys_global_symbol_to_cdecl # Transform the output of nm in a C name address pair global_symbol_to_c_name_address=$lt_lt_cv_sys_global_symbol_to_c_name_address # This is the shared library runtime path variable. runpath_var=$runpath_var # This is the shared library path variable. shlibpath_var=$shlibpath_var # Is shlibpath searched before the hard-coded library search path? shlibpath_overrides_runpath=$shlibpath_overrides_runpath # How to hardcode a shared library path into an executable. hardcode_action=$hardcode_action_GCJ # Whether we should hardcode library paths into libraries. hardcode_into_libs=$hardcode_into_libs # Flag to hardcode \$libdir into a binary during linking. # This must work even if \$libdir does not exist. hardcode_libdir_flag_spec=$lt_hardcode_libdir_flag_spec_GCJ # If ld is used when linking, flag to hardcode \$libdir into # a binary during linking. This must work even if \$libdir does # not exist. hardcode_libdir_flag_spec_ld=$lt_hardcode_libdir_flag_spec_ld_GCJ # Whether we need a single -rpath flag with a separated argument. hardcode_libdir_separator=$lt_hardcode_libdir_separator_GCJ # Set to yes if using DIR/libNAME${shared_ext} during linking hardcodes DIR into the # resulting binary. hardcode_direct=$hardcode_direct_GCJ # Set to yes if using the -LDIR flag during linking hardcodes DIR into the # resulting binary. hardcode_minus_L=$hardcode_minus_L_GCJ # Set to yes if using SHLIBPATH_VAR=DIR during linking hardcodes DIR into # the resulting binary. hardcode_shlibpath_var=$hardcode_shlibpath_var_GCJ # Set to yes if building a shared library automatically hardcodes DIR into the library # and all subsequent libraries and executables linked against it. hardcode_automatic=$hardcode_automatic_GCJ # Variables whose values should be saved in libtool wrapper scripts and # restored at relink time. variables_saved_for_relink="$variables_saved_for_relink" # Whether libtool must link a program against all its dependency libraries. link_all_deplibs=$link_all_deplibs_GCJ # Compile-time system search path for libraries sys_lib_search_path_spec=$lt_sys_lib_search_path_spec # Run-time system search path for libraries sys_lib_dlsearch_path_spec=$lt_sys_lib_dlsearch_path_spec # Fix the shell variable \$srcfile for the compiler. fix_srcfile_path="$fix_srcfile_path_GCJ" # Set to yes if exported symbols are required. always_export_symbols=$always_export_symbols_GCJ # The commands to list exported symbols. export_symbols_cmds=$lt_export_symbols_cmds_GCJ # The commands to extract the exported symbol list from a shared archive. extract_expsyms_cmds=$lt_extract_expsyms_cmds # Symbols that should not be listed in the preloaded symbols. exclude_expsyms=$lt_exclude_expsyms_GCJ # Symbols that must always be exported. include_expsyms=$lt_include_expsyms_GCJ # ### END LIBTOOL TAG CONFIG: $tagname __EOF__ else # If there is no Makefile yet, we rely on a make rule to execute # `config.status --recheck' to rerun these tests and create the # libtool script then. ltmain_in=`echo $ltmain | sed -e 's/\.sh$/.in/'` if test -f "$ltmain_in"; then test -f Makefile && make "$ltmain" fi fi ac_ext=c ac_cpp='$CPP $CPPFLAGS' ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' ac_compiler_gnu=$ac_cv_c_compiler_gnu CC="$lt_save_CC" else tagname="" fi ;; RC) # Source file extension for RC test sources. ac_ext=rc # Object file extension for compiled RC test sources. objext=o objext_RC=$objext # Code to be used in simple compile tests lt_simple_compile_test_code='sample MENU { MENUITEM "&Soup", 100, CHECKED }\n' # Code to be used in simple link tests lt_simple_link_test_code="$lt_simple_compile_test_code" # ltmain only uses $CC for tagged configurations so make sure $CC is set. # If no C compiler was specified, use CC. LTCC=${LTCC-"$CC"} # Allow CC to be a program name with arguments. compiler=$CC # Allow CC to be a program name with arguments. lt_save_CC="$CC" CC=${RC-"windres"} compiler=$CC compiler_RC=$CC lt_cv_prog_compiler_c_o_RC=yes # The else clause should only fire when bootstrapping the # libtool distribution, otherwise you forgot to ship ltmain.sh # with your package, and you will get complaints that there are # no rules to generate ltmain.sh. if test -f "$ltmain"; then # See if we are running on zsh, and set the options which allow our commands through # without removal of \ escapes. if test -n "${ZSH_VERSION+set}" ; then setopt NO_GLOB_SUBST fi # Now quote all the things that may contain metacharacters while being # careful not to overquote the AC_SUBSTed values. We take copies of the # variables and quote the copies for generation of the libtool script. for var in echo old_CC old_CFLAGS AR AR_FLAGS EGREP RANLIB LN_S LTCC NM \ SED SHELL STRIP \ libname_spec library_names_spec soname_spec extract_expsyms_cmds \ old_striplib striplib file_magic_cmd finish_cmds finish_eval \ deplibs_check_method reload_flag reload_cmds need_locks \ lt_cv_sys_global_symbol_pipe lt_cv_sys_global_symbol_to_cdecl \ lt_cv_sys_global_symbol_to_c_name_address \ sys_lib_search_path_spec sys_lib_dlsearch_path_spec \ old_postinstall_cmds old_postuninstall_cmds \ compiler_RC \ CC_RC \ LD_RC \ lt_prog_compiler_wl_RC \ lt_prog_compiler_pic_RC \ lt_prog_compiler_static_RC \ lt_prog_compiler_no_builtin_flag_RC \ export_dynamic_flag_spec_RC \ thread_safe_flag_spec_RC \ whole_archive_flag_spec_RC \ enable_shared_with_static_runtimes_RC \ old_archive_cmds_RC \ old_archive_from_new_cmds_RC \ predep_objects_RC \ postdep_objects_RC \ predeps_RC \ postdeps_RC \ compiler_lib_search_path_RC \ archive_cmds_RC \ archive_expsym_cmds_RC \ postinstall_cmds_RC \ postuninstall_cmds_RC \ old_archive_from_expsyms_cmds_RC \ allow_undefined_flag_RC \ no_undefined_flag_RC \ export_symbols_cmds_RC \ hardcode_libdir_flag_spec_RC \ hardcode_libdir_flag_spec_ld_RC \ hardcode_libdir_separator_RC \ hardcode_automatic_RC \ module_cmds_RC \ module_expsym_cmds_RC \ lt_cv_prog_compiler_c_o_RC \ exclude_expsyms_RC \ include_expsyms_RC; do case $var in old_archive_cmds_RC | \ old_archive_from_new_cmds_RC | \ archive_cmds_RC | \ archive_expsym_cmds_RC | \ module_cmds_RC | \ module_expsym_cmds_RC | \ old_archive_from_expsyms_cmds_RC | \ export_symbols_cmds_RC | \ extract_expsyms_cmds | reload_cmds | finish_cmds | \ postinstall_cmds | postuninstall_cmds | \ old_postinstall_cmds | old_postuninstall_cmds | \ sys_lib_search_path_spec | sys_lib_dlsearch_path_spec) # Double-quote double-evaled strings. eval "lt_$var=\\\"\`\$echo \"X\$$var\" | \$Xsed -e \"\$double_quote_subst\" -e \"\$sed_quote_subst\" -e \"\$delay_variable_subst\"\`\\\"" ;; *) eval "lt_$var=\\\"\`\$echo \"X\$$var\" | \$Xsed -e \"\$sed_quote_subst\"\`\\\"" ;; esac done case $lt_echo in *'\$0 --fallback-echo"') lt_echo=`$echo "X$lt_echo" | $Xsed -e 's/\\\\\\\$0 --fallback-echo"$/$0 --fallback-echo"/'` ;; esac cfgfile="$ofile" cat <<__EOF__ >> "$cfgfile" # ### BEGIN LIBTOOL TAG CONFIG: $tagname # Libtool was configured on host `(hostname || uname -n) 2>/dev/null | sed 1q`: # Shell to use when invoking shell scripts. SHELL=$lt_SHELL # Whether or not to build shared libraries. build_libtool_libs=$enable_shared # Whether or not to build static libraries. build_old_libs=$enable_static # Whether or not to add -lc for building shared libraries. build_libtool_need_lc=$archive_cmds_need_lc_RC # Whether or not to disallow shared libs when runtime libs are static allow_libtool_libs_with_static_runtimes=$enable_shared_with_static_runtimes_RC # Whether or not to optimize for fast installation. fast_install=$enable_fast_install # The host system. host_alias=$host_alias host=$host # An echo program that does not interpret backslashes. echo=$lt_echo # The archiver. AR=$lt_AR AR_FLAGS=$lt_AR_FLAGS # A C compiler. LTCC=$lt_LTCC # A language-specific compiler. CC=$lt_compiler_RC # Is the compiler the GNU C compiler? with_gcc=$GCC_RC # An ERE matcher. EGREP=$lt_EGREP # The linker used to build libraries. LD=$lt_LD_RC # Whether we need hard or soft links. LN_S=$lt_LN_S # A BSD-compatible nm program. NM=$lt_NM # A symbol stripping program STRIP=$lt_STRIP # Used to examine libraries when file_magic_cmd begins "file" MAGIC_CMD=$MAGIC_CMD # Used on cygwin: DLL creation program. DLLTOOL="$DLLTOOL" # Used on cygwin: object dumper. OBJDUMP="$OBJDUMP" # Used on cygwin: assembler. AS="$AS" # The name of the directory that contains temporary libtool files. objdir=$objdir # How to create reloadable object files. reload_flag=$lt_reload_flag reload_cmds=$lt_reload_cmds # How to pass a linker flag through the compiler. wl=$lt_lt_prog_compiler_wl_RC # Object file suffix (normally "o"). objext="$ac_objext" # Old archive suffix (normally "a"). libext="$libext" # Shared library suffix (normally ".so"). shrext_cmds='$shrext_cmds' # Executable file suffix (normally ""). exeext="$exeext" # Additional compiler flags for building library objects. pic_flag=$lt_lt_prog_compiler_pic_RC pic_mode=$pic_mode # What is the maximum length of a command? max_cmd_len=$lt_cv_sys_max_cmd_len # Does compiler simultaneously support -c and -o options? compiler_c_o=$lt_lt_cv_prog_compiler_c_o_RC # Must we lock files when doing compilation ? need_locks=$lt_need_locks # Do we need the lib prefix for modules? need_lib_prefix=$need_lib_prefix # Do we need a version for libraries? need_version=$need_version # Whether dlopen is supported. dlopen_support=$enable_dlopen # Whether dlopen of programs is supported. dlopen_self=$enable_dlopen_self # Whether dlopen of statically linked programs is supported. dlopen_self_static=$enable_dlopen_self_static # Compiler flag to prevent dynamic linking. link_static_flag=$lt_lt_prog_compiler_static_RC # Compiler flag to turn off builtin functions. no_builtin_flag=$lt_lt_prog_compiler_no_builtin_flag_RC # Compiler flag to allow reflexive dlopens. export_dynamic_flag_spec=$lt_export_dynamic_flag_spec_RC # Compiler flag to generate shared objects directly from archives. whole_archive_flag_spec=$lt_whole_archive_flag_spec_RC # Compiler flag to generate thread-safe objects. thread_safe_flag_spec=$lt_thread_safe_flag_spec_RC # Library versioning type. version_type=$version_type # Format of library name prefix. libname_spec=$lt_libname_spec # List of archive names. First name is the real one, the rest are links. # The last name is the one that the linker finds with -lNAME. library_names_spec=$lt_library_names_spec # The coded name of the library, if different from the real name. soname_spec=$lt_soname_spec # Commands used to build and install an old-style archive. RANLIB=$lt_RANLIB old_archive_cmds=$lt_old_archive_cmds_RC old_postinstall_cmds=$lt_old_postinstall_cmds old_postuninstall_cmds=$lt_old_postuninstall_cmds # Create an old-style archive from a shared archive. old_archive_from_new_cmds=$lt_old_archive_from_new_cmds_RC # Create a temporary old-style archive to link instead of a shared archive. old_archive_from_expsyms_cmds=$lt_old_archive_from_expsyms_cmds_RC # Commands used to build and install a shared archive. archive_cmds=$lt_archive_cmds_RC archive_expsym_cmds=$lt_archive_expsym_cmds_RC postinstall_cmds=$lt_postinstall_cmds postuninstall_cmds=$lt_postuninstall_cmds # Commands used to build a loadable module (assumed same as above if empty) module_cmds=$lt_module_cmds_RC module_expsym_cmds=$lt_module_expsym_cmds_RC # Commands to strip libraries. old_striplib=$lt_old_striplib striplib=$lt_striplib # Dependencies to place before the objects being linked to create a # shared library. predep_objects=$lt_predep_objects_RC # Dependencies to place after the objects being linked to create a # shared library. postdep_objects=$lt_postdep_objects_RC # Dependencies to place before the objects being linked to create a # shared library. predeps=$lt_predeps_RC # Dependencies to place after the objects being linked to create a # shared library. postdeps=$lt_postdeps_RC # The library search path used internally by the compiler when linking # a shared library. compiler_lib_search_path=$lt_compiler_lib_search_path_RC # Method to check whether dependent libraries are shared objects. deplibs_check_method=$lt_deplibs_check_method # Command to use when deplibs_check_method == file_magic. file_magic_cmd=$lt_file_magic_cmd # Flag that allows shared libraries with undefined symbols to be built. allow_undefined_flag=$lt_allow_undefined_flag_RC # Flag that forces no undefined symbols. no_undefined_flag=$lt_no_undefined_flag_RC # Commands used to finish a libtool library installation in a directory. finish_cmds=$lt_finish_cmds # Same as above, but a single script fragment to be evaled but not shown. finish_eval=$lt_finish_eval # Take the output of nm and produce a listing of raw symbols and C names. global_symbol_pipe=$lt_lt_cv_sys_global_symbol_pipe # Transform the output of nm in a proper C declaration global_symbol_to_cdecl=$lt_lt_cv_sys_global_symbol_to_cdecl # Transform the output of nm in a C name address pair global_symbol_to_c_name_address=$lt_lt_cv_sys_global_symbol_to_c_name_address # This is the shared library runtime path variable. runpath_var=$runpath_var # This is the shared library path variable. shlibpath_var=$shlibpath_var # Is shlibpath searched before the hard-coded library search path? shlibpath_overrides_runpath=$shlibpath_overrides_runpath # How to hardcode a shared library path into an executable. hardcode_action=$hardcode_action_RC # Whether we should hardcode library paths into libraries. hardcode_into_libs=$hardcode_into_libs # Flag to hardcode \$libdir into a binary during linking. # This must work even if \$libdir does not exist. hardcode_libdir_flag_spec=$lt_hardcode_libdir_flag_spec_RC # If ld is used when linking, flag to hardcode \$libdir into # a binary during linking. This must work even if \$libdir does # not exist. hardcode_libdir_flag_spec_ld=$lt_hardcode_libdir_flag_spec_ld_RC # Whether we need a single -rpath flag with a separated argument. hardcode_libdir_separator=$lt_hardcode_libdir_separator_RC # Set to yes if using DIR/libNAME${shared_ext} during linking hardcodes DIR into the # resulting binary. hardcode_direct=$hardcode_direct_RC # Set to yes if using the -LDIR flag during linking hardcodes DIR into the # resulting binary. hardcode_minus_L=$hardcode_minus_L_RC # Set to yes if using SHLIBPATH_VAR=DIR during linking hardcodes DIR into # the resulting binary. hardcode_shlibpath_var=$hardcode_shlibpath_var_RC # Set to yes if building a shared library automatically hardcodes DIR into the library # and all subsequent libraries and executables linked against it. hardcode_automatic=$hardcode_automatic_RC # Variables whose values should be saved in libtool wrapper scripts and # restored at relink time. variables_saved_for_relink="$variables_saved_for_relink" # Whether libtool must link a program against all its dependency libraries. link_all_deplibs=$link_all_deplibs_RC # Compile-time system search path for libraries sys_lib_search_path_spec=$lt_sys_lib_search_path_spec # Run-time system search path for libraries sys_lib_dlsearch_path_spec=$lt_sys_lib_dlsearch_path_spec # Fix the shell variable \$srcfile for the compiler. fix_srcfile_path="$fix_srcfile_path_RC" # Set to yes if exported symbols are required. always_export_symbols=$always_export_symbols_RC # The commands to list exported symbols. export_symbols_cmds=$lt_export_symbols_cmds_RC # The commands to extract the exported symbol list from a shared archive. extract_expsyms_cmds=$lt_extract_expsyms_cmds # Symbols that should not be listed in the preloaded symbols. exclude_expsyms=$lt_exclude_expsyms_RC # Symbols that must always be exported. include_expsyms=$lt_include_expsyms_RC # ### END LIBTOOL TAG CONFIG: $tagname __EOF__ else # If there is no Makefile yet, we rely on a make rule to execute # `config.status --recheck' to rerun these tests and create the # libtool script then. ltmain_in=`echo $ltmain | sed -e 's/\.sh$/.in/'` if test -f "$ltmain_in"; then test -f Makefile && make "$ltmain" fi fi ac_ext=c ac_cpp='$CPP $CPPFLAGS' ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' ac_compiler_gnu=$ac_cv_c_compiler_gnu CC="$lt_save_CC" ;; *) { { echo "$as_me:$LINENO: error: Unsupported tag name: $tagname" >&5 echo "$as_me: error: Unsupported tag name: $tagname" >&2;} { (exit 1); exit 1; }; } ;; esac # Append the new tag name to the list of available tags. if test -n "$tagname" ; then available_tags="$available_tags $tagname" fi fi done IFS="$lt_save_ifs" # Now substitute the updated list of available tags. if eval "sed -e 's/^available_tags=.*\$/available_tags=\"$available_tags\"/' \"$ofile\" > \"${ofile}T\""; then mv "${ofile}T" "$ofile" chmod +x "$ofile" else rm -f "${ofile}T" { { echo "$as_me:$LINENO: error: unable to update list of available tagged configurations." >&5 echo "$as_me: error: unable to update list of available tagged configurations." >&2;} { (exit 1); exit 1; }; } fi fi # This can be used to rebuild libtool when needed LIBTOOL_DEPS="$ac_aux_dir/ltmain.sh" # Always use our own libtool. LIBTOOL='$(SHELL) $(top_builddir)/libtool' # Prevent multiple expansion ### i18n GETTEXT_PACKAGE=libtranslate cat >>confdefs.h <<_ACEOF #define GETTEXT_PACKAGE "$GETTEXT_PACKAGE" _ACEOF ALL_LINGUAS="fr" for ac_header in locale.h do as_ac_Header=`echo "ac_cv_header_$ac_header" | $as_tr_sh` if eval "test \"\${$as_ac_Header+set}\" = set"; then echo "$as_me:$LINENO: checking for $ac_header" >&5 echo $ECHO_N "checking for $ac_header... $ECHO_C" >&6 if eval "test \"\${$as_ac_Header+set}\" = set"; then echo $ECHO_N "(cached) $ECHO_C" >&6 fi echo "$as_me:$LINENO: result: `eval echo '${'$as_ac_Header'}'`" >&5 echo "${ECHO_T}`eval echo '${'$as_ac_Header'}'`" >&6 else # Is the header compilable? echo "$as_me:$LINENO: checking $ac_header usability" >&5 echo $ECHO_N "checking $ac_header usability... $ECHO_C" >&6 cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ $ac_includes_default #include <$ac_header> _ACEOF rm -f conftest.$ac_objext if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5 (eval $ac_compile) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest.$ac_objext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then ac_header_compiler=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_header_compiler=no fi rm -f conftest.err conftest.$ac_objext conftest.$ac_ext echo "$as_me:$LINENO: result: $ac_header_compiler" >&5 echo "${ECHO_T}$ac_header_compiler" >&6 # Is the header present? echo "$as_me:$LINENO: checking $ac_header presence" >&5 echo $ECHO_N "checking $ac_header presence... $ECHO_C" >&6 cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #include <$ac_header> _ACEOF if { (eval echo "$as_me:$LINENO: \"$ac_cpp conftest.$ac_ext\"") >&5 (eval $ac_cpp conftest.$ac_ext) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } >/dev/null; then if test -s conftest.err; then ac_cpp_err=$ac_c_preproc_warn_flag ac_cpp_err=$ac_cpp_err$ac_c_werror_flag else ac_cpp_err= fi else ac_cpp_err=yes fi if test -z "$ac_cpp_err"; then ac_header_preproc=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_header_preproc=no fi rm -f conftest.err conftest.$ac_ext echo "$as_me:$LINENO: result: $ac_header_preproc" >&5 echo "${ECHO_T}$ac_header_preproc" >&6 # So? What about this header? case $ac_header_compiler:$ac_header_preproc:$ac_c_preproc_warn_flag in yes:no: ) { echo "$as_me:$LINENO: WARNING: $ac_header: accepted by the compiler, rejected by the preprocessor!" >&5 echo "$as_me: WARNING: $ac_header: accepted by the compiler, rejected by the preprocessor!" >&2;} { echo "$as_me:$LINENO: WARNING: $ac_header: proceeding with the compiler's result" >&5 echo "$as_me: WARNING: $ac_header: proceeding with the compiler's result" >&2;} ac_header_preproc=yes ;; no:yes:* ) { echo "$as_me:$LINENO: WARNING: $ac_header: present but cannot be compiled" >&5 echo "$as_me: WARNING: $ac_header: present but cannot be compiled" >&2;} { echo "$as_me:$LINENO: WARNING: $ac_header: check for missing prerequisite headers?" >&5 echo "$as_me: WARNING: $ac_header: check for missing prerequisite headers?" >&2;} { echo "$as_me:$LINENO: WARNING: $ac_header: see the Autoconf documentation" >&5 echo "$as_me: WARNING: $ac_header: see the Autoconf documentation" >&2;} { echo "$as_me:$LINENO: WARNING: $ac_header: section \"Present But Cannot Be Compiled\"" >&5 echo "$as_me: WARNING: $ac_header: section \"Present But Cannot Be Compiled\"" >&2;} { echo "$as_me:$LINENO: WARNING: $ac_header: proceeding with the preprocessor's result" >&5 echo "$as_me: WARNING: $ac_header: proceeding with the preprocessor's result" >&2;} { echo "$as_me:$LINENO: WARNING: $ac_header: in the future, the compiler will take precedence" >&5 echo "$as_me: WARNING: $ac_header: in the future, the compiler will take precedence" >&2;} ( cat <<\_ASBOX ## ---------------------------------- ## ## Report this to jylefort@brutele.be ## ## ---------------------------------- ## _ASBOX ) | sed "s/^/$as_me: WARNING: /" >&2 ;; esac echo "$as_me:$LINENO: checking for $ac_header" >&5 echo $ECHO_N "checking for $ac_header... $ECHO_C" >&6 if eval "test \"\${$as_ac_Header+set}\" = set"; then echo $ECHO_N "(cached) $ECHO_C" >&6 else eval "$as_ac_Header=\$ac_header_preproc" fi echo "$as_me:$LINENO: result: `eval echo '${'$as_ac_Header'}'`" >&5 echo "${ECHO_T}`eval echo '${'$as_ac_Header'}'`" >&6 fi if test `eval echo '${'$as_ac_Header'}'` = yes; then cat >>confdefs.h <<_ACEOF #define `echo "HAVE_$ac_header" | $as_tr_cpp` 1 _ACEOF fi done if test $ac_cv_header_locale_h = yes; then echo "$as_me:$LINENO: checking for LC_MESSAGES" >&5 echo $ECHO_N "checking for LC_MESSAGES... $ECHO_C" >&6 if test "${am_cv_val_LC_MESSAGES+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #include int main () { return LC_MESSAGES ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then am_cv_val_LC_MESSAGES=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 am_cv_val_LC_MESSAGES=no fi rm -f conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext fi echo "$as_me:$LINENO: result: $am_cv_val_LC_MESSAGES" >&5 echo "${ECHO_T}$am_cv_val_LC_MESSAGES" >&6 if test $am_cv_val_LC_MESSAGES = yes; then cat >>confdefs.h <<\_ACEOF #define HAVE_LC_MESSAGES 1 _ACEOF fi fi USE_NLS=yes gt_cv_have_gettext=no CATOBJEXT=NONE XGETTEXT=: INTLLIBS= if test "${ac_cv_header_libintl_h+set}" = set; then echo "$as_me:$LINENO: checking for libintl.h" >&5 echo $ECHO_N "checking for libintl.h... $ECHO_C" >&6 if test "${ac_cv_header_libintl_h+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 fi echo "$as_me:$LINENO: result: $ac_cv_header_libintl_h" >&5 echo "${ECHO_T}$ac_cv_header_libintl_h" >&6 else # Is the header compilable? echo "$as_me:$LINENO: checking libintl.h usability" >&5 echo $ECHO_N "checking libintl.h usability... $ECHO_C" >&6 cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ $ac_includes_default #include _ACEOF rm -f conftest.$ac_objext if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5 (eval $ac_compile) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest.$ac_objext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then ac_header_compiler=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_header_compiler=no fi rm -f conftest.err conftest.$ac_objext conftest.$ac_ext echo "$as_me:$LINENO: result: $ac_header_compiler" >&5 echo "${ECHO_T}$ac_header_compiler" >&6 # Is the header present? echo "$as_me:$LINENO: checking libintl.h presence" >&5 echo $ECHO_N "checking libintl.h presence... $ECHO_C" >&6 cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #include _ACEOF if { (eval echo "$as_me:$LINENO: \"$ac_cpp conftest.$ac_ext\"") >&5 (eval $ac_cpp conftest.$ac_ext) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } >/dev/null; then if test -s conftest.err; then ac_cpp_err=$ac_c_preproc_warn_flag ac_cpp_err=$ac_cpp_err$ac_c_werror_flag else ac_cpp_err= fi else ac_cpp_err=yes fi if test -z "$ac_cpp_err"; then ac_header_preproc=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_header_preproc=no fi rm -f conftest.err conftest.$ac_ext echo "$as_me:$LINENO: result: $ac_header_preproc" >&5 echo "${ECHO_T}$ac_header_preproc" >&6 # So? What about this header? case $ac_header_compiler:$ac_header_preproc:$ac_c_preproc_warn_flag in yes:no: ) { echo "$as_me:$LINENO: WARNING: libintl.h: accepted by the compiler, rejected by the preprocessor!" >&5 echo "$as_me: WARNING: libintl.h: accepted by the compiler, rejected by the preprocessor!" >&2;} { echo "$as_me:$LINENO: WARNING: libintl.h: proceeding with the compiler's result" >&5 echo "$as_me: WARNING: libintl.h: proceeding with the compiler's result" >&2;} ac_header_preproc=yes ;; no:yes:* ) { echo "$as_me:$LINENO: WARNING: libintl.h: present but cannot be compiled" >&5 echo "$as_me: WARNING: libintl.h: present but cannot be compiled" >&2;} { echo "$as_me:$LINENO: WARNING: libintl.h: check for missing prerequisite headers?" >&5 echo "$as_me: WARNING: libintl.h: check for missing prerequisite headers?" >&2;} { echo "$as_me:$LINENO: WARNING: libintl.h: see the Autoconf documentation" >&5 echo "$as_me: WARNING: libintl.h: see the Autoconf documentation" >&2;} { echo "$as_me:$LINENO: WARNING: libintl.h: section \"Present But Cannot Be Compiled\"" >&5 echo "$as_me: WARNING: libintl.h: section \"Present But Cannot Be Compiled\"" >&2;} { echo "$as_me:$LINENO: WARNING: libintl.h: proceeding with the preprocessor's result" >&5 echo "$as_me: WARNING: libintl.h: proceeding with the preprocessor's result" >&2;} { echo "$as_me:$LINENO: WARNING: libintl.h: in the future, the compiler will take precedence" >&5 echo "$as_me: WARNING: libintl.h: in the future, the compiler will take precedence" >&2;} ( cat <<\_ASBOX ## ---------------------------------- ## ## Report this to jylefort@brutele.be ## ## ---------------------------------- ## _ASBOX ) | sed "s/^/$as_me: WARNING: /" >&2 ;; esac echo "$as_me:$LINENO: checking for libintl.h" >&5 echo $ECHO_N "checking for libintl.h... $ECHO_C" >&6 if test "${ac_cv_header_libintl_h+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else ac_cv_header_libintl_h=$ac_header_preproc fi echo "$as_me:$LINENO: result: $ac_cv_header_libintl_h" >&5 echo "${ECHO_T}$ac_cv_header_libintl_h" >&6 fi if test $ac_cv_header_libintl_h = yes; then gt_cv_func_dgettext_libintl="no" libintl_extra_libs="" # # First check in libc # echo "$as_me:$LINENO: checking for dgettext in libc" >&5 echo $ECHO_N "checking for dgettext in libc... $ECHO_C" >&6 if test "${gt_cv_func_dgettext_libc+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #include int main () { return (int) dgettext ("","") ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then gt_cv_func_dgettext_libc=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 gt_cv_func_dgettext_libc=no fi rm -f conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext fi echo "$as_me:$LINENO: result: $gt_cv_func_dgettext_libc" >&5 echo "${ECHO_T}$gt_cv_func_dgettext_libc" >&6 if test "$gt_cv_func_dgettext_libc" = "yes" ; then for ac_func in bind_textdomain_codeset do as_ac_var=`echo "ac_cv_func_$ac_func" | $as_tr_sh` echo "$as_me:$LINENO: checking for $ac_func" >&5 echo $ECHO_N "checking for $ac_func... $ECHO_C" >&6 if eval "test \"\${$as_ac_var+set}\" = set"; then echo $ECHO_N "(cached) $ECHO_C" >&6 else cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ /* Define $ac_func to an innocuous variant, in case declares $ac_func. For example, HP-UX 11i declares gettimeofday. */ #define $ac_func innocuous_$ac_func /* System header to define __stub macros and hopefully few prototypes, which can conflict with char $ac_func (); below. Prefer to if __STDC__ is defined, since exists even on freestanding compilers. */ #ifdef __STDC__ # include #else # include #endif #undef $ac_func /* Override any gcc2 internal prototype to avoid an error. */ #ifdef __cplusplus extern "C" { #endif /* We use char because int might match the return type of a gcc2 builtin and then its argument prototype would still apply. */ char $ac_func (); /* The GNU C library defines this for functions which it implements to always fail with ENOSYS. Some functions are actually named something starting with __ and the normal name is an alias. */ #if defined (__stub_$ac_func) || defined (__stub___$ac_func) choke me #else char (*f) () = $ac_func; #endif #ifdef __cplusplus } #endif int main () { return f != $ac_func; ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then eval "$as_ac_var=yes" else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 eval "$as_ac_var=no" fi rm -f conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext fi echo "$as_me:$LINENO: result: `eval echo '${'$as_ac_var'}'`" >&5 echo "${ECHO_T}`eval echo '${'$as_ac_var'}'`" >&6 if test `eval echo '${'$as_ac_var'}'` = yes; then cat >>confdefs.h <<_ACEOF #define `echo "HAVE_$ac_func" | $as_tr_cpp` 1 _ACEOF fi done fi # # If we don't have everything we want, check in libintl # if test "$gt_cv_func_dgettext_libc" != "yes" \ || test "$ac_cv_func_bind_textdomain_codeset" != "yes" ; then echo "$as_me:$LINENO: checking for bindtextdomain in -lintl" >&5 echo $ECHO_N "checking for bindtextdomain in -lintl... $ECHO_C" >&6 if test "${ac_cv_lib_intl_bindtextdomain+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else ac_check_lib_save_LIBS=$LIBS LIBS="-lintl $LIBS" cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ /* Override any gcc2 internal prototype to avoid an error. */ #ifdef __cplusplus extern "C" #endif /* We use char because int might match the return type of a gcc2 builtin and then its argument prototype would still apply. */ char bindtextdomain (); int main () { bindtextdomain (); ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then ac_cv_lib_intl_bindtextdomain=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_cv_lib_intl_bindtextdomain=no fi rm -f conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext LIBS=$ac_check_lib_save_LIBS fi echo "$as_me:$LINENO: result: $ac_cv_lib_intl_bindtextdomain" >&5 echo "${ECHO_T}$ac_cv_lib_intl_bindtextdomain" >&6 if test $ac_cv_lib_intl_bindtextdomain = yes; then echo "$as_me:$LINENO: checking for dgettext in -lintl" >&5 echo $ECHO_N "checking for dgettext in -lintl... $ECHO_C" >&6 if test "${ac_cv_lib_intl_dgettext+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else ac_check_lib_save_LIBS=$LIBS LIBS="-lintl $LIBS" cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ /* Override any gcc2 internal prototype to avoid an error. */ #ifdef __cplusplus extern "C" #endif /* We use char because int might match the return type of a gcc2 builtin and then its argument prototype would still apply. */ char dgettext (); int main () { dgettext (); ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then ac_cv_lib_intl_dgettext=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_cv_lib_intl_dgettext=no fi rm -f conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext LIBS=$ac_check_lib_save_LIBS fi echo "$as_me:$LINENO: result: $ac_cv_lib_intl_dgettext" >&5 echo "${ECHO_T}$ac_cv_lib_intl_dgettext" >&6 if test $ac_cv_lib_intl_dgettext = yes; then gt_cv_func_dgettext_libintl=yes fi fi if test "$gt_cv_func_dgettext_libintl" != "yes" ; then echo "$as_me:$LINENO: checking if -liconv is needed to use gettext" >&5 echo $ECHO_N "checking if -liconv is needed to use gettext... $ECHO_C" >&6 echo "$as_me:$LINENO: result: " >&5 echo "${ECHO_T}" >&6 echo "$as_me:$LINENO: checking for dcgettext in -lintl" >&5 echo $ECHO_N "checking for dcgettext in -lintl... $ECHO_C" >&6 if test "${ac_cv_lib_intl_dcgettext+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else ac_check_lib_save_LIBS=$LIBS LIBS="-lintl -liconv $LIBS" cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ /* Override any gcc2 internal prototype to avoid an error. */ #ifdef __cplusplus extern "C" #endif /* We use char because int might match the return type of a gcc2 builtin and then its argument prototype would still apply. */ char dcgettext (); int main () { dcgettext (); ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then ac_cv_lib_intl_dcgettext=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_cv_lib_intl_dcgettext=no fi rm -f conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext LIBS=$ac_check_lib_save_LIBS fi echo "$as_me:$LINENO: result: $ac_cv_lib_intl_dcgettext" >&5 echo "${ECHO_T}$ac_cv_lib_intl_dcgettext" >&6 if test $ac_cv_lib_intl_dcgettext = yes; then gt_cv_func_dgettext_libintl=yes libintl_extra_libs=-liconv else : fi fi # # If we found libintl, then check in it for bind_textdomain_codeset(); # we'll prefer libc if neither have bind_textdomain_codeset(), # and both have dgettext # if test "$gt_cv_func_dgettext_libintl" = "yes" ; then glib_save_LIBS="$LIBS" LIBS="$LIBS -lintl $libintl_extra_libs" unset ac_cv_func_bind_textdomain_codeset for ac_func in bind_textdomain_codeset do as_ac_var=`echo "ac_cv_func_$ac_func" | $as_tr_sh` echo "$as_me:$LINENO: checking for $ac_func" >&5 echo $ECHO_N "checking for $ac_func... $ECHO_C" >&6 if eval "test \"\${$as_ac_var+set}\" = set"; then echo $ECHO_N "(cached) $ECHO_C" >&6 else cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ /* Define $ac_func to an innocuous variant, in case declares $ac_func. For example, HP-UX 11i declares gettimeofday. */ #define $ac_func innocuous_$ac_func /* System header to define __stub macros and hopefully few prototypes, which can conflict with char $ac_func (); below. Prefer to if __STDC__ is defined, since exists even on freestanding compilers. */ #ifdef __STDC__ # include #else # include #endif #undef $ac_func /* Override any gcc2 internal prototype to avoid an error. */ #ifdef __cplusplus extern "C" { #endif /* We use char because int might match the return type of a gcc2 builtin and then its argument prototype would still apply. */ char $ac_func (); /* The GNU C library defines this for functions which it implements to always fail with ENOSYS. Some functions are actually named something starting with __ and the normal name is an alias. */ #if defined (__stub_$ac_func) || defined (__stub___$ac_func) choke me #else char (*f) () = $ac_func; #endif #ifdef __cplusplus } #endif int main () { return f != $ac_func; ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then eval "$as_ac_var=yes" else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 eval "$as_ac_var=no" fi rm -f conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext fi echo "$as_me:$LINENO: result: `eval echo '${'$as_ac_var'}'`" >&5 echo "${ECHO_T}`eval echo '${'$as_ac_var'}'`" >&6 if test `eval echo '${'$as_ac_var'}'` = yes; then cat >>confdefs.h <<_ACEOF #define `echo "HAVE_$ac_func" | $as_tr_cpp` 1 _ACEOF fi done LIBS="$glib_save_LIBS" if test "$ac_cv_func_bind_textdomain_codeset" = "yes" ; then gt_cv_func_dgettext_libc=no else if test "$gt_cv_func_dgettext_libc" = "yes"; then gt_cv_func_dgettext_libintl=no fi fi fi fi if test "$gt_cv_func_dgettext_libc" = "yes" \ || test "$gt_cv_func_dgettext_libintl" = "yes"; then gt_cv_have_gettext=yes fi if test "$gt_cv_func_dgettext_libintl" = "yes"; then INTLLIBS="-lintl $libintl_extra_libs" fi if test "$gt_cv_have_gettext" = "yes"; then cat >>confdefs.h <<\_ACEOF #define HAVE_GETTEXT 1 _ACEOF # Extract the first word of "msgfmt", so it can be a program name with args. set dummy msgfmt; ac_word=$2 echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6 if test "${ac_cv_path_MSGFMT+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else case "$MSGFMT" in /*) ac_cv_path_MSGFMT="$MSGFMT" # Let the user override the test with a path. ;; *) IFS="${IFS= }"; ac_save_ifs="$IFS"; IFS="${IFS}:" for ac_dir in $PATH; do test -z "$ac_dir" && ac_dir=. if test -f $ac_dir/$ac_word; then if test -z "`$ac_dir/$ac_word -h 2>&1 | grep 'dv '`"; then ac_cv_path_MSGFMT="$ac_dir/$ac_word" break fi fi done IFS="$ac_save_ifs" test -z "$ac_cv_path_MSGFMT" && ac_cv_path_MSGFMT="no" ;; esac fi MSGFMT="$ac_cv_path_MSGFMT" if test "$MSGFMT" != "no"; then echo "$as_me:$LINENO: result: $MSGFMT" >&5 echo "${ECHO_T}$MSGFMT" >&6 else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 fi if test "$MSGFMT" != "no"; then glib_save_LIBS="$LIBS" LIBS="$LIBS $INTLLIBS" for ac_func in dcgettext do as_ac_var=`echo "ac_cv_func_$ac_func" | $as_tr_sh` echo "$as_me:$LINENO: checking for $ac_func" >&5 echo $ECHO_N "checking for $ac_func... $ECHO_C" >&6 if eval "test \"\${$as_ac_var+set}\" = set"; then echo $ECHO_N "(cached) $ECHO_C" >&6 else cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ /* Define $ac_func to an innocuous variant, in case declares $ac_func. For example, HP-UX 11i declares gettimeofday. */ #define $ac_func innocuous_$ac_func /* System header to define __stub macros and hopefully few prototypes, which can conflict with char $ac_func (); below. Prefer to if __STDC__ is defined, since exists even on freestanding compilers. */ #ifdef __STDC__ # include #else # include #endif #undef $ac_func /* Override any gcc2 internal prototype to avoid an error. */ #ifdef __cplusplus extern "C" { #endif /* We use char because int might match the return type of a gcc2 builtin and then its argument prototype would still apply. */ char $ac_func (); /* The GNU C library defines this for functions which it implements to always fail with ENOSYS. Some functions are actually named something starting with __ and the normal name is an alias. */ #if defined (__stub_$ac_func) || defined (__stub___$ac_func) choke me #else char (*f) () = $ac_func; #endif #ifdef __cplusplus } #endif int main () { return f != $ac_func; ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then eval "$as_ac_var=yes" else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 eval "$as_ac_var=no" fi rm -f conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext fi echo "$as_me:$LINENO: result: `eval echo '${'$as_ac_var'}'`" >&5 echo "${ECHO_T}`eval echo '${'$as_ac_var'}'`" >&6 if test `eval echo '${'$as_ac_var'}'` = yes; then cat >>confdefs.h <<_ACEOF #define `echo "HAVE_$ac_func" | $as_tr_cpp` 1 _ACEOF fi done # Extract the first word of "gmsgfmt", so it can be a program name with args. set dummy gmsgfmt; ac_word=$2 echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6 if test "${ac_cv_path_GMSGFMT+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else case $GMSGFMT in [\\/]* | ?:[\\/]*) ac_cv_path_GMSGFMT="$GMSGFMT" # Let the user override the test with a path. ;; *) as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then ac_cv_path_GMSGFMT="$as_dir/$ac_word$ac_exec_ext" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done test -z "$ac_cv_path_GMSGFMT" && ac_cv_path_GMSGFMT="$MSGFMT" ;; esac fi GMSGFMT=$ac_cv_path_GMSGFMT if test -n "$GMSGFMT"; then echo "$as_me:$LINENO: result: $GMSGFMT" >&5 echo "${ECHO_T}$GMSGFMT" >&6 else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 fi # Extract the first word of "xgettext", so it can be a program name with args. set dummy xgettext; ac_word=$2 echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6 if test "${ac_cv_path_XGETTEXT+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else case "$XGETTEXT" in /*) ac_cv_path_XGETTEXT="$XGETTEXT" # Let the user override the test with a path. ;; *) IFS="${IFS= }"; ac_save_ifs="$IFS"; IFS="${IFS}:" for ac_dir in $PATH; do test -z "$ac_dir" && ac_dir=. if test -f $ac_dir/$ac_word; then if test -z "`$ac_dir/$ac_word -h 2>&1 | grep '(HELP)'`"; then ac_cv_path_XGETTEXT="$ac_dir/$ac_word" break fi fi done IFS="$ac_save_ifs" test -z "$ac_cv_path_XGETTEXT" && ac_cv_path_XGETTEXT=":" ;; esac fi XGETTEXT="$ac_cv_path_XGETTEXT" if test "$XGETTEXT" != ":"; then echo "$as_me:$LINENO: result: $XGETTEXT" >&5 echo "${ECHO_T}$XGETTEXT" >&6 else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 fi cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ int main () { extern int _nl_msg_cat_cntr; return _nl_msg_cat_cntr ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then CATOBJEXT=.gmo DATADIRNAME=share else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 case $host in *-*-solaris*) echo "$as_me:$LINENO: checking for bind_textdomain_codeset" >&5 echo $ECHO_N "checking for bind_textdomain_codeset... $ECHO_C" >&6 if test "${ac_cv_func_bind_textdomain_codeset+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ /* Define bind_textdomain_codeset to an innocuous variant, in case declares bind_textdomain_codeset. For example, HP-UX 11i declares gettimeofday. */ #define bind_textdomain_codeset innocuous_bind_textdomain_codeset /* System header to define __stub macros and hopefully few prototypes, which can conflict with char bind_textdomain_codeset (); below. Prefer to if __STDC__ is defined, since exists even on freestanding compilers. */ #ifdef __STDC__ # include #else # include #endif #undef bind_textdomain_codeset /* Override any gcc2 internal prototype to avoid an error. */ #ifdef __cplusplus extern "C" { #endif /* We use char because int might match the return type of a gcc2 builtin and then its argument prototype would still apply. */ char bind_textdomain_codeset (); /* The GNU C library defines this for functions which it implements to always fail with ENOSYS. Some functions are actually named something starting with __ and the normal name is an alias. */ #if defined (__stub_bind_textdomain_codeset) || defined (__stub___bind_textdomain_codeset) choke me #else char (*f) () = bind_textdomain_codeset; #endif #ifdef __cplusplus } #endif int main () { return f != bind_textdomain_codeset; ; return 0; } _ACEOF rm -f conftest.$ac_objext conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then ac_cv_func_bind_textdomain_codeset=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_cv_func_bind_textdomain_codeset=no fi rm -f conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext fi echo "$as_me:$LINENO: result: $ac_cv_func_bind_textdomain_codeset" >&5 echo "${ECHO_T}$ac_cv_func_bind_textdomain_codeset" >&6 if test $ac_cv_func_bind_textdomain_codeset = yes; then CATOBJEXT=.gmo DATADIRNAME=share else CATOBJEXT=.mo DATADIRNAME=lib fi ;; *) CATOBJEXT=.mo DATADIRNAME=lib ;; esac fi rm -f conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext LIBS="$glib_save_LIBS" INSTOBJEXT=.mo else gt_cv_have_gettext=no fi fi fi if test "$gt_cv_have_gettext" = "yes" ; then cat >>confdefs.h <<\_ACEOF #define ENABLE_NLS 1 _ACEOF fi if test "$XGETTEXT" != ":"; then if $XGETTEXT --omit-header /dev/null 2> /dev/null; then : ; else echo "$as_me:$LINENO: result: found xgettext program is not GNU xgettext; ignore it" >&5 echo "${ECHO_T}found xgettext program is not GNU xgettext; ignore it" >&6 XGETTEXT=":" fi fi # We need to process the po/ directory. POSUB=po ac_config_commands="$ac_config_commands default-1" for lang in $ALL_LINGUAS; do GMOFILES="$GMOFILES $lang.gmo" POFILES="$POFILES $lang.po" done if test "$gt_cv_have_gettext" = "yes"; then if test "x$ALL_LINGUAS" = "x"; then LINGUAS= else echo "$as_me:$LINENO: checking for catalogs to be installed" >&5 echo $ECHO_N "checking for catalogs to be installed... $ECHO_C" >&6 NEW_LINGUAS= for presentlang in $ALL_LINGUAS; do useit=no if test "%UNSET%" != "${LINGUAS-%UNSET%}"; then desiredlanguages="$LINGUAS" else desiredlanguages="$ALL_LINGUAS" fi for desiredlang in $desiredlanguages; do # Use the presentlang catalog if desiredlang is # a. equal to presentlang, or # b. a variant of presentlang (because in this case, # presentlang can be used as a fallback for messages # which are not translated in the desiredlang catalog). case "$desiredlang" in "$presentlang"*) useit=yes;; esac done if test $useit = yes; then NEW_LINGUAS="$NEW_LINGUAS $presentlang" fi done LINGUAS=$NEW_LINGUAS echo "$as_me:$LINENO: result: $LINGUAS" >&5 echo "${ECHO_T}$LINGUAS" >&6 fi if test -n "$LINGUAS"; then for lang in $LINGUAS; do CATALOGS="$CATALOGS $lang$CATOBJEXT"; done fi fi MKINSTALLDIRS= if test -n "$ac_aux_dir"; then MKINSTALLDIRS="$ac_aux_dir/mkinstalldirs" fi if test -z "$MKINSTALLDIRS"; then MKINSTALLDIRS="\$(top_srcdir)/mkinstalldirs" fi test -d po || mkdir po if test "x$srcdir" != "x."; then if test "x`echo $srcdir | sed 's@/.*@@'`" = "x"; then posrcprefix="$srcdir/" else posrcprefix="../$srcdir/" fi else posrcprefix="../" fi rm -f po/POTFILES sed -e "/^#/d" -e "/^\$/d" -e "s,.*, $posrcprefix& \\\\," -e "\$s/\(.*\) \\\\/\1/" \ < $srcdir/po/POTFILES.in > po/POTFILES glib_save_prefix="$prefix" glib_save_exec_prefix="$exec_prefix" test "x$prefix" = xNONE && prefix=$ac_default_prefix test "x$exec_prefix" = xNONE && exec_prefix=$prefix if test "x$CATOBJEXT" = "x.mo" ; then localedir=`eval echo "${libdir}/locale"` else localedir=`eval echo "${datadir}/locale"` fi prefix="$glib_save_prefix" exec_prefix="$glib_save_exec_prefix" cat >>confdefs.h <<_ACEOF #define LOCALEDIR "$localedir" _ACEOF if test -n ""; then echo "$as_me:$LINENO: checking for intltool >= " >&5 echo $ECHO_N "checking for intltool >= ... $ECHO_C" >&6 INTLTOOL_REQUIRED_VERSION_AS_INT=`echo | awk -F. '{ printf "%d", $1 * 100 + $2; }'` INTLTOOL_APPLIED_VERSION=`awk -F\" '/\\$VERSION / { printf $2; }' < ${ac_aux_dir}/intltool-update.in` INTLTOOL_APPLIED_VERSION_AS_INT=`awk -F\" '/\\$VERSION / { split($2, VERSION, "."); printf "%d\n", VERSION[1] * 100 + VERSION[2];}' < ${ac_aux_dir}/intltool-update.in` if test "$INTLTOOL_APPLIED_VERSION_AS_INT" -ge "$INTLTOOL_REQUIRED_VERSION_AS_INT"; then echo "$as_me:$LINENO: result: $INTLTOOL_APPLIED_VERSION found" >&5 echo "${ECHO_T}$INTLTOOL_APPLIED_VERSION found" >&6 else echo "$as_me:$LINENO: result: $INTLTOOL_APPLIED_VERSION found. Your intltool is too old. You need intltool or later." >&5 echo "${ECHO_T}$INTLTOOL_APPLIED_VERSION found. Your intltool is too old. You need intltool or later." >&6 exit 1 fi fi INTLTOOL_DESKTOP_RULE='%.desktop: %.desktop.in $(INTLTOOL_MERGE) $(wildcard $(top_srcdir)/po/*.po) ; LC_ALL=C $(INTLTOOL_MERGE) -d -u -c $(top_builddir)/po/.intltool-merge-cache $(top_srcdir)/po $< $@' INTLTOOL_DIRECTORY_RULE='%.directory: %.directory.in $(INTLTOOL_MERGE) $(wildcard $(top_srcdir)/po/*.po) ; LC_ALL=C $(INTLTOOL_MERGE) -d -u -c $(top_builddir)/po/.intltool-merge-cache $(top_srcdir)/po $< $@' INTLTOOL_KEYS_RULE='%.keys: %.keys.in $(INTLTOOL_MERGE) $(wildcard $(top_srcdir)/po/*.po) ; LC_ALL=C $(INTLTOOL_MERGE) -k -u -c $(top_builddir)/po/.intltool-merge-cache $(top_srcdir)/po $< $@' INTLTOOL_PROP_RULE='%.prop: %.prop.in $(INTLTOOL_MERGE) $(wildcard $(top_srcdir)/po/*.po) ; LC_ALL=C $(INTLTOOL_MERGE) -d -u -c $(top_builddir)/po/.intltool-merge-cache $(top_srcdir)/po $< $@' INTLTOOL_OAF_RULE='%.oaf: %.oaf.in $(INTLTOOL_MERGE) $(wildcard $(top_srcdir)/po/*.po) ; LC_ALL=C $(INTLTOOL_MERGE) -o -p $(top_srcdir)/po $< $@' INTLTOOL_PONG_RULE='%.pong: %.pong.in $(INTLTOOL_MERGE) $(wildcard $(top_srcdir)/po/*.po) ; LC_ALL=C $(INTLTOOL_MERGE) -x -u -c $(top_builddir)/po/.intltool-merge-cache $(top_srcdir)/po $< $@' INTLTOOL_SERVER_RULE='%.server: %.server.in $(INTLTOOL_MERGE) $(wildcard $(top_srcdir)/po/*.po) ; LC_ALL=C $(INTLTOOL_MERGE) -o -u -c $(top_builddir)/po/.intltool-merge-cache $(top_srcdir)/po $< $@' INTLTOOL_SHEET_RULE='%.sheet: %.sheet.in $(INTLTOOL_MERGE) $(wildcard $(top_srcdir)/po/*.po) ; LC_ALL=C $(INTLTOOL_MERGE) -x -u -c $(top_builddir)/po/.intltool-merge-cache $(top_srcdir)/po $< $@' INTLTOOL_SOUNDLIST_RULE='%.soundlist: %.soundlist.in $(INTLTOOL_MERGE) $(wildcard $(top_srcdir)/po/*.po) ; LC_ALL=C $(INTLTOOL_MERGE) -d -u -c $(top_builddir)/po/.intltool-merge-cache $(top_srcdir)/po $< $@' INTLTOOL_UI_RULE='%.ui: %.ui.in $(INTLTOOL_MERGE) $(wildcard $(top_srcdir)/po/*.po) ; LC_ALL=C $(INTLTOOL_MERGE) -x -u -c $(top_builddir)/po/.intltool-merge-cache $(top_srcdir)/po $< $@' INTLTOOL_XML_RULE='%.xml: %.xml.in $(INTLTOOL_MERGE) $(wildcard $(top_srcdir)/po/*.po) ; LC_ALL=C $(INTLTOOL_MERGE) -x -u -c $(top_builddir)/po/.intltool-merge-cache $(top_srcdir)/po $< $@' INTLTOOL_XML_NOMERGE_RULE='%.xml: %.xml.in $(INTLTOOL_MERGE) ; LC_ALL=C $(INTLTOOL_MERGE) -x -u /tmp $< $@' INTLTOOL_XAM_RULE='%.xam: %.xml.in $(INTLTOOL_MERGE) $(wildcard $(top_srcdir)/po/*.po) ; LC_ALL=C $(INTLTOOL_MERGE) -x -u -c $(top_builddir)/po/.intltool-merge-cache $(top_srcdir)/po $< $@' INTLTOOL_KBD_RULE='%.kbd: %.kbd.in $(INTLTOOL_MERGE) $(wildcard $(top_srcdir)/po/*.po) ; LC_ALL=C $(INTLTOOL_MERGE) -x -u -m -c $(top_builddir)/po/.intltool-merge-cache $(top_srcdir)/po $< $@' INTLTOOL_CAVES_RULE='%.caves: %.caves.in $(INTLTOOL_MERGE) $(wildcard $(top_srcdir)/po/*.po) ; LC_ALL=C $(INTLTOOL_MERGE) -d -u -c $(top_builddir)/po/.intltool-merge-cache $(top_srcdir)/po $< $@' INTLTOOL_SCHEMAS_RULE='%.schemas: %.schemas.in $(INTLTOOL_MERGE) $(wildcard $(top_srcdir)/po/*.po) ; LC_ALL=C $(INTLTOOL_MERGE) -s -u -c $(top_builddir)/po/.intltool-merge-cache $(top_srcdir)/po $< $@' INTLTOOL_THEME_RULE='%.theme: %.theme.in $(INTLTOOL_MERGE) $(wildcard $(top_srcdir)/po/*.po) ; LC_ALL=C $(INTLTOOL_MERGE) -d -u -c $(top_builddir)/po/.intltool-merge-cache $(top_srcdir)/po $< $@' # Use the tools built into the package, not the ones that are installed. INTLTOOL_EXTRACT='$(top_builddir)/intltool-extract' INTLTOOL_MERGE='$(top_builddir)/intltool-merge' INTLTOOL_UPDATE='$(top_builddir)/intltool-update' # Extract the first word of "perl", so it can be a program name with args. set dummy perl; ac_word=$2 echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6 if test "${ac_cv_path_INTLTOOL_PERL+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else case $INTLTOOL_PERL in [\\/]* | ?:[\\/]*) ac_cv_path_INTLTOOL_PERL="$INTLTOOL_PERL" # Let the user override the test with a path. ;; *) as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then ac_cv_path_INTLTOOL_PERL="$as_dir/$ac_word$ac_exec_ext" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done ;; esac fi INTLTOOL_PERL=$ac_cv_path_INTLTOOL_PERL if test -n "$INTLTOOL_PERL"; then echo "$as_me:$LINENO: result: $INTLTOOL_PERL" >&5 echo "${ECHO_T}$INTLTOOL_PERL" >&6 else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 fi if test -z "$INTLTOOL_PERL"; then { { echo "$as_me:$LINENO: error: perl not found; required for intltool" >&5 echo "$as_me: error: perl not found; required for intltool" >&2;} { (exit 1); exit 1; }; } fi if test -z "`$INTLTOOL_PERL -v | fgrep '5.' 2> /dev/null`"; then { { echo "$as_me:$LINENO: error: perl 5.x required for intltool" >&5 echo "$as_me: error: perl 5.x required for intltool" >&2;} { (exit 1); exit 1; }; } fi if test "x" != "xno-xml"; then echo "$as_me:$LINENO: checking for XML::Parser" >&5 echo $ECHO_N "checking for XML::Parser... $ECHO_C" >&6 if `$INTLTOOL_PERL -e "require XML::Parser" 2>/dev/null`; then echo "$as_me:$LINENO: result: ok" >&5 echo "${ECHO_T}ok" >&6 else { { echo "$as_me:$LINENO: error: XML::Parser perl module is required for intltool" >&5 echo "$as_me: error: XML::Parser perl module is required for intltool" >&2;} { (exit 1); exit 1; }; } fi fi # Extract the first word of "iconv", so it can be a program name with args. set dummy iconv; ac_word=$2 echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6 if test "${ac_cv_path_ICONV+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else case $ICONV in [\\/]* | ?:[\\/]*) ac_cv_path_ICONV="$ICONV" # Let the user override the test with a path. ;; *) as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then ac_cv_path_ICONV="$as_dir/$ac_word$ac_exec_ext" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done test -z "$ac_cv_path_ICONV" && ac_cv_path_ICONV="iconv" ;; esac fi ICONV=$ac_cv_path_ICONV if test -n "$ICONV"; then echo "$as_me:$LINENO: result: $ICONV" >&5 echo "${ECHO_T}$ICONV" >&6 else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 fi # Extract the first word of "msgfmt", so it can be a program name with args. set dummy msgfmt; ac_word=$2 echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6 if test "${ac_cv_path_MSGFMT+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else case $MSGFMT in [\\/]* | ?:[\\/]*) ac_cv_path_MSGFMT="$MSGFMT" # Let the user override the test with a path. ;; *) as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then ac_cv_path_MSGFMT="$as_dir/$ac_word$ac_exec_ext" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done test -z "$ac_cv_path_MSGFMT" && ac_cv_path_MSGFMT="msgfmt" ;; esac fi MSGFMT=$ac_cv_path_MSGFMT if test -n "$MSGFMT"; then echo "$as_me:$LINENO: result: $MSGFMT" >&5 echo "${ECHO_T}$MSGFMT" >&6 else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 fi # Extract the first word of "msgmerge", so it can be a program name with args. set dummy msgmerge; ac_word=$2 echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6 if test "${ac_cv_path_MSGMERGE+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else case $MSGMERGE in [\\/]* | ?:[\\/]*) ac_cv_path_MSGMERGE="$MSGMERGE" # Let the user override the test with a path. ;; *) as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then ac_cv_path_MSGMERGE="$as_dir/$ac_word$ac_exec_ext" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done test -z "$ac_cv_path_MSGMERGE" && ac_cv_path_MSGMERGE="msgmerge" ;; esac fi MSGMERGE=$ac_cv_path_MSGMERGE if test -n "$MSGMERGE"; then echo "$as_me:$LINENO: result: $MSGMERGE" >&5 echo "${ECHO_T}$MSGMERGE" >&6 else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 fi # Extract the first word of "xgettext", so it can be a program name with args. set dummy xgettext; ac_word=$2 echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6 if test "${ac_cv_path_XGETTEXT+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else case $XGETTEXT in [\\/]* | ?:[\\/]*) ac_cv_path_XGETTEXT="$XGETTEXT" # Let the user override the test with a path. ;; *) as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then ac_cv_path_XGETTEXT="$as_dir/$ac_word$ac_exec_ext" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done test -z "$ac_cv_path_XGETTEXT" && ac_cv_path_XGETTEXT="xgettext" ;; esac fi XGETTEXT=$ac_cv_path_XGETTEXT if test -n "$XGETTEXT"; then echo "$as_me:$LINENO: result: $XGETTEXT" >&5 echo "${ECHO_T}$XGETTEXT" >&6 else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 fi # Remove file type tags (using []) from po/POTFILES. if mkdir -p --version . >/dev/null 2>&1 && test ! -d ./--version; then # Keeping the `.' argument allows $(mkdir_p) to be used without # argument. Indeed, we sometimes output rules like # $(mkdir_p) $(somedir) # where $(somedir) is conditionally defined. # (`test -n '$(somedir)' && $(mkdir_p) $(somedir)' is a more # expensive solution, as it forces Make to start a sub-shell.) mkdir_p='mkdir -p -- .' else # On NextStep and OpenStep, the `mkdir' command does not # recognize any option. It will interpret all options as # directories to create, and then abort because `.' already # exists. for d in ./-p ./--version; do test -d $d && rmdir $d done # $(mkinstalldirs) is defined by Automake if mkinstalldirs exists. if test -f "$ac_aux_dir/mkinstalldirs"; then mkdir_p='$(mkinstalldirs)' else mkdir_p='$(install_sh) -d' fi fi # Manually sed perl in so people don't have to put the intltool scripts in AC_OUTPUT. ac_config_commands="$ac_config_commands intltool" ### system features # Check whether --enable-largefile or --disable-largefile was given. if test "${enable_largefile+set}" = set; then enableval="$enable_largefile" fi; if test "$enable_largefile" != no; then echo "$as_me:$LINENO: checking for special C compiler options needed for large files" >&5 echo $ECHO_N "checking for special C compiler options needed for large files... $ECHO_C" >&6 if test "${ac_cv_sys_largefile_CC+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else ac_cv_sys_largefile_CC=no if test "$GCC" != yes; then ac_save_CC=$CC while :; do # IRIX 6.2 and later do not support large files by default, # so use the C compiler's -n32 option if that helps. cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #include /* Check that off_t can represent 2**63 - 1 correctly. We can't simply define LARGE_OFF_T to be 9223372036854775807, since some C++ compilers masquerading as C compilers incorrectly reject 9223372036854775807. */ #define LARGE_OFF_T (((off_t) 1 << 62) - 1 + ((off_t) 1 << 62)) int off_t_is_large[(LARGE_OFF_T % 2147483629 == 721 && LARGE_OFF_T % 2147483647 == 1) ? 1 : -1]; int main () { ; return 0; } _ACEOF rm -f conftest.$ac_objext if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5 (eval $ac_compile) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest.$ac_objext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then break else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 fi rm -f conftest.err conftest.$ac_objext CC="$CC -n32" rm -f conftest.$ac_objext if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5 (eval $ac_compile) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest.$ac_objext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then ac_cv_sys_largefile_CC=' -n32'; break else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 fi rm -f conftest.err conftest.$ac_objext break done CC=$ac_save_CC rm -f conftest.$ac_ext fi fi echo "$as_me:$LINENO: result: $ac_cv_sys_largefile_CC" >&5 echo "${ECHO_T}$ac_cv_sys_largefile_CC" >&6 if test "$ac_cv_sys_largefile_CC" != no; then CC=$CC$ac_cv_sys_largefile_CC fi echo "$as_me:$LINENO: checking for _FILE_OFFSET_BITS value needed for large files" >&5 echo $ECHO_N "checking for _FILE_OFFSET_BITS value needed for large files... $ECHO_C" >&6 if test "${ac_cv_sys_file_offset_bits+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else while :; do ac_cv_sys_file_offset_bits=no cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #include /* Check that off_t can represent 2**63 - 1 correctly. We can't simply define LARGE_OFF_T to be 9223372036854775807, since some C++ compilers masquerading as C compilers incorrectly reject 9223372036854775807. */ #define LARGE_OFF_T (((off_t) 1 << 62) - 1 + ((off_t) 1 << 62)) int off_t_is_large[(LARGE_OFF_T % 2147483629 == 721 && LARGE_OFF_T % 2147483647 == 1) ? 1 : -1]; int main () { ; return 0; } _ACEOF rm -f conftest.$ac_objext if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5 (eval $ac_compile) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest.$ac_objext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then break else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 fi rm -f conftest.err conftest.$ac_objext conftest.$ac_ext cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #define _FILE_OFFSET_BITS 64 #include /* Check that off_t can represent 2**63 - 1 correctly. We can't simply define LARGE_OFF_T to be 9223372036854775807, since some C++ compilers masquerading as C compilers incorrectly reject 9223372036854775807. */ #define LARGE_OFF_T (((off_t) 1 << 62) - 1 + ((off_t) 1 << 62)) int off_t_is_large[(LARGE_OFF_T % 2147483629 == 721 && LARGE_OFF_T % 2147483647 == 1) ? 1 : -1]; int main () { ; return 0; } _ACEOF rm -f conftest.$ac_objext if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5 (eval $ac_compile) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest.$ac_objext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then ac_cv_sys_file_offset_bits=64; break else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 fi rm -f conftest.err conftest.$ac_objext conftest.$ac_ext break done fi echo "$as_me:$LINENO: result: $ac_cv_sys_file_offset_bits" >&5 echo "${ECHO_T}$ac_cv_sys_file_offset_bits" >&6 if test "$ac_cv_sys_file_offset_bits" != no; then cat >>confdefs.h <<_ACEOF #define _FILE_OFFSET_BITS $ac_cv_sys_file_offset_bits _ACEOF fi rm -f conftest* echo "$as_me:$LINENO: checking for _LARGE_FILES value needed for large files" >&5 echo $ECHO_N "checking for _LARGE_FILES value needed for large files... $ECHO_C" >&6 if test "${ac_cv_sys_large_files+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else while :; do ac_cv_sys_large_files=no cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #include /* Check that off_t can represent 2**63 - 1 correctly. We can't simply define LARGE_OFF_T to be 9223372036854775807, since some C++ compilers masquerading as C compilers incorrectly reject 9223372036854775807. */ #define LARGE_OFF_T (((off_t) 1 << 62) - 1 + ((off_t) 1 << 62)) int off_t_is_large[(LARGE_OFF_T % 2147483629 == 721 && LARGE_OFF_T % 2147483647 == 1) ? 1 : -1]; int main () { ; return 0; } _ACEOF rm -f conftest.$ac_objext if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5 (eval $ac_compile) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest.$ac_objext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then break else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 fi rm -f conftest.err conftest.$ac_objext conftest.$ac_ext cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #define _LARGE_FILES 1 #include /* Check that off_t can represent 2**63 - 1 correctly. We can't simply define LARGE_OFF_T to be 9223372036854775807, since some C++ compilers masquerading as C compilers incorrectly reject 9223372036854775807. */ #define LARGE_OFF_T (((off_t) 1 << 62) - 1 + ((off_t) 1 << 62)) int off_t_is_large[(LARGE_OFF_T % 2147483629 == 721 && LARGE_OFF_T % 2147483647 == 1) ? 1 : -1]; int main () { ; return 0; } _ACEOF rm -f conftest.$ac_objext if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5 (eval $ac_compile) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest.$ac_objext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then ac_cv_sys_large_files=1; break else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 fi rm -f conftest.err conftest.$ac_objext conftest.$ac_ext break done fi echo "$as_me:$LINENO: result: $ac_cv_sys_large_files" >&5 echo "${ECHO_T}$ac_cv_sys_large_files" >&6 if test "$ac_cv_sys_large_files" != no; then cat >>confdefs.h <<_ACEOF #define _LARGE_FILES $ac_cv_sys_large_files _ACEOF fi rm -f conftest* fi # check for ANSI C headers echo "$as_me:$LINENO: checking for ANSI C header files" >&5 echo $ECHO_N "checking for ANSI C header files... $ECHO_C" >&6 if test "${ac_cv_header_stdc+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #include #include #include #include int main () { ; return 0; } _ACEOF rm -f conftest.$ac_objext if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5 (eval $ac_compile) 2>conftest.er1 ac_status=$? grep -v '^ *+' conftest.er1 >conftest.err rm -f conftest.er1 cat conftest.err >&5 echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='test -z "$ac_c_werror_flag" || test ! -s conftest.err' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; } && { ac_try='test -s conftest.$ac_objext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then ac_cv_header_stdc=yes else echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_cv_header_stdc=no fi rm -f conftest.err conftest.$ac_objext conftest.$ac_ext if test $ac_cv_header_stdc = yes; then # SunOS 4.x string.h does not declare mem*, contrary to ANSI. cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #include _ACEOF if (eval "$ac_cpp conftest.$ac_ext") 2>&5 | $EGREP "memchr" >/dev/null 2>&1; then : else ac_cv_header_stdc=no fi rm -f conftest* fi if test $ac_cv_header_stdc = yes; then # ISC 2.0.2 stdlib.h does not declare free, contrary to ANSI. cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #include _ACEOF if (eval "$ac_cpp conftest.$ac_ext") 2>&5 | $EGREP "free" >/dev/null 2>&1; then : else ac_cv_header_stdc=no fi rm -f conftest* fi if test $ac_cv_header_stdc = yes; then # /bin/cc in Irix-4.0.5 gets non-ANSI ctype macros unless using -ansi. if test "$cross_compiling" = yes; then : else cat >conftest.$ac_ext <<_ACEOF /* confdefs.h. */ _ACEOF cat confdefs.h >>conftest.$ac_ext cat >>conftest.$ac_ext <<_ACEOF /* end confdefs.h. */ #include #if ((' ' & 0x0FF) == 0x020) # define ISLOWER(c) ('a' <= (c) && (c) <= 'z') # define TOUPPER(c) (ISLOWER(c) ? 'A' + ((c) - 'a') : (c)) #else # define ISLOWER(c) \ (('a' <= (c) && (c) <= 'i') \ || ('j' <= (c) && (c) <= 'r') \ || ('s' <= (c) && (c) <= 'z')) # define TOUPPER(c) (ISLOWER(c) ? ((c) | 0x40) : (c)) #endif #define XOR(e, f) (((e) && !(f)) || (!(e) && (f))) int main () { int i; for (i = 0; i < 256; i++) if (XOR (islower (i), ISLOWER (i)) || toupper (i) != TOUPPER (i)) exit(2); exit (0); } _ACEOF rm -f conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='./conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then : else echo "$as_me: program exited with status $ac_status" >&5 echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ( exit $ac_status ) ac_cv_header_stdc=no fi rm -f core *.core gmon.out bb.out conftest$ac_exeext conftest.$ac_objext conftest.$ac_ext fi fi fi echo "$as_me:$LINENO: result: $ac_cv_header_stdc" >&5 echo "${ECHO_T}$ac_cv_header_stdc" >&6 if test $ac_cv_header_stdc = yes; then cat >>confdefs.h <<\_ACEOF #define STDC_HEADERS 1 _ACEOF fi if test $ac_cv_header_stdc != yes; then { { echo "$as_me:$LINENO: error: ANSI C headers not present" >&5 echo "$as_me: error: ANSI C headers not present" >&2;} { (exit 1); exit 1; }; } fi ### mandatory libraries and programs succeeded=no if test -z "$PKG_CONFIG"; then # Extract the first word of "pkg-config", so it can be a program name with args. set dummy pkg-config; ac_word=$2 echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6 if test "${ac_cv_path_PKG_CONFIG+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else case $PKG_CONFIG in [\\/]* | ?:[\\/]*) ac_cv_path_PKG_CONFIG="$PKG_CONFIG" # Let the user override the test with a path. ;; *) as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then ac_cv_path_PKG_CONFIG="$as_dir/$ac_word$ac_exec_ext" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done test -z "$ac_cv_path_PKG_CONFIG" && ac_cv_path_PKG_CONFIG="no" ;; esac fi PKG_CONFIG=$ac_cv_path_PKG_CONFIG if test -n "$PKG_CONFIG"; then echo "$as_me:$LINENO: result: $PKG_CONFIG" >&5 echo "${ECHO_T}$PKG_CONFIG" >&6 else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 fi fi if test "$PKG_CONFIG" = "no" ; then echo "*** The pkg-config script could not be found. Make sure it is" echo "*** in your path, or set the PKG_CONFIG environment variable" echo "*** to the full path to pkg-config." echo "*** Or see http://www.freedesktop.org/software/pkgconfig to get pkg-config." else PKG_CONFIG_MIN_VERSION=0.9.0 if $PKG_CONFIG --atleast-pkgconfig-version $PKG_CONFIG_MIN_VERSION; then echo "$as_me:$LINENO: checking for gobject-2.0 >= 2.4.0 gmodule-2.0 >= 2.4.0 gthread-2.0 >= 2.4.0" >&5 echo $ECHO_N "checking for gobject-2.0 >= 2.4.0 gmodule-2.0 >= 2.4.0 gthread-2.0 >= 2.4.0... $ECHO_C" >&6 if $PKG_CONFIG --exists "gobject-2.0 >= 2.4.0 gmodule-2.0 >= 2.4.0 gthread-2.0 >= 2.4.0" ; then echo "$as_me:$LINENO: result: yes" >&5 echo "${ECHO_T}yes" >&6 succeeded=yes echo "$as_me:$LINENO: checking GLIB_CFLAGS" >&5 echo $ECHO_N "checking GLIB_CFLAGS... $ECHO_C" >&6 GLIB_CFLAGS=`$PKG_CONFIG --cflags "gobject-2.0 >= 2.4.0 gmodule-2.0 >= 2.4.0 gthread-2.0 >= 2.4.0"` echo "$as_me:$LINENO: result: $GLIB_CFLAGS" >&5 echo "${ECHO_T}$GLIB_CFLAGS" >&6 echo "$as_me:$LINENO: checking GLIB_LIBS" >&5 echo $ECHO_N "checking GLIB_LIBS... $ECHO_C" >&6 GLIB_LIBS=`$PKG_CONFIG --libs "gobject-2.0 >= 2.4.0 gmodule-2.0 >= 2.4.0 gthread-2.0 >= 2.4.0"` echo "$as_me:$LINENO: result: $GLIB_LIBS" >&5 echo "${ECHO_T}$GLIB_LIBS" >&6 else GLIB_CFLAGS="" GLIB_LIBS="" ## If we have a custom action on failure, don't print errors, but ## do set a variable so people can do so. GLIB_PKG_ERRORS=`$PKG_CONFIG --errors-to-stdout --print-errors "gobject-2.0 >= 2.4.0 gmodule-2.0 >= 2.4.0 gthread-2.0 >= 2.4.0"` fi else echo "*** Your version of pkg-config is too old. You need version $PKG_CONFIG_MIN_VERSION or newer." echo "*** See http://www.freedesktop.org/software/pkgconfig" fi fi if test $succeeded = yes; then : else { { echo "$as_me:$LINENO: error: unable to find the GLib libraries" >&5 echo "$as_me: error: unable to find the GLib libraries" >&2;} { (exit 1); exit 1; }; } fi # not needed by end users # Check whether --with-html-dir or --without-html-dir was given. if test "${with_html_dir+set}" = set; then withval="$with_html_dir" else with_html_dir='${datadir}/gtk-doc/html' fi; HTML_DIR="$with_html_dir" # Check whether --enable-gtk-doc or --disable-gtk-doc was given. if test "${enable_gtk_doc+set}" = set; then enableval="$enable_gtk_doc" else enable_gtk_doc=no fi; have_gtk_doc=no if test x$enable_gtk_doc = xyes; then if test -z "$PKG_CONFIG"; then # Extract the first word of "pkg-config", so it can be a program name with args. set dummy pkg-config; ac_word=$2 echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6 if test "${ac_cv_path_PKG_CONFIG+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else case $PKG_CONFIG in [\\/]* | ?:[\\/]*) ac_cv_path_PKG_CONFIG="$PKG_CONFIG" # Let the user override the test with a path. ;; *) as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then ac_cv_path_PKG_CONFIG="$as_dir/$ac_word$ac_exec_ext" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done test -z "$ac_cv_path_PKG_CONFIG" && ac_cv_path_PKG_CONFIG="no" ;; esac fi PKG_CONFIG=$ac_cv_path_PKG_CONFIG if test -n "$PKG_CONFIG"; then echo "$as_me:$LINENO: result: $PKG_CONFIG" >&5 echo "${ECHO_T}$PKG_CONFIG" >&6 else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 fi fi if test "$PKG_CONFIG" != "no" && $PKG_CONFIG --exists gtk-doc; then have_gtk_doc=yes fi gtk_doc_min_version=1.0 if test "$have_gtk_doc" = yes; then echo "$as_me:$LINENO: checking gtk-doc version >= $gtk_doc_min_version" >&5 echo $ECHO_N "checking gtk-doc version >= $gtk_doc_min_version... $ECHO_C" >&6 if $PKG_CONFIG --atleast-version $gtk_doc_min_version gtk-doc; then echo "$as_me:$LINENO: result: yes" >&5 echo "${ECHO_T}yes" >&6 else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 have_gtk_doc=no fi fi if test "$have_gtk_doc" != yes; then enable_gtk_doc=no fi fi if test x$enable_gtk_doc = xyes; then ENABLE_GTK_DOC_TRUE= ENABLE_GTK_DOC_FALSE='#' else ENABLE_GTK_DOC_TRUE='#' ENABLE_GTK_DOC_FALSE= fi if test -n "$LIBTOOL"; then GTK_DOC_USE_LIBTOOL_TRUE= GTK_DOC_USE_LIBTOOL_FALSE='#' else GTK_DOC_USE_LIBTOOL_TRUE='#' GTK_DOC_USE_LIBTOOL_FALSE= fi ### optional libraries if test $enable_generic = yes; then succeeded=no if test -z "$PKG_CONFIG"; then # Extract the first word of "pkg-config", so it can be a program name with args. set dummy pkg-config; ac_word=$2 echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6 if test "${ac_cv_path_PKG_CONFIG+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else case $PKG_CONFIG in [\\/]* | ?:[\\/]*) ac_cv_path_PKG_CONFIG="$PKG_CONFIG" # Let the user override the test with a path. ;; *) as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then ac_cv_path_PKG_CONFIG="$as_dir/$ac_word$ac_exec_ext" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done test -z "$ac_cv_path_PKG_CONFIG" && ac_cv_path_PKG_CONFIG="no" ;; esac fi PKG_CONFIG=$ac_cv_path_PKG_CONFIG if test -n "$PKG_CONFIG"; then echo "$as_me:$LINENO: result: $PKG_CONFIG" >&5 echo "${ECHO_T}$PKG_CONFIG" >&6 else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 fi fi if test "$PKG_CONFIG" = "no" ; then echo "*** The pkg-config script could not be found. Make sure it is" echo "*** in your path, or set the PKG_CONFIG environment variable" echo "*** to the full path to pkg-config." echo "*** Or see http://www.freedesktop.org/software/pkgconfig to get pkg-config." else PKG_CONFIG_MIN_VERSION=0.9.0 if $PKG_CONFIG --atleast-pkgconfig-version $PKG_CONFIG_MIN_VERSION; then echo "$as_me:$LINENO: checking for libsoup-2.2" >&5 echo $ECHO_N "checking for libsoup-2.2... $ECHO_C" >&6 if $PKG_CONFIG --exists "libsoup-2.2" ; then echo "$as_me:$LINENO: result: yes" >&5 echo "${ECHO_T}yes" >&6 succeeded=yes echo "$as_me:$LINENO: checking SOUP_CFLAGS" >&5 echo $ECHO_N "checking SOUP_CFLAGS... $ECHO_C" >&6 SOUP_CFLAGS=`$PKG_CONFIG --cflags "libsoup-2.2"` echo "$as_me:$LINENO: result: $SOUP_CFLAGS" >&5 echo "${ECHO_T}$SOUP_CFLAGS" >&6 echo "$as_me:$LINENO: checking SOUP_LIBS" >&5 echo $ECHO_N "checking SOUP_LIBS... $ECHO_C" >&6 SOUP_LIBS=`$PKG_CONFIG --libs "libsoup-2.2"` echo "$as_me:$LINENO: result: $SOUP_LIBS" >&5 echo "${ECHO_T}$SOUP_LIBS" >&6 else SOUP_CFLAGS="" SOUP_LIBS="" ## If we have a custom action on failure, don't print errors, but ## do set a variable so people can do so. SOUP_PKG_ERRORS=`$PKG_CONFIG --errors-to-stdout --print-errors "libsoup-2.2"` fi else echo "*** Your version of pkg-config is too old. You need version $PKG_CONFIG_MIN_VERSION or newer." echo "*** See http://www.freedesktop.org/software/pkgconfig" fi fi if test $succeeded = yes; then : else { echo "$as_me:$LINENO: libsoup not found: forcing --disable-generic" >&5 echo "$as_me: libsoup not found: forcing --disable-generic" >&6;} enable_generic=no disable_generic_reason="(libsoup not found)" fi fi if test $enable_generic = yes; then succeeded=no if test -z "$PKG_CONFIG"; then # Extract the first word of "pkg-config", so it can be a program name with args. set dummy pkg-config; ac_word=$2 echo "$as_me:$LINENO: checking for $ac_word" >&5 echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6 if test "${ac_cv_path_PKG_CONFIG+set}" = set; then echo $ECHO_N "(cached) $ECHO_C" >&6 else case $PKG_CONFIG in [\\/]* | ?:[\\/]*) ac_cv_path_PKG_CONFIG="$PKG_CONFIG" # Let the user override the test with a path. ;; *) as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then ac_cv_path_PKG_CONFIG="$as_dir/$ac_word$ac_exec_ext" echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done test -z "$ac_cv_path_PKG_CONFIG" && ac_cv_path_PKG_CONFIG="no" ;; esac fi PKG_CONFIG=$ac_cv_path_PKG_CONFIG if test -n "$PKG_CONFIG"; then echo "$as_me:$LINENO: result: $PKG_CONFIG" >&5 echo "${ECHO_T}$PKG_CONFIG" >&6 else echo "$as_me:$LINENO: result: no" >&5 echo "${ECHO_T}no" >&6 fi fi if test "$PKG_CONFIG" = "no" ; then echo "*** The pkg-config script could not be found. Make sure it is" echo "*** in your path, or set the PKG_CONFIG environment variable" echo "*** to the full path to pkg-config." echo "*** Or see http://www.freedesktop.org/software/pkgconfig to get pkg-config." else PKG_CONFIG_MIN_VERSION=0.9.0 if $PKG_CONFIG --atleast-pkgconfig-version $PKG_CONFIG_MIN_VERSION; then echo "$as_me:$LINENO: checking for libxml-2.0" >&5 echo $ECHO_N "checking for libxml-2.0... $ECHO_C" >&6 if $PKG_CONFIG --exists "libxml-2.0" ; then echo "$as_me:$LINENO: result: yes" >&5 echo "${ECHO_T}yes" >&6 succeeded=yes echo "$as_me:$LINENO: checking LIBXML_CFLAGS" >&5 echo $ECHO_N "checking LIBXML_CFLAGS... $ECHO_C" >&6 LIBXML_CFLAGS=`$PKG_CONFIG --cflags "libxml-2.0"` echo "$as_me:$LINENO: result: $LIBXML_CFLAGS" >&5 echo "${ECHO_T}$LIBXML_CFLAGS" >&6 echo "$as_me:$LINENO: checking LIBXML_LIBS" >&5 echo $ECHO_N "checking LIBXML_LIBS... $ECHO_C" >&6 LIBXML_LIBS=`$PKG_CONFIG --libs "libxml-2.0"` echo "$as_me:$LINENO: result: $LIBXML_LIBS" >&5 echo "${ECHO_T}$LIBXML_LIBS" >&6 else LIBXML_CFLAGS="" LIBXML_LIBS="" ## If we have a custom action on failure, don't print errors, but ## do set a variable so people can do so. LIBXML_PKG_ERRORS=`$PKG_CONFIG --errors-to-stdout --print-errors "libxml-2.0"` fi else echo "*** Your version of pkg-config is too old. You need version $PKG_CONFIG_MIN_VERSION or newer." echo "*** See http://www.freedesktop.org/software/pkgconfig" fi fi if test $succeeded = yes; then : else { echo "$as_me:$LINENO: libxml not found: forcing --disable-generic" >&5 echo "$as_me: libxml not found: forcing --disable-generic" >&6;} enable_generic=no disable_generic_reason="(libxml not found)" fi fi if test $enable_talkfilters = yes; then TALKFILTERS_CFLAGS="" TALKFILTERS_LIBS="-ltalkfilters" ac_save_CFLAGS="$CFLAGS" ac_save_LIBS="$LIBS" CFLAGS="$CFLAGS $TALKFILTERS_CFLAGS" LIBS="$LIBS $TALKFILTERS_LIBS" echo "$as_me:$LINENO: checking for GNU Talk Filters" >&5 echo $ECHO_N "checking for GNU Talk Filters... $ECHO_C" >&6 if test "$cross_compiling" = yes; then found=yes else cat >conftest.$ac_ext <<_ACEOF #include int main() { gtf_filter_list; exit(0); } _ACEOF rm -f conftest$ac_exeext if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5 (eval $ac_link) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); } && { ac_try='./conftest$ac_exeext' { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5 (eval $ac_try) 2>&5 ac_status=$? echo "$as_me:$LINENO: \$? = $ac_status" >&5 (exit $ac_status); }; }; then found=yes else echo "$as_me: program exited with status $ac_status" >&5 echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ( exit $ac_status ) found=no fi rm -f core *.core gmon.out bb.out conftest$ac_exeext conftest.$ac_objext conftest.$ac_ext fi echo "$as_me:$LINENO: result: $found" >&5 echo "${ECHO_T}$found" >&6 CFLAGS="$ac_save_CFLAGS" LIBS="$ac_save_LIBS" if test $found = yes; then : else TALKFILTERS_CFLAGS="" TALKFILTERS_LIBS="" { echo "$as_me:$LINENO: GNU Talk Filters not found: forcing --disable-talkfilters" >&5 echo "$as_me: GNU Talk Filters not found: forcing --disable-talkfilters" >&6;} enable_talkfilters=no disable_talkfilters_reason="(GNU Talk Filters not found)" fi fi ### Automake conditionals if test $enable_generic = yes; then WITH_GENERIC_TRUE= WITH_GENERIC_FALSE='#' else WITH_GENERIC_TRUE='#' WITH_GENERIC_FALSE= fi if test $enable_talkfilters = yes; then WITH_TALKFILTERS_TRUE= WITH_TALKFILTERS_FALSE='#' else WITH_TALKFILTERS_TRUE='#' WITH_TALKFILTERS_FALSE= fi if test $enable_regression_tests = yes; then WITH_REGRESSION_TESTS_TRUE= WITH_REGRESSION_TESTS_FALSE='#' else WITH_REGRESSION_TESTS_TRUE='#' WITH_REGRESSION_TESTS_FALSE= fi ### output ac_config_files="$ac_config_files Makefile data/Makefile data/libtranslate.pc docs/Makefile docs/man/Makefile docs/man/version.xml docs/reference/Makefile docs/reference/version.xml m4/Makefile po/Makefile.in src/Makefile src/modules/Makefile" cat >confcache <<\_ACEOF # This file is a shell script that caches the results of configure # tests run on this system so they can be shared between configure # scripts and configure runs, see configure's option --config-cache. # It is not useful on other systems. If it contains results you don't # want to keep, you may remove or edit it. # # config.status only pays attention to the cache file if you give it # the --recheck option to rerun configure. # # `ac_cv_env_foo' variables (set or unset) will be overridden when # loading this file, other *unset* `ac_cv_foo' will be assigned the # following values. _ACEOF # The following way of writing the cache mishandles newlines in values, # but we know of no workaround that is simple, portable, and efficient. # So, don't put newlines in cache variables' values. # Ultrix sh set writes to stderr and can't be redirected directly, # and sets the high bit in the cache file unless we assign to the vars. { (set) 2>&1 | case `(ac_space=' '; set | grep ac_space) 2>&1` in *ac_space=\ *) # `set' does not quote correctly, so add quotes (double-quote # substitution turns \\\\ into \\, and sed turns \\ into \). sed -n \ "s/'/'\\\\''/g; s/^\\([_$as_cr_alnum]*_cv_[_$as_cr_alnum]*\\)=\\(.*\\)/\\1='\\2'/p" ;; *) # `set' quotes correctly as required by POSIX, so do not add quotes. sed -n \ "s/^\\([_$as_cr_alnum]*_cv_[_$as_cr_alnum]*\\)=\\(.*\\)/\\1=\\2/p" ;; esac; } | sed ' t clear : clear s/^\([^=]*\)=\(.*[{}].*\)$/test "${\1+set}" = set || &/ t end /^ac_cv_env/!s/^\([^=]*\)=\(.*\)$/\1=${\1=\2}/ : end' >>confcache if diff $cache_file confcache >/dev/null 2>&1; then :; else if test -w $cache_file; then test "x$cache_file" != "x/dev/null" && echo "updating cache $cache_file" cat confcache >$cache_file else echo "not updating unwritable cache $cache_file" fi fi rm -f confcache test "x$prefix" = xNONE && prefix=$ac_default_prefix # Let make expand exec_prefix. test "x$exec_prefix" = xNONE && exec_prefix='${prefix}' # VPATH may cause trouble with some makes, so we remove $(srcdir), # ${srcdir} and @srcdir@ from VPATH if srcdir is ".", strip leading and # trailing colons and then remove the whole line if VPATH becomes empty # (actually we leave an empty line to preserve line numbers). if test "x$srcdir" = x.; then ac_vpsub='/^[ ]*VPATH[ ]*=/{ s/:*\$(srcdir):*/:/; s/:*\${srcdir}:*/:/; s/:*@srcdir@:*/:/; s/^\([^=]*=[ ]*\):*/\1/; s/:*$//; s/^[^=]*=[ ]*$//; }' fi DEFS=-DHAVE_CONFIG_H ac_libobjs= ac_ltlibobjs= for ac_i in : $LIBOBJS; do test "x$ac_i" = x: && continue # 1. Remove the extension, and $U if already installed. ac_i=`echo "$ac_i" | sed 's/\$U\././;s/\.o$//;s/\.obj$//'` # 2. Add them. ac_libobjs="$ac_libobjs $ac_i\$U.$ac_objext" ac_ltlibobjs="$ac_ltlibobjs $ac_i"'$U.lo' done LIBOBJS=$ac_libobjs LTLIBOBJS=$ac_ltlibobjs if test -z "${MAINTAINER_MODE_TRUE}" && test -z "${MAINTAINER_MODE_FALSE}"; then { { echo "$as_me:$LINENO: error: conditional \"MAINTAINER_MODE\" was never defined. Usually this means the macro was only invoked conditionally." >&5 echo "$as_me: error: conditional \"MAINTAINER_MODE\" was never defined. Usually this means the macro was only invoked conditionally." >&2;} { (exit 1); exit 1; }; } fi if test -z "${AMDEP_TRUE}" && test -z "${AMDEP_FALSE}"; then { { echo "$as_me:$LINENO: error: conditional \"AMDEP\" was never defined. Usually this means the macro was only invoked conditionally." >&5 echo "$as_me: error: conditional \"AMDEP\" was never defined. Usually this means the macro was only invoked conditionally." >&2;} { (exit 1); exit 1; }; } fi if test -z "${am__fastdepCC_TRUE}" && test -z "${am__fastdepCC_FALSE}"; then { { echo "$as_me:$LINENO: error: conditional \"am__fastdepCC\" was never defined. Usually this means the macro was only invoked conditionally." >&5 echo "$as_me: error: conditional \"am__fastdepCC\" was never defined. Usually this means the macro was only invoked conditionally." >&2;} { (exit 1); exit 1; }; } fi if test -z "${am__fastdepCXX_TRUE}" && test -z "${am__fastdepCXX_FALSE}"; then { { echo "$as_me:$LINENO: error: conditional \"am__fastdepCXX\" was never defined. Usually this means the macro was only invoked conditionally." >&5 echo "$as_me: error: conditional \"am__fastdepCXX\" was never defined. Usually this means the macro was only invoked conditionally." >&2;} { (exit 1); exit 1; }; } fi mv -f po/POTFILES po/POTFILES.tmp sed -e '/\[encoding.*\]/d' -e 's/\[.*\] *//' < po/POTFILES.tmp > po/POTFILES rm -f po/POTFILES.tmp if test -z "${ENABLE_GTK_DOC_TRUE}" && test -z "${ENABLE_GTK_DOC_FALSE}"; then { { echo "$as_me:$LINENO: error: conditional \"ENABLE_GTK_DOC\" was never defined. Usually this means the macro was only invoked conditionally." >&5 echo "$as_me: error: conditional \"ENABLE_GTK_DOC\" was never defined. Usually this means the macro was only invoked conditionally." >&2;} { (exit 1); exit 1; }; } fi if test -z "${GTK_DOC_USE_LIBTOOL_TRUE}" && test -z "${GTK_DOC_USE_LIBTOOL_FALSE}"; then { { echo "$as_me:$LINENO: error: conditional \"GTK_DOC_USE_LIBTOOL\" was never defined. Usually this means the macro was only invoked conditionally." >&5 echo "$as_me: error: conditional \"GTK_DOC_USE_LIBTOOL\" was never defined. Usually this means the macro was only invoked conditionally." >&2;} { (exit 1); exit 1; }; } fi if test -z "${WITH_GENERIC_TRUE}" && test -z "${WITH_GENERIC_FALSE}"; then { { echo "$as_me:$LINENO: error: conditional \"WITH_GENERIC\" was never defined. Usually this means the macro was only invoked conditionally." >&5 echo "$as_me: error: conditional \"WITH_GENERIC\" was never defined. Usually this means the macro was only invoked conditionally." >&2;} { (exit 1); exit 1; }; } fi if test -z "${WITH_TALKFILTERS_TRUE}" && test -z "${WITH_TALKFILTERS_FALSE}"; then { { echo "$as_me:$LINENO: error: conditional \"WITH_TALKFILTERS\" was never defined. Usually this means the macro was only invoked conditionally." >&5 echo "$as_me: error: conditional \"WITH_TALKFILTERS\" was never defined. Usually this means the macro was only invoked conditionally." >&2;} { (exit 1); exit 1; }; } fi if test -z "${WITH_REGRESSION_TESTS_TRUE}" && test -z "${WITH_REGRESSION_TESTS_FALSE}"; then { { echo "$as_me:$LINENO: error: conditional \"WITH_REGRESSION_TESTS\" was never defined. Usually this means the macro was only invoked conditionally." >&5 echo "$as_me: error: conditional \"WITH_REGRESSION_TESTS\" was never defined. Usually this means the macro was only invoked conditionally." >&2;} { (exit 1); exit 1; }; } fi : ${CONFIG_STATUS=./config.status} ac_clean_files_save=$ac_clean_files ac_clean_files="$ac_clean_files $CONFIG_STATUS" { echo "$as_me:$LINENO: creating $CONFIG_STATUS" >&5 echo "$as_me: creating $CONFIG_STATUS" >&6;} cat >$CONFIG_STATUS <<_ACEOF #! $SHELL # Generated by $as_me. # Run this file to recreate the current configuration. # Compiler output produced by configure, useful for debugging # configure, is in config.log if it exists. debug=false ac_cs_recheck=false ac_cs_silent=false SHELL=\${CONFIG_SHELL-$SHELL} _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF ## --------------------- ## ## M4sh Initialization. ## ## --------------------- ## # Be Bourne compatible if test -n "${ZSH_VERSION+set}" && (emulate sh) >/dev/null 2>&1; then emulate sh NULLCMD=: # Zsh 3.x and 4.x performs word splitting on ${1+"$@"}, which # is contrary to our usage. Disable this feature. alias -g '${1+"$@"}'='"$@"' elif test -n "${BASH_VERSION+set}" && (set -o posix) >/dev/null 2>&1; then set -o posix fi DUALCASE=1; export DUALCASE # for MKS sh # Support unset when possible. if ( (MAIL=60; unset MAIL) || exit) >/dev/null 2>&1; then as_unset=unset else as_unset=false fi # Work around bugs in pre-3.0 UWIN ksh. $as_unset ENV MAIL MAILPATH PS1='$ ' PS2='> ' PS4='+ ' # NLS nuisances. for as_var in \ LANG LANGUAGE LC_ADDRESS LC_ALL LC_COLLATE LC_CTYPE LC_IDENTIFICATION \ LC_MEASUREMENT LC_MESSAGES LC_MONETARY LC_NAME LC_NUMERIC LC_PAPER \ LC_TELEPHONE LC_TIME do if (set +x; test -z "`(eval $as_var=C; export $as_var) 2>&1`"); then eval $as_var=C; export $as_var else $as_unset $as_var fi done # Required to use basename. if expr a : '\(a\)' >/dev/null 2>&1; then as_expr=expr else as_expr=false fi if (basename /) >/dev/null 2>&1 && test "X`basename / 2>&1`" = "X/"; then as_basename=basename else as_basename=false fi # Name of the executable. as_me=`$as_basename "$0" || $as_expr X/"$0" : '.*/\([^/][^/]*\)/*$' \| \ X"$0" : 'X\(//\)$' \| \ X"$0" : 'X\(/\)$' \| \ . : '\(.\)' 2>/dev/null || echo X/"$0" | sed '/^.*\/\([^/][^/]*\)\/*$/{ s//\1/; q; } /^X\/\(\/\/\)$/{ s//\1/; q; } /^X\/\(\/\).*/{ s//\1/; q; } s/.*/./; q'` # PATH needs CR, and LINENO needs CR and PATH. # Avoid depending upon Character Ranges. as_cr_letters='abcdefghijklmnopqrstuvwxyz' as_cr_LETTERS='ABCDEFGHIJKLMNOPQRSTUVWXYZ' as_cr_Letters=$as_cr_letters$as_cr_LETTERS as_cr_digits='0123456789' as_cr_alnum=$as_cr_Letters$as_cr_digits # The user is always right. if test "${PATH_SEPARATOR+set}" != set; then echo "#! /bin/sh" >conf$$.sh echo "exit 0" >>conf$$.sh chmod +x conf$$.sh if (PATH="/nonexistent;."; conf$$.sh) >/dev/null 2>&1; then PATH_SEPARATOR=';' else PATH_SEPARATOR=: fi rm -f conf$$.sh fi as_lineno_1=$LINENO as_lineno_2=$LINENO as_lineno_3=`(expr $as_lineno_1 + 1) 2>/dev/null` test "x$as_lineno_1" != "x$as_lineno_2" && test "x$as_lineno_3" = "x$as_lineno_2" || { # Find who we are. Look in the path if we contain no path at all # relative or not. case $0 in *[\\/]* ) as_myself=$0 ;; *) as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. test -r "$as_dir/$0" && as_myself=$as_dir/$0 && break done ;; esac # We did not find ourselves, most probably we were run as `sh COMMAND' # in which case we are not to be found in the path. if test "x$as_myself" = x; then as_myself=$0 fi if test ! -f "$as_myself"; then { { echo "$as_me:$LINENO: error: cannot find myself; rerun with an absolute path" >&5 echo "$as_me: error: cannot find myself; rerun with an absolute path" >&2;} { (exit 1); exit 1; }; } fi case $CONFIG_SHELL in '') as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in /bin$PATH_SEPARATOR/usr/bin$PATH_SEPARATOR$PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for as_base in sh bash ksh sh5; do case $as_dir in /*) if ("$as_dir/$as_base" -c ' as_lineno_1=$LINENO as_lineno_2=$LINENO as_lineno_3=`(expr $as_lineno_1 + 1) 2>/dev/null` test "x$as_lineno_1" != "x$as_lineno_2" && test "x$as_lineno_3" = "x$as_lineno_2" ') 2>/dev/null; then $as_unset BASH_ENV || test "${BASH_ENV+set}" != set || { BASH_ENV=; export BASH_ENV; } $as_unset ENV || test "${ENV+set}" != set || { ENV=; export ENV; } CONFIG_SHELL=$as_dir/$as_base export CONFIG_SHELL exec "$CONFIG_SHELL" "$0" ${1+"$@"} fi;; esac done done ;; esac # Create $as_me.lineno as a copy of $as_myself, but with $LINENO # uniformly replaced by the line number. The first 'sed' inserts a # line-number line before each line; the second 'sed' does the real # work. The second script uses 'N' to pair each line-number line # with the numbered line, and appends trailing '-' during # substitution so that $LINENO is not a special case at line end. # (Raja R Harinath suggested sed '=', and Paul Eggert wrote the # second 'sed' script. Blame Lee E. McMahon for sed's syntax. :-) sed '=' <$as_myself | sed ' N s,$,-, : loop s,^\(['$as_cr_digits']*\)\(.*\)[$]LINENO\([^'$as_cr_alnum'_]\),\1\2\1\3, t loop s,-$,, s,^['$as_cr_digits']*\n,, ' >$as_me.lineno && chmod +x $as_me.lineno || { { echo "$as_me:$LINENO: error: cannot create $as_me.lineno; rerun with a POSIX shell" >&5 echo "$as_me: error: cannot create $as_me.lineno; rerun with a POSIX shell" >&2;} { (exit 1); exit 1; }; } # Don't try to exec as it changes $[0], causing all sort of problems # (the dirname of $[0] is not the place where we might find the # original and so on. Autoconf is especially sensible to this). . ./$as_me.lineno # Exit status is that of the last command. exit } case `echo "testing\c"; echo 1,2,3`,`echo -n testing; echo 1,2,3` in *c*,-n*) ECHO_N= ECHO_C=' ' ECHO_T=' ' ;; *c*,* ) ECHO_N=-n ECHO_C= ECHO_T= ;; *) ECHO_N= ECHO_C='\c' ECHO_T= ;; esac if expr a : '\(a\)' >/dev/null 2>&1; then as_expr=expr else as_expr=false fi rm -f conf$$ conf$$.exe conf$$.file echo >conf$$.file if ln -s conf$$.file conf$$ 2>/dev/null; then # We could just check for DJGPP; but this test a) works b) is more generic # and c) will remain valid once DJGPP supports symlinks (DJGPP 2.04). if test -f conf$$.exe; then # Don't use ln at all; we don't have any links as_ln_s='cp -p' else as_ln_s='ln -s' fi elif ln conf$$.file conf$$ 2>/dev/null; then as_ln_s=ln else as_ln_s='cp -p' fi rm -f conf$$ conf$$.exe conf$$.file if mkdir -p . 2>/dev/null; then as_mkdir_p=: else test -d ./-p && rmdir ./-p as_mkdir_p=false fi as_executable_p="test -f" # Sed expression to map a string onto a valid CPP name. as_tr_cpp="eval sed 'y%*$as_cr_letters%P$as_cr_LETTERS%;s%[^_$as_cr_alnum]%_%g'" # Sed expression to map a string onto a valid variable name. as_tr_sh="eval sed 'y%*+%pp%;s%[^_$as_cr_alnum]%_%g'" # IFS # We need space, tab and new line, in precisely that order. as_nl=' ' IFS=" $as_nl" # CDPATH. $as_unset CDPATH exec 6>&1 # Open the log real soon, to keep \$[0] and so on meaningful, and to # report actual input values of CONFIG_FILES etc. instead of their # values after options handling. Logging --version etc. is OK. exec 5>>config.log { echo sed 'h;s/./-/g;s/^.../## /;s/...$/ ##/;p;x;p;x' <<_ASBOX ## Running $as_me. ## _ASBOX } >&5 cat >&5 <<_CSEOF This file was extended by libtranslate $as_me 0.99, which was generated by GNU Autoconf 2.59. Invocation command line was CONFIG_FILES = $CONFIG_FILES CONFIG_HEADERS = $CONFIG_HEADERS CONFIG_LINKS = $CONFIG_LINKS CONFIG_COMMANDS = $CONFIG_COMMANDS $ $0 $@ _CSEOF echo "on `(hostname || uname -n) 2>/dev/null | sed 1q`" >&5 echo >&5 _ACEOF # Files that config.status was made for. if test -n "$ac_config_files"; then echo "config_files=\"$ac_config_files\"" >>$CONFIG_STATUS fi if test -n "$ac_config_headers"; then echo "config_headers=\"$ac_config_headers\"" >>$CONFIG_STATUS fi if test -n "$ac_config_links"; then echo "config_links=\"$ac_config_links\"" >>$CONFIG_STATUS fi if test -n "$ac_config_commands"; then echo "config_commands=\"$ac_config_commands\"" >>$CONFIG_STATUS fi cat >>$CONFIG_STATUS <<\_ACEOF ac_cs_usage="\ \`$as_me' instantiates files from templates according to the current configuration. Usage: $0 [OPTIONS] [FILE]... -h, --help print this help, then exit -V, --version print version number, then exit -q, --quiet do not print progress messages -d, --debug don't remove temporary files --recheck update $as_me by reconfiguring in the same conditions --file=FILE[:TEMPLATE] instantiate the configuration file FILE --header=FILE[:TEMPLATE] instantiate the configuration header FILE Configuration files: $config_files Configuration headers: $config_headers Configuration commands: $config_commands Report bugs to ." _ACEOF cat >>$CONFIG_STATUS <<_ACEOF ac_cs_version="\\ libtranslate config.status 0.99 configured by $0, generated by GNU Autoconf 2.59, with options \\"`echo "$ac_configure_args" | sed 's/[\\""\`\$]/\\\\&/g'`\\" Copyright (C) 2003 Free Software Foundation, Inc. This config.status script is free software; the Free Software Foundation gives unlimited permission to copy, distribute and modify it." srcdir=$srcdir INSTALL="$INSTALL" _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF # If no file are specified by the user, then we need to provide default # value. By we need to know if files were specified by the user. ac_need_defaults=: while test $# != 0 do case $1 in --*=*) ac_option=`expr "x$1" : 'x\([^=]*\)='` ac_optarg=`expr "x$1" : 'x[^=]*=\(.*\)'` ac_shift=: ;; -*) ac_option=$1 ac_optarg=$2 ac_shift=shift ;; *) # This is not an option, so the user has probably given explicit # arguments. ac_option=$1 ac_need_defaults=false;; esac case $ac_option in # Handling of the options. _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF -recheck | --recheck | --rechec | --reche | --rech | --rec | --re | --r) ac_cs_recheck=: ;; --version | --vers* | -V ) echo "$ac_cs_version"; exit 0 ;; --he | --h) # Conflict between --help and --header { { echo "$as_me:$LINENO: error: ambiguous option: $1 Try \`$0 --help' for more information." >&5 echo "$as_me: error: ambiguous option: $1 Try \`$0 --help' for more information." >&2;} { (exit 1); exit 1; }; };; --help | --hel | -h ) echo "$ac_cs_usage"; exit 0 ;; --debug | --d* | -d ) debug=: ;; --file | --fil | --fi | --f ) $ac_shift CONFIG_FILES="$CONFIG_FILES $ac_optarg" ac_need_defaults=false;; --header | --heade | --head | --hea ) $ac_shift CONFIG_HEADERS="$CONFIG_HEADERS $ac_optarg" ac_need_defaults=false;; -q | -quiet | --quiet | --quie | --qui | --qu | --q \ | -silent | --silent | --silen | --sile | --sil | --si | --s) ac_cs_silent=: ;; # This is an error. -*) { { echo "$as_me:$LINENO: error: unrecognized option: $1 Try \`$0 --help' for more information." >&5 echo "$as_me: error: unrecognized option: $1 Try \`$0 --help' for more information." >&2;} { (exit 1); exit 1; }; } ;; *) ac_config_targets="$ac_config_targets $1" ;; esac shift done ac_configure_extra_args= if $ac_cs_silent; then exec 6>/dev/null ac_configure_extra_args="$ac_configure_extra_args --silent" fi _ACEOF cat >>$CONFIG_STATUS <<_ACEOF if \$ac_cs_recheck; then echo "running $SHELL $0 " $ac_configure_args \$ac_configure_extra_args " --no-create --no-recursion" >&6 exec $SHELL $0 $ac_configure_args \$ac_configure_extra_args --no-create --no-recursion fi _ACEOF cat >>$CONFIG_STATUS <<_ACEOF # # INIT-COMMANDS section. # AMDEP_TRUE="$AMDEP_TRUE" ac_aux_dir="$ac_aux_dir" INTLTOOL_PERL='${INTLTOOL_PERL}' ac_aux_dir=${ac_aux_dir} INTLTOOL_EXTRACT='${INTLTOOL_EXTRACT}' ICONV='${ICONV}' MSGFMT='${MSGFMT}' MSGMERGE='${MSGMERGE}' XGETTEXT='${XGETTEXT}' _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF for ac_config_target in $ac_config_targets do case "$ac_config_target" in # Handling of arguments. "Makefile" ) CONFIG_FILES="$CONFIG_FILES Makefile" ;; "data/Makefile" ) CONFIG_FILES="$CONFIG_FILES data/Makefile" ;; "data/libtranslate.pc" ) CONFIG_FILES="$CONFIG_FILES data/libtranslate.pc" ;; "docs/Makefile" ) CONFIG_FILES="$CONFIG_FILES docs/Makefile" ;; "docs/man/Makefile" ) CONFIG_FILES="$CONFIG_FILES docs/man/Makefile" ;; "docs/man/version.xml" ) CONFIG_FILES="$CONFIG_FILES docs/man/version.xml" ;; "docs/reference/Makefile" ) CONFIG_FILES="$CONFIG_FILES docs/reference/Makefile" ;; "docs/reference/version.xml" ) CONFIG_FILES="$CONFIG_FILES docs/reference/version.xml" ;; "m4/Makefile" ) CONFIG_FILES="$CONFIG_FILES m4/Makefile" ;; "po/Makefile.in" ) CONFIG_FILES="$CONFIG_FILES po/Makefile.in" ;; "src/Makefile" ) CONFIG_FILES="$CONFIG_FILES src/Makefile" ;; "src/modules/Makefile" ) CONFIG_FILES="$CONFIG_FILES src/modules/Makefile" ;; "depfiles" ) CONFIG_COMMANDS="$CONFIG_COMMANDS depfiles" ;; "default-1" ) CONFIG_COMMANDS="$CONFIG_COMMANDS default-1" ;; "intltool" ) CONFIG_COMMANDS="$CONFIG_COMMANDS intltool" ;; "config.h" ) CONFIG_HEADERS="$CONFIG_HEADERS config.h" ;; *) { { echo "$as_me:$LINENO: error: invalid argument: $ac_config_target" >&5 echo "$as_me: error: invalid argument: $ac_config_target" >&2;} { (exit 1); exit 1; }; };; esac done # If the user did not use the arguments to specify the items to instantiate, # then the envvar interface is used. Set only those that are not. # We use the long form for the default assignment because of an extremely # bizarre bug on SunOS 4.1.3. if $ac_need_defaults; then test "${CONFIG_FILES+set}" = set || CONFIG_FILES=$config_files test "${CONFIG_HEADERS+set}" = set || CONFIG_HEADERS=$config_headers test "${CONFIG_COMMANDS+set}" = set || CONFIG_COMMANDS=$config_commands fi # Have a temporary directory for convenience. Make it in the build tree # simply because there is no reason to put it here, and in addition, # creating and moving files from /tmp can sometimes cause problems. # Create a temporary directory, and hook for its removal unless debugging. $debug || { trap 'exit_status=$?; rm -rf $tmp && exit $exit_status' 0 trap '{ (exit 1); exit 1; }' 1 2 13 15 } # Create a (secure) tmp directory for tmp files. { tmp=`(umask 077 && mktemp -d -q "./confstatXXXXXX") 2>/dev/null` && test -n "$tmp" && test -d "$tmp" } || { tmp=./confstat$$-$RANDOM (umask 077 && mkdir $tmp) } || { echo "$me: cannot create a temporary directory in ." >&2 { (exit 1); exit 1; } } _ACEOF cat >>$CONFIG_STATUS <<_ACEOF # # CONFIG_FILES section. # # No need to generate the scripts if there are no CONFIG_FILES. # This happens for instance when ./config.status config.h if test -n "\$CONFIG_FILES"; then # Protect against being on the right side of a sed subst in config.status. sed 's/,@/@@/; s/@,/@@/; s/,;t t\$/@;t t/; /@;t t\$/s/[\\\\&,]/\\\\&/g; s/@@/,@/; s/@@/@,/; s/@;t t\$/,;t t/' >\$tmp/subs.sed <<\\CEOF s,@SHELL@,$SHELL,;t t s,@PATH_SEPARATOR@,$PATH_SEPARATOR,;t t s,@PACKAGE_NAME@,$PACKAGE_NAME,;t t s,@PACKAGE_TARNAME@,$PACKAGE_TARNAME,;t t s,@PACKAGE_VERSION@,$PACKAGE_VERSION,;t t s,@PACKAGE_STRING@,$PACKAGE_STRING,;t t s,@PACKAGE_BUGREPORT@,$PACKAGE_BUGREPORT,;t t s,@exec_prefix@,$exec_prefix,;t t s,@prefix@,$prefix,;t t s,@program_transform_name@,$program_transform_name,;t t s,@bindir@,$bindir,;t t s,@sbindir@,$sbindir,;t t s,@libexecdir@,$libexecdir,;t t s,@datadir@,$datadir,;t t s,@sysconfdir@,$sysconfdir,;t t s,@sharedstatedir@,$sharedstatedir,;t t s,@localstatedir@,$localstatedir,;t t s,@libdir@,$libdir,;t t s,@includedir@,$includedir,;t t s,@oldincludedir@,$oldincludedir,;t t s,@infodir@,$infodir,;t t s,@mandir@,$mandir,;t t s,@build_alias@,$build_alias,;t t s,@host_alias@,$host_alias,;t t s,@target_alias@,$target_alias,;t t s,@DEFS@,$DEFS,;t t s,@ECHO_C@,$ECHO_C,;t t s,@ECHO_N@,$ECHO_N,;t t s,@ECHO_T@,$ECHO_T,;t t s,@LIBS@,$LIBS,;t t s,@WARN_CFLAGS@,$WARN_CFLAGS,;t t s,@INSTALL_PROGRAM@,$INSTALL_PROGRAM,;t t s,@INSTALL_SCRIPT@,$INSTALL_SCRIPT,;t t s,@INSTALL_DATA@,$INSTALL_DATA,;t t s,@CYGPATH_W@,$CYGPATH_W,;t t s,@PACKAGE@,$PACKAGE,;t t s,@VERSION@,$VERSION,;t t s,@ACLOCAL@,$ACLOCAL,;t t s,@AUTOCONF@,$AUTOCONF,;t t s,@AUTOMAKE@,$AUTOMAKE,;t t s,@AUTOHEADER@,$AUTOHEADER,;t t s,@MAKEINFO@,$MAKEINFO,;t t s,@install_sh@,$install_sh,;t t s,@STRIP@,$STRIP,;t t s,@ac_ct_STRIP@,$ac_ct_STRIP,;t t s,@INSTALL_STRIP_PROGRAM@,$INSTALL_STRIP_PROGRAM,;t t s,@mkdir_p@,$mkdir_p,;t t s,@AWK@,$AWK,;t t s,@SET_MAKE@,$SET_MAKE,;t t s,@am__leading_dot@,$am__leading_dot,;t t s,@AMTAR@,$AMTAR,;t t s,@am__tar@,$am__tar,;t t s,@am__untar@,$am__untar,;t t s,@MAINTAINER_MODE_TRUE@,$MAINTAINER_MODE_TRUE,;t t s,@MAINTAINER_MODE_FALSE@,$MAINTAINER_MODE_FALSE,;t t s,@MAINT@,$MAINT,;t t s,@build@,$build,;t t s,@build_cpu@,$build_cpu,;t t s,@build_vendor@,$build_vendor,;t t s,@build_os@,$build_os,;t t s,@host@,$host,;t t s,@host_cpu@,$host_cpu,;t t s,@host_vendor@,$host_vendor,;t t s,@host_os@,$host_os,;t t s,@CC@,$CC,;t t s,@CFLAGS@,$CFLAGS,;t t s,@LDFLAGS@,$LDFLAGS,;t t s,@CPPFLAGS@,$CPPFLAGS,;t t s,@ac_ct_CC@,$ac_ct_CC,;t t s,@EXEEXT@,$EXEEXT,;t t s,@OBJEXT@,$OBJEXT,;t t s,@DEPDIR@,$DEPDIR,;t t s,@am__include@,$am__include,;t t s,@am__quote@,$am__quote,;t t s,@AMDEP_TRUE@,$AMDEP_TRUE,;t t s,@AMDEP_FALSE@,$AMDEP_FALSE,;t t s,@AMDEPBACKSLASH@,$AMDEPBACKSLASH,;t t s,@CCDEPMODE@,$CCDEPMODE,;t t s,@am__fastdepCC_TRUE@,$am__fastdepCC_TRUE,;t t s,@am__fastdepCC_FALSE@,$am__fastdepCC_FALSE,;t t s,@EGREP@,$EGREP,;t t s,@LN_S@,$LN_S,;t t s,@ECHO@,$ECHO,;t t s,@AR@,$AR,;t t s,@ac_ct_AR@,$ac_ct_AR,;t t s,@RANLIB@,$RANLIB,;t t s,@ac_ct_RANLIB@,$ac_ct_RANLIB,;t t s,@CPP@,$CPP,;t t s,@CXX@,$CXX,;t t s,@CXXFLAGS@,$CXXFLAGS,;t t s,@ac_ct_CXX@,$ac_ct_CXX,;t t s,@CXXDEPMODE@,$CXXDEPMODE,;t t s,@am__fastdepCXX_TRUE@,$am__fastdepCXX_TRUE,;t t s,@am__fastdepCXX_FALSE@,$am__fastdepCXX_FALSE,;t t s,@CXXCPP@,$CXXCPP,;t t s,@F77@,$F77,;t t s,@FFLAGS@,$FFLAGS,;t t s,@ac_ct_F77@,$ac_ct_F77,;t t s,@LIBTOOL@,$LIBTOOL,;t t s,@GETTEXT_PACKAGE@,$GETTEXT_PACKAGE,;t t s,@USE_NLS@,$USE_NLS,;t t s,@MSGFMT@,$MSGFMT,;t t s,@GMSGFMT@,$GMSGFMT,;t t s,@XGETTEXT@,$XGETTEXT,;t t s,@CATALOGS@,$CATALOGS,;t t s,@CATOBJEXT@,$CATOBJEXT,;t t s,@DATADIRNAME@,$DATADIRNAME,;t t s,@GMOFILES@,$GMOFILES,;t t s,@INSTOBJEXT@,$INSTOBJEXT,;t t s,@INTLLIBS@,$INTLLIBS,;t t s,@PO_IN_DATADIR_TRUE@,$PO_IN_DATADIR_TRUE,;t t s,@PO_IN_DATADIR_FALSE@,$PO_IN_DATADIR_FALSE,;t t s,@POFILES@,$POFILES,;t t s,@POSUB@,$POSUB,;t t s,@MKINSTALLDIRS@,$MKINSTALLDIRS,;t t s,@INTLTOOL_DESKTOP_RULE@,$INTLTOOL_DESKTOP_RULE,;t t s,@INTLTOOL_DIRECTORY_RULE@,$INTLTOOL_DIRECTORY_RULE,;t t s,@INTLTOOL_KEYS_RULE@,$INTLTOOL_KEYS_RULE,;t t s,@INTLTOOL_PROP_RULE@,$INTLTOOL_PROP_RULE,;t t s,@INTLTOOL_OAF_RULE@,$INTLTOOL_OAF_RULE,;t t s,@INTLTOOL_PONG_RULE@,$INTLTOOL_PONG_RULE,;t t s,@INTLTOOL_SERVER_RULE@,$INTLTOOL_SERVER_RULE,;t t s,@INTLTOOL_SHEET_RULE@,$INTLTOOL_SHEET_RULE,;t t s,@INTLTOOL_SOUNDLIST_RULE@,$INTLTOOL_SOUNDLIST_RULE,;t t s,@INTLTOOL_UI_RULE@,$INTLTOOL_UI_RULE,;t t s,@INTLTOOL_XAM_RULE@,$INTLTOOL_XAM_RULE,;t t s,@INTLTOOL_KBD_RULE@,$INTLTOOL_KBD_RULE,;t t s,@INTLTOOL_XML_RULE@,$INTLTOOL_XML_RULE,;t t s,@INTLTOOL_XML_NOMERGE_RULE@,$INTLTOOL_XML_NOMERGE_RULE,;t t s,@INTLTOOL_CAVES_RULE@,$INTLTOOL_CAVES_RULE,;t t s,@INTLTOOL_SCHEMAS_RULE@,$INTLTOOL_SCHEMAS_RULE,;t t s,@INTLTOOL_THEME_RULE@,$INTLTOOL_THEME_RULE,;t t s,@INTLTOOL_EXTRACT@,$INTLTOOL_EXTRACT,;t t s,@INTLTOOL_MERGE@,$INTLTOOL_MERGE,;t t s,@INTLTOOL_UPDATE@,$INTLTOOL_UPDATE,;t t s,@INTLTOOL_PERL@,$INTLTOOL_PERL,;t t s,@ICONV@,$ICONV,;t t s,@MSGMERGE@,$MSGMERGE,;t t s,@PKG_CONFIG@,$PKG_CONFIG,;t t s,@GLIB_CFLAGS@,$GLIB_CFLAGS,;t t s,@GLIB_LIBS@,$GLIB_LIBS,;t t s,@HTML_DIR@,$HTML_DIR,;t t s,@ENABLE_GTK_DOC_TRUE@,$ENABLE_GTK_DOC_TRUE,;t t s,@ENABLE_GTK_DOC_FALSE@,$ENABLE_GTK_DOC_FALSE,;t t s,@GTK_DOC_USE_LIBTOOL_TRUE@,$GTK_DOC_USE_LIBTOOL_TRUE,;t t s,@GTK_DOC_USE_LIBTOOL_FALSE@,$GTK_DOC_USE_LIBTOOL_FALSE,;t t s,@SOUP_CFLAGS@,$SOUP_CFLAGS,;t t s,@SOUP_LIBS@,$SOUP_LIBS,;t t s,@LIBXML_CFLAGS@,$LIBXML_CFLAGS,;t t s,@LIBXML_LIBS@,$LIBXML_LIBS,;t t s,@TALKFILTERS_CFLAGS@,$TALKFILTERS_CFLAGS,;t t s,@TALKFILTERS_LIBS@,$TALKFILTERS_LIBS,;t t s,@WITH_GENERIC_TRUE@,$WITH_GENERIC_TRUE,;t t s,@WITH_GENERIC_FALSE@,$WITH_GENERIC_FALSE,;t t s,@WITH_TALKFILTERS_TRUE@,$WITH_TALKFILTERS_TRUE,;t t s,@WITH_TALKFILTERS_FALSE@,$WITH_TALKFILTERS_FALSE,;t t s,@WITH_REGRESSION_TESTS_TRUE@,$WITH_REGRESSION_TESTS_TRUE,;t t s,@WITH_REGRESSION_TESTS_FALSE@,$WITH_REGRESSION_TESTS_FALSE,;t t s,@LIBOBJS@,$LIBOBJS,;t t s,@LTLIBOBJS@,$LTLIBOBJS,;t t CEOF _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF # Split the substitutions into bite-sized pieces for seds with # small command number limits, like on Digital OSF/1 and HP-UX. ac_max_sed_lines=48 ac_sed_frag=1 # Number of current file. ac_beg=1 # First line for current file. ac_end=$ac_max_sed_lines # Line after last line for current file. ac_more_lines=: ac_sed_cmds= while $ac_more_lines; do if test $ac_beg -gt 1; then sed "1,${ac_beg}d; ${ac_end}q" $tmp/subs.sed >$tmp/subs.frag else sed "${ac_end}q" $tmp/subs.sed >$tmp/subs.frag fi if test ! -s $tmp/subs.frag; then ac_more_lines=false else # The purpose of the label and of the branching condition is to # speed up the sed processing (if there are no `@' at all, there # is no need to browse any of the substitutions). # These are the two extra sed commands mentioned above. (echo ':t /@[a-zA-Z_][a-zA-Z_0-9]*@/!b' && cat $tmp/subs.frag) >$tmp/subs-$ac_sed_frag.sed if test -z "$ac_sed_cmds"; then ac_sed_cmds="sed -f $tmp/subs-$ac_sed_frag.sed" else ac_sed_cmds="$ac_sed_cmds | sed -f $tmp/subs-$ac_sed_frag.sed" fi ac_sed_frag=`expr $ac_sed_frag + 1` ac_beg=$ac_end ac_end=`expr $ac_end + $ac_max_sed_lines` fi done if test -z "$ac_sed_cmds"; then ac_sed_cmds=cat fi fi # test -n "$CONFIG_FILES" _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF for ac_file in : $CONFIG_FILES; do test "x$ac_file" = x: && continue # Support "outfile[:infile[:infile...]]", defaulting infile="outfile.in". case $ac_file in - | *:- | *:-:* ) # input from stdin cat >$tmp/stdin ac_file_in=`echo "$ac_file" | sed 's,[^:]*:,,'` ac_file=`echo "$ac_file" | sed 's,:.*,,'` ;; *:* ) ac_file_in=`echo "$ac_file" | sed 's,[^:]*:,,'` ac_file=`echo "$ac_file" | sed 's,:.*,,'` ;; * ) ac_file_in=$ac_file.in ;; esac # Compute @srcdir@, @top_srcdir@, and @INSTALL@ for subdirectories. ac_dir=`(dirname "$ac_file") 2>/dev/null || $as_expr X"$ac_file" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$ac_file" : 'X\(//\)[^/]' \| \ X"$ac_file" : 'X\(//\)$' \| \ X"$ac_file" : 'X\(/\)' \| \ . : '\(.\)' 2>/dev/null || echo X"$ac_file" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/; q; } /^X\(\/\/\)[^/].*/{ s//\1/; q; } /^X\(\/\/\)$/{ s//\1/; q; } /^X\(\/\).*/{ s//\1/; q; } s/.*/./; q'` { if $as_mkdir_p; then mkdir -p "$ac_dir" else as_dir="$ac_dir" as_dirs= while test ! -d "$as_dir"; do as_dirs="$as_dir $as_dirs" as_dir=`(dirname "$as_dir") 2>/dev/null || $as_expr X"$as_dir" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$as_dir" : 'X\(//\)[^/]' \| \ X"$as_dir" : 'X\(//\)$' \| \ X"$as_dir" : 'X\(/\)' \| \ . : '\(.\)' 2>/dev/null || echo X"$as_dir" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/; q; } /^X\(\/\/\)[^/].*/{ s//\1/; q; } /^X\(\/\/\)$/{ s//\1/; q; } /^X\(\/\).*/{ s//\1/; q; } s/.*/./; q'` done test ! -n "$as_dirs" || mkdir $as_dirs fi || { { echo "$as_me:$LINENO: error: cannot create directory \"$ac_dir\"" >&5 echo "$as_me: error: cannot create directory \"$ac_dir\"" >&2;} { (exit 1); exit 1; }; }; } ac_builddir=. if test "$ac_dir" != .; then ac_dir_suffix=/`echo "$ac_dir" | sed 's,^\.[\\/],,'` # A "../" for each directory in $ac_dir_suffix. ac_top_builddir=`echo "$ac_dir_suffix" | sed 's,/[^\\/]*,../,g'` else ac_dir_suffix= ac_top_builddir= fi case $srcdir in .) # No --srcdir option. We are building in place. ac_srcdir=. if test -z "$ac_top_builddir"; then ac_top_srcdir=. else ac_top_srcdir=`echo $ac_top_builddir | sed 's,/$,,'` fi ;; [\\/]* | ?:[\\/]* ) # Absolute path. ac_srcdir=$srcdir$ac_dir_suffix; ac_top_srcdir=$srcdir ;; *) # Relative path. ac_srcdir=$ac_top_builddir$srcdir$ac_dir_suffix ac_top_srcdir=$ac_top_builddir$srcdir ;; esac # Do not use `cd foo && pwd` to compute absolute paths, because # the directories may not exist. case `pwd` in .) ac_abs_builddir="$ac_dir";; *) case "$ac_dir" in .) ac_abs_builddir=`pwd`;; [\\/]* | ?:[\\/]* ) ac_abs_builddir="$ac_dir";; *) ac_abs_builddir=`pwd`/"$ac_dir";; esac;; esac case $ac_abs_builddir in .) ac_abs_top_builddir=${ac_top_builddir}.;; *) case ${ac_top_builddir}. in .) ac_abs_top_builddir=$ac_abs_builddir;; [\\/]* | ?:[\\/]* ) ac_abs_top_builddir=${ac_top_builddir}.;; *) ac_abs_top_builddir=$ac_abs_builddir/${ac_top_builddir}.;; esac;; esac case $ac_abs_builddir in .) ac_abs_srcdir=$ac_srcdir;; *) case $ac_srcdir in .) ac_abs_srcdir=$ac_abs_builddir;; [\\/]* | ?:[\\/]* ) ac_abs_srcdir=$ac_srcdir;; *) ac_abs_srcdir=$ac_abs_builddir/$ac_srcdir;; esac;; esac case $ac_abs_builddir in .) ac_abs_top_srcdir=$ac_top_srcdir;; *) case $ac_top_srcdir in .) ac_abs_top_srcdir=$ac_abs_builddir;; [\\/]* | ?:[\\/]* ) ac_abs_top_srcdir=$ac_top_srcdir;; *) ac_abs_top_srcdir=$ac_abs_builddir/$ac_top_srcdir;; esac;; esac case $INSTALL in [\\/$]* | ?:[\\/]* ) ac_INSTALL=$INSTALL ;; *) ac_INSTALL=$ac_top_builddir$INSTALL ;; esac if test x"$ac_file" != x-; then { echo "$as_me:$LINENO: creating $ac_file" >&5 echo "$as_me: creating $ac_file" >&6;} rm -f "$ac_file" fi # Let's still pretend it is `configure' which instantiates (i.e., don't # use $as_me), people would be surprised to read: # /* config.h. Generated by config.status. */ if test x"$ac_file" = x-; then configure_input= else configure_input="$ac_file. " fi configure_input=$configure_input"Generated from `echo $ac_file_in | sed 's,.*/,,'` by configure." # First look for the input files in the build tree, otherwise in the # src tree. ac_file_inputs=`IFS=: for f in $ac_file_in; do case $f in -) echo $tmp/stdin ;; [\\/$]*) # Absolute (can't be DOS-style, as IFS=:) test -f "$f" || { { echo "$as_me:$LINENO: error: cannot find input file: $f" >&5 echo "$as_me: error: cannot find input file: $f" >&2;} { (exit 1); exit 1; }; } echo "$f";; *) # Relative if test -f "$f"; then # Build tree echo "$f" elif test -f "$srcdir/$f"; then # Source tree echo "$srcdir/$f" else # /dev/null tree { { echo "$as_me:$LINENO: error: cannot find input file: $f" >&5 echo "$as_me: error: cannot find input file: $f" >&2;} { (exit 1); exit 1; }; } fi;; esac done` || { (exit 1); exit 1; } _ACEOF cat >>$CONFIG_STATUS <<_ACEOF sed "$ac_vpsub $extrasub _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF :t /@[a-zA-Z_][a-zA-Z_0-9]*@/!b s,@configure_input@,$configure_input,;t t s,@srcdir@,$ac_srcdir,;t t s,@abs_srcdir@,$ac_abs_srcdir,;t t s,@top_srcdir@,$ac_top_srcdir,;t t s,@abs_top_srcdir@,$ac_abs_top_srcdir,;t t s,@builddir@,$ac_builddir,;t t s,@abs_builddir@,$ac_abs_builddir,;t t s,@top_builddir@,$ac_top_builddir,;t t s,@abs_top_builddir@,$ac_abs_top_builddir,;t t s,@INSTALL@,$ac_INSTALL,;t t " $ac_file_inputs | (eval "$ac_sed_cmds") >$tmp/out rm -f $tmp/stdin if test x"$ac_file" != x-; then mv $tmp/out $ac_file else cat $tmp/out rm -f $tmp/out fi done _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF # # CONFIG_HEADER section. # # These sed commands are passed to sed as "A NAME B NAME C VALUE D", where # NAME is the cpp macro being defined and VALUE is the value it is being given. # # ac_d sets the value in "#define NAME VALUE" lines. ac_dA='s,^\([ ]*\)#\([ ]*define[ ][ ]*\)' ac_dB='[ ].*$,\1#\2' ac_dC=' ' ac_dD=',;t' # ac_u turns "#undef NAME" without trailing blanks into "#define NAME VALUE". ac_uA='s,^\([ ]*\)#\([ ]*\)undef\([ ][ ]*\)' ac_uB='$,\1#\2define\3' ac_uC=' ' ac_uD=',;t' for ac_file in : $CONFIG_HEADERS; do test "x$ac_file" = x: && continue # Support "outfile[:infile[:infile...]]", defaulting infile="outfile.in". case $ac_file in - | *:- | *:-:* ) # input from stdin cat >$tmp/stdin ac_file_in=`echo "$ac_file" | sed 's,[^:]*:,,'` ac_file=`echo "$ac_file" | sed 's,:.*,,'` ;; *:* ) ac_file_in=`echo "$ac_file" | sed 's,[^:]*:,,'` ac_file=`echo "$ac_file" | sed 's,:.*,,'` ;; * ) ac_file_in=$ac_file.in ;; esac test x"$ac_file" != x- && { echo "$as_me:$LINENO: creating $ac_file" >&5 echo "$as_me: creating $ac_file" >&6;} # First look for the input files in the build tree, otherwise in the # src tree. ac_file_inputs=`IFS=: for f in $ac_file_in; do case $f in -) echo $tmp/stdin ;; [\\/$]*) # Absolute (can't be DOS-style, as IFS=:) test -f "$f" || { { echo "$as_me:$LINENO: error: cannot find input file: $f" >&5 echo "$as_me: error: cannot find input file: $f" >&2;} { (exit 1); exit 1; }; } # Do quote $f, to prevent DOS paths from being IFS'd. echo "$f";; *) # Relative if test -f "$f"; then # Build tree echo "$f" elif test -f "$srcdir/$f"; then # Source tree echo "$srcdir/$f" else # /dev/null tree { { echo "$as_me:$LINENO: error: cannot find input file: $f" >&5 echo "$as_me: error: cannot find input file: $f" >&2;} { (exit 1); exit 1; }; } fi;; esac done` || { (exit 1); exit 1; } # Remove the trailing spaces. sed 's/[ ]*$//' $ac_file_inputs >$tmp/in _ACEOF # Transform confdefs.h into two sed scripts, `conftest.defines' and # `conftest.undefs', that substitutes the proper values into # config.h.in to produce config.h. The first handles `#define' # templates, and the second `#undef' templates. # And first: Protect against being on the right side of a sed subst in # config.status. Protect against being in an unquoted here document # in config.status. rm -f conftest.defines conftest.undefs # Using a here document instead of a string reduces the quoting nightmare. # Putting comments in sed scripts is not portable. # # `end' is used to avoid that the second main sed command (meant for # 0-ary CPP macros) applies to n-ary macro definitions. # See the Autoconf documentation for `clear'. cat >confdef2sed.sed <<\_ACEOF s/[\\&,]/\\&/g s,[\\$`],\\&,g t clear : clear s,^[ ]*#[ ]*define[ ][ ]*\([^ (][^ (]*\)\(([^)]*)\)[ ]*\(.*\)$,${ac_dA}\1${ac_dB}\1\2${ac_dC}\3${ac_dD},gp t end s,^[ ]*#[ ]*define[ ][ ]*\([^ ][^ ]*\)[ ]*\(.*\)$,${ac_dA}\1${ac_dB}\1${ac_dC}\2${ac_dD},gp : end _ACEOF # If some macros were called several times there might be several times # the same #defines, which is useless. Nevertheless, we may not want to # sort them, since we want the *last* AC-DEFINE to be honored. uniq confdefs.h | sed -n -f confdef2sed.sed >conftest.defines sed 's/ac_d/ac_u/g' conftest.defines >conftest.undefs rm -f confdef2sed.sed # This sed command replaces #undef with comments. This is necessary, for # example, in the case of _POSIX_SOURCE, which is predefined and required # on some systems where configure will not decide to define it. cat >>conftest.undefs <<\_ACEOF s,^[ ]*#[ ]*undef[ ][ ]*[a-zA-Z_][a-zA-Z_0-9]*,/* & */, _ACEOF # Break up conftest.defines because some shells have a limit on the size # of here documents, and old seds have small limits too (100 cmds). echo ' # Handle all the #define templates only if necessary.' >>$CONFIG_STATUS echo ' if grep "^[ ]*#[ ]*define" $tmp/in >/dev/null; then' >>$CONFIG_STATUS echo ' # If there are no defines, we may have an empty if/fi' >>$CONFIG_STATUS echo ' :' >>$CONFIG_STATUS rm -f conftest.tail while grep . conftest.defines >/dev/null do # Write a limited-size here document to $tmp/defines.sed. echo ' cat >$tmp/defines.sed <>$CONFIG_STATUS # Speed up: don't consider the non `#define' lines. echo '/^[ ]*#[ ]*define/!b' >>$CONFIG_STATUS # Work around the forget-to-reset-the-flag bug. echo 't clr' >>$CONFIG_STATUS echo ': clr' >>$CONFIG_STATUS sed ${ac_max_here_lines}q conftest.defines >>$CONFIG_STATUS echo 'CEOF sed -f $tmp/defines.sed $tmp/in >$tmp/out rm -f $tmp/in mv $tmp/out $tmp/in ' >>$CONFIG_STATUS sed 1,${ac_max_here_lines}d conftest.defines >conftest.tail rm -f conftest.defines mv conftest.tail conftest.defines done rm -f conftest.defines echo ' fi # grep' >>$CONFIG_STATUS echo >>$CONFIG_STATUS # Break up conftest.undefs because some shells have a limit on the size # of here documents, and old seds have small limits too (100 cmds). echo ' # Handle all the #undef templates' >>$CONFIG_STATUS rm -f conftest.tail while grep . conftest.undefs >/dev/null do # Write a limited-size here document to $tmp/undefs.sed. echo ' cat >$tmp/undefs.sed <>$CONFIG_STATUS # Speed up: don't consider the non `#undef' echo '/^[ ]*#[ ]*undef/!b' >>$CONFIG_STATUS # Work around the forget-to-reset-the-flag bug. echo 't clr' >>$CONFIG_STATUS echo ': clr' >>$CONFIG_STATUS sed ${ac_max_here_lines}q conftest.undefs >>$CONFIG_STATUS echo 'CEOF sed -f $tmp/undefs.sed $tmp/in >$tmp/out rm -f $tmp/in mv $tmp/out $tmp/in ' >>$CONFIG_STATUS sed 1,${ac_max_here_lines}d conftest.undefs >conftest.tail rm -f conftest.undefs mv conftest.tail conftest.undefs done rm -f conftest.undefs cat >>$CONFIG_STATUS <<\_ACEOF # Let's still pretend it is `configure' which instantiates (i.e., don't # use $as_me), people would be surprised to read: # /* config.h. Generated by config.status. */ if test x"$ac_file" = x-; then echo "/* Generated by configure. */" >$tmp/config.h else echo "/* $ac_file. Generated by configure. */" >$tmp/config.h fi cat $tmp/in >>$tmp/config.h rm -f $tmp/in if test x"$ac_file" != x-; then if diff $ac_file $tmp/config.h >/dev/null 2>&1; then { echo "$as_me:$LINENO: $ac_file is unchanged" >&5 echo "$as_me: $ac_file is unchanged" >&6;} else ac_dir=`(dirname "$ac_file") 2>/dev/null || $as_expr X"$ac_file" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$ac_file" : 'X\(//\)[^/]' \| \ X"$ac_file" : 'X\(//\)$' \| \ X"$ac_file" : 'X\(/\)' \| \ . : '\(.\)' 2>/dev/null || echo X"$ac_file" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/; q; } /^X\(\/\/\)[^/].*/{ s//\1/; q; } /^X\(\/\/\)$/{ s//\1/; q; } /^X\(\/\).*/{ s//\1/; q; } s/.*/./; q'` { if $as_mkdir_p; then mkdir -p "$ac_dir" else as_dir="$ac_dir" as_dirs= while test ! -d "$as_dir"; do as_dirs="$as_dir $as_dirs" as_dir=`(dirname "$as_dir") 2>/dev/null || $as_expr X"$as_dir" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$as_dir" : 'X\(//\)[^/]' \| \ X"$as_dir" : 'X\(//\)$' \| \ X"$as_dir" : 'X\(/\)' \| \ . : '\(.\)' 2>/dev/null || echo X"$as_dir" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/; q; } /^X\(\/\/\)[^/].*/{ s//\1/; q; } /^X\(\/\/\)$/{ s//\1/; q; } /^X\(\/\).*/{ s//\1/; q; } s/.*/./; q'` done test ! -n "$as_dirs" || mkdir $as_dirs fi || { { echo "$as_me:$LINENO: error: cannot create directory \"$ac_dir\"" >&5 echo "$as_me: error: cannot create directory \"$ac_dir\"" >&2;} { (exit 1); exit 1; }; }; } rm -f $ac_file mv $tmp/config.h $ac_file fi else cat $tmp/config.h rm -f $tmp/config.h fi # Compute $ac_file's index in $config_headers. _am_stamp_count=1 for _am_header in $config_headers :; do case $_am_header in $ac_file | $ac_file:* ) break ;; * ) _am_stamp_count=`expr $_am_stamp_count + 1` ;; esac done echo "timestamp for $ac_file" >`(dirname $ac_file) 2>/dev/null || $as_expr X$ac_file : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X$ac_file : 'X\(//\)[^/]' \| \ X$ac_file : 'X\(//\)$' \| \ X$ac_file : 'X\(/\)' \| \ . : '\(.\)' 2>/dev/null || echo X$ac_file | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/; q; } /^X\(\/\/\)[^/].*/{ s//\1/; q; } /^X\(\/\/\)$/{ s//\1/; q; } /^X\(\/\).*/{ s//\1/; q; } s/.*/./; q'`/stamp-h$_am_stamp_count done _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF # # CONFIG_COMMANDS section. # for ac_file in : $CONFIG_COMMANDS; do test "x$ac_file" = x: && continue ac_dest=`echo "$ac_file" | sed 's,:.*,,'` ac_source=`echo "$ac_file" | sed 's,[^:]*:,,'` ac_dir=`(dirname "$ac_dest") 2>/dev/null || $as_expr X"$ac_dest" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$ac_dest" : 'X\(//\)[^/]' \| \ X"$ac_dest" : 'X\(//\)$' \| \ X"$ac_dest" : 'X\(/\)' \| \ . : '\(.\)' 2>/dev/null || echo X"$ac_dest" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/; q; } /^X\(\/\/\)[^/].*/{ s//\1/; q; } /^X\(\/\/\)$/{ s//\1/; q; } /^X\(\/\).*/{ s//\1/; q; } s/.*/./; q'` { if $as_mkdir_p; then mkdir -p "$ac_dir" else as_dir="$ac_dir" as_dirs= while test ! -d "$as_dir"; do as_dirs="$as_dir $as_dirs" as_dir=`(dirname "$as_dir") 2>/dev/null || $as_expr X"$as_dir" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$as_dir" : 'X\(//\)[^/]' \| \ X"$as_dir" : 'X\(//\)$' \| \ X"$as_dir" : 'X\(/\)' \| \ . : '\(.\)' 2>/dev/null || echo X"$as_dir" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/; q; } /^X\(\/\/\)[^/].*/{ s//\1/; q; } /^X\(\/\/\)$/{ s//\1/; q; } /^X\(\/\).*/{ s//\1/; q; } s/.*/./; q'` done test ! -n "$as_dirs" || mkdir $as_dirs fi || { { echo "$as_me:$LINENO: error: cannot create directory \"$ac_dir\"" >&5 echo "$as_me: error: cannot create directory \"$ac_dir\"" >&2;} { (exit 1); exit 1; }; }; } ac_builddir=. if test "$ac_dir" != .; then ac_dir_suffix=/`echo "$ac_dir" | sed 's,^\.[\\/],,'` # A "../" for each directory in $ac_dir_suffix. ac_top_builddir=`echo "$ac_dir_suffix" | sed 's,/[^\\/]*,../,g'` else ac_dir_suffix= ac_top_builddir= fi case $srcdir in .) # No --srcdir option. We are building in place. ac_srcdir=. if test -z "$ac_top_builddir"; then ac_top_srcdir=. else ac_top_srcdir=`echo $ac_top_builddir | sed 's,/$,,'` fi ;; [\\/]* | ?:[\\/]* ) # Absolute path. ac_srcdir=$srcdir$ac_dir_suffix; ac_top_srcdir=$srcdir ;; *) # Relative path. ac_srcdir=$ac_top_builddir$srcdir$ac_dir_suffix ac_top_srcdir=$ac_top_builddir$srcdir ;; esac # Do not use `cd foo && pwd` to compute absolute paths, because # the directories may not exist. case `pwd` in .) ac_abs_builddir="$ac_dir";; *) case "$ac_dir" in .) ac_abs_builddir=`pwd`;; [\\/]* | ?:[\\/]* ) ac_abs_builddir="$ac_dir";; *) ac_abs_builddir=`pwd`/"$ac_dir";; esac;; esac case $ac_abs_builddir in .) ac_abs_top_builddir=${ac_top_builddir}.;; *) case ${ac_top_builddir}. in .) ac_abs_top_builddir=$ac_abs_builddir;; [\\/]* | ?:[\\/]* ) ac_abs_top_builddir=${ac_top_builddir}.;; *) ac_abs_top_builddir=$ac_abs_builddir/${ac_top_builddir}.;; esac;; esac case $ac_abs_builddir in .) ac_abs_srcdir=$ac_srcdir;; *) case $ac_srcdir in .) ac_abs_srcdir=$ac_abs_builddir;; [\\/]* | ?:[\\/]* ) ac_abs_srcdir=$ac_srcdir;; *) ac_abs_srcdir=$ac_abs_builddir/$ac_srcdir;; esac;; esac case $ac_abs_builddir in .) ac_abs_top_srcdir=$ac_top_srcdir;; *) case $ac_top_srcdir in .) ac_abs_top_srcdir=$ac_abs_builddir;; [\\/]* | ?:[\\/]* ) ac_abs_top_srcdir=$ac_top_srcdir;; *) ac_abs_top_srcdir=$ac_abs_builddir/$ac_top_srcdir;; esac;; esac { echo "$as_me:$LINENO: executing $ac_dest commands" >&5 echo "$as_me: executing $ac_dest commands" >&6;} case $ac_dest in depfiles ) test x"$AMDEP_TRUE" != x"" || for mf in $CONFIG_FILES; do # Strip MF so we end up with the name of the file. mf=`echo "$mf" | sed -e 's/:.*$//'` # Check whether this is an Automake generated Makefile or not. # We used to match only the files named `Makefile.in', but # some people rename them; so instead we look at the file content. # Grep'ing the first line is not enough: some people post-process # each Makefile.in and add a new line on top of each file to say so. # So let's grep whole file. if grep '^#.*generated by automake' $mf > /dev/null 2>&1; then dirpart=`(dirname "$mf") 2>/dev/null || $as_expr X"$mf" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$mf" : 'X\(//\)[^/]' \| \ X"$mf" : 'X\(//\)$' \| \ X"$mf" : 'X\(/\)' \| \ . : '\(.\)' 2>/dev/null || echo X"$mf" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/; q; } /^X\(\/\/\)[^/].*/{ s//\1/; q; } /^X\(\/\/\)$/{ s//\1/; q; } /^X\(\/\).*/{ s//\1/; q; } s/.*/./; q'` else continue fi # Extract the definition of DEPDIR, am__include, and am__quote # from the Makefile without running `make'. DEPDIR=`sed -n 's/^DEPDIR = //p' < "$mf"` test -z "$DEPDIR" && continue am__include=`sed -n 's/^am__include = //p' < "$mf"` test -z "am__include" && continue am__quote=`sed -n 's/^am__quote = //p' < "$mf"` # When using ansi2knr, U may be empty or an underscore; expand it U=`sed -n 's/^U = //p' < "$mf"` # Find all dependency output files, they are included files with # $(DEPDIR) in their names. We invoke sed twice because it is the # simplest approach to changing $(DEPDIR) to its actual value in the # expansion. for file in `sed -n " s/^$am__include $am__quote\(.*(DEPDIR).*\)$am__quote"'$/\1/p' <"$mf" | \ sed -e 's/\$(DEPDIR)/'"$DEPDIR"'/g' -e 's/\$U/'"$U"'/g'`; do # Make sure the directory exists. test -f "$dirpart/$file" && continue fdir=`(dirname "$file") 2>/dev/null || $as_expr X"$file" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$file" : 'X\(//\)[^/]' \| \ X"$file" : 'X\(//\)$' \| \ X"$file" : 'X\(/\)' \| \ . : '\(.\)' 2>/dev/null || echo X"$file" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/; q; } /^X\(\/\/\)[^/].*/{ s//\1/; q; } /^X\(\/\/\)$/{ s//\1/; q; } /^X\(\/\).*/{ s//\1/; q; } s/.*/./; q'` { if $as_mkdir_p; then mkdir -p $dirpart/$fdir else as_dir=$dirpart/$fdir as_dirs= while test ! -d "$as_dir"; do as_dirs="$as_dir $as_dirs" as_dir=`(dirname "$as_dir") 2>/dev/null || $as_expr X"$as_dir" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$as_dir" : 'X\(//\)[^/]' \| \ X"$as_dir" : 'X\(//\)$' \| \ X"$as_dir" : 'X\(/\)' \| \ . : '\(.\)' 2>/dev/null || echo X"$as_dir" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/; q; } /^X\(\/\/\)[^/].*/{ s//\1/; q; } /^X\(\/\/\)$/{ s//\1/; q; } /^X\(\/\).*/{ s//\1/; q; } s/.*/./; q'` done test ! -n "$as_dirs" || mkdir $as_dirs fi || { { echo "$as_me:$LINENO: error: cannot create directory $dirpart/$fdir" >&5 echo "$as_me: error: cannot create directory $dirpart/$fdir" >&2;} { (exit 1); exit 1; }; }; } # echo "creating $dirpart/$file" echo '# dummy' > "$dirpart/$file" done done ;; default-1 ) case "$CONFIG_FILES" in *po/Makefile.in*) sed -e "/POTFILES =/r po/POTFILES" po/Makefile.in > po/Makefile esac ;; intltool ) intltool_edit="-e 's:@INTLTOOL_EXTRACT@:`pwd`/intltool-extract:g' \ -e 's:@INTLTOOL_ICONV@:${ICONV}:g' \ -e 's:@INTLTOOL_MSGFMT@:${MSGFMT}:g' \ -e 's:@INTLTOOL_MSGMERGE@:${MSGMERGE}:g' \ -e 's:@INTLTOOL_XGETTEXT@:${XGETTEXT}:g' \ -e 's:@INTLTOOL_PERL@:${INTLTOOL_PERL}:g'" eval sed ${intltool_edit} < ${ac_aux_dir}/intltool-extract.in \ > intltool-extract.out if cmp -s intltool-extract intltool-extract.out 2>/dev/null; then rm -f intltool-extract.out else mv -f intltool-extract.out intltool-extract fi chmod ugo+x intltool-extract chmod u+w intltool-extract eval sed ${intltool_edit} < ${ac_aux_dir}/intltool-merge.in \ > intltool-merge.out if cmp -s intltool-merge intltool-merge.out 2>/dev/null; then rm -f intltool-merge.out else mv -f intltool-merge.out intltool-merge fi chmod ugo+x intltool-merge chmod u+w intltool-merge eval sed ${intltool_edit} < ${ac_aux_dir}/intltool-update.in \ > intltool-update.out if cmp -s intltool-update intltool-update.out 2>/dev/null; then rm -f intltool-update.out else mv -f intltool-update.out intltool-update fi chmod ugo+x intltool-update chmod u+w intltool-update ;; esac done _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF { (exit 0); exit 0; } _ACEOF chmod +x $CONFIG_STATUS ac_clean_files=$ac_clean_files_save # configure is writing to config.log, and then calls config.status. # config.status does its own redirection, appending to config.log. # Unfortunately, on DOS this fails, as config.log is still kept open # by configure, so config.status won't be able to write to it; its # output is simply discarded. So we exec the FD to /dev/null, # effectively closing config.log, so it can be properly (re)opened and # appended to by config.status. When coming back to configure, we # need to make the FD available again. if test "$no_create" != yes; then ac_cs_success=: ac_config_status_args= test "$silent" = yes && ac_config_status_args="$ac_config_status_args --quiet" exec 5>/dev/null $SHELL $CONFIG_STATUS $ac_config_status_args || ac_cs_success=false exec 5>>config.log # Use ||, not &&, to avoid exiting from the if with $? = 1, which # would make configure fail if this is the last instruction. $ac_cs_success || { (exit 1); exit 1; } fi ### report cat <. libtranslate-0.99/COPYING000644 001750 001750 00000002733 10172766047 016747 0ustar00jylefortjylefort000000 000000 Copyright (C) 2004, 2005 Jean-Yves Lefort All rights reserved. Redistribution and use in source and binary forms, with or without modification, are permitted provided that the following conditions are met: 1. Redistributions of source code must retain the above copyright notice, this list of conditions and the following disclaimer. 2. Redistributions in binary form must reproduce the above copyright notice, this list of conditions and the following disclaimer in the documentation and/or other materials provided with the distribution. 3. Neither the name of Jean-Yves Lefort nor the names of its contributors may be used to endorse or promote products derived from this software without specific prior written permission. THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. libtranslate-0.99/INSTALL000644 001750 001750 00000003075 10172766273 016746 0ustar00jylefortjylefort000000 000000 =============================================================================== libtranslate installation instructions =============================================================================== Index 0. About this document 1. Dependencies 2. Instructions 3. Configure options 0. About this document $Id: INSTALL,v 1.2 2005/01/17 16:50:03 jylefort Exp $ Copyright (C) 2005 Jean-Yves Lefort. This document is part of libtranslate. It may be distributed under the same terms as libtranslate. 1. Dependencies Mandatory libraries: * GLib (version 2.4.0 or superior) http://www.gtk.org/ Optional libraries: * for the generic module: libsoup (version 2.2.0 or superior) http://www.gnome.org/ libxml2 (version 2.0 or superior) http://www.xmlsoft.org/ * for the talkfilters module: GNU Talk Filters http://www.dystance.net/software/talkfilters/ 2. Instructions libtranslate uses the well-known GNU build system. Hence, the following usual sequence will probably satisfy most users: $ ./configure --prefix=/usr $ make $ make install The ./configure script options are documented below. They are enabled by default and automatically disabled if a requirement is not met, so you probably do not need to use them. 3. Configure options --enable-generic (default: yes) Build the generic module. Requirements: libsoup version 2.2.0 or superior libxml2 version 2.0 or superior. --enable-talkfilters (default: yes) Build the talkfilters module. Requirements: GNU Talk Filters. libtranslate-0.99/NEWS000644 001750 001750 00000000057 10172237101 016370 0ustar00jylefortjylefort000000 000000 0.99 January 15, 2005 * Initial release libtranslate-0.99/TODO000644 001750 001750 00000000000 10172766117 016363 0ustar00jylefortjylefort000000 000000 libtranslate-0.99/compile000755 001750 001750 00000005326 10161371573 017265 0ustar00jylefortjylefort000000 000000 #! /bin/sh # Wrapper for compilers which do not understand `-c -o'. # Copyright 1999, 2000 Free Software Foundation, Inc. # Written by Tom Tromey . # # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2, or (at your option) # any later version. # # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA. # As a special exception to the GNU General Public License, if you # distribute this file as part of a program that contains a # configuration script generated by Autoconf, you may include it under # the same distribution terms that you use for the rest of that program. # Usage: # compile PROGRAM [ARGS]... # `-o FOO.o' is removed from the args passed to the actual compile. prog=$1 shift ofile= cfile= args= while test $# -gt 0; do case "$1" in -o) # configure might choose to run compile as `compile cc -o foo foo.c'. # So we do something ugly here. ofile=$2 shift case "$ofile" in *.o | *.obj) ;; *) args="$args -o $ofile" ofile= ;; esac ;; *.c) cfile=$1 args="$args $1" ;; *) args="$args $1" ;; esac shift done if test -z "$ofile" || test -z "$cfile"; then # If no `-o' option was seen then we might have been invoked from a # pattern rule where we don't need one. That is ok -- this is a # normal compilation that the losing compiler can handle. If no # `.c' file was seen then we are probably linking. That is also # ok. exec "$prog" $args fi # Name of file we expect compiler to create. cofile=`echo $cfile | sed -e 's|^.*/||' -e 's/\.c$/.o/'` # Create the lock directory. # Note: use `[/.-]' here to ensure that we don't use the same name # that we are using for the .o file. Also, base the name on the expected # object file name, since that is what matters with a parallel build. lockdir=`echo $cofile | sed -e 's|[/.-]|_|g'`.d while true; do if mkdir $lockdir > /dev/null 2>&1; then break fi sleep 1 done # FIXME: race condition here if user kills between mkdir and trap. trap "rmdir $lockdir; exit 1" 1 2 15 # Run the compile. "$prog" $args status=$? if test -f "$cofile"; then mv "$cofile" "$ofile" fi rmdir $lockdir exit $status libtranslate-0.99/config.guess000555 001750 001750 00000122065 10145502334 020216 0ustar00jylefortjylefort000000 000000 #! /bin/sh # Attempt to guess a canonical system name. # Copyright (C) 1992, 1993, 1994, 1995, 1996, 1997, 1998, 1999, # 2000, 2001, 2002, 2003 Free Software Foundation, Inc. timestamp='2003-07-02' # This file is free software; you can redistribute it and/or modify it # under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2 of the License, or # (at your option) any later version. # # This program is distributed in the hope that it will be useful, but # WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU # General Public License for more details. # # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA. # # As a special exception to the GNU General Public License, if you # distribute this file as part of a program that contains a # configuration script generated by Autoconf, you may include it under # the same distribution terms that you use for the rest of that program. # Originally written by Per Bothner . # Please send patches to . Submit a context # diff and a properly formatted ChangeLog entry. # # This script attempts to guess a canonical system name similar to # config.sub. If it succeeds, it prints the system name on stdout, and # exits with 0. Otherwise, it exits with 1. # # The plan is that this can be called by configure scripts if you # don't specify an explicit build system type. me=`echo "$0" | sed -e 's,.*/,,'` usage="\ Usage: $0 [OPTION] Output the configuration name of the system \`$me' is run on. Operation modes: -h, --help print this help, then exit -t, --time-stamp print date of last modification, then exit -v, --version print version number, then exit Report bugs and patches to ." version="\ GNU config.guess ($timestamp) Originally written by Per Bothner. Copyright (C) 1992, 1993, 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001 Free Software Foundation, Inc. This is free software; see the source for copying conditions. There is NO warranty; not even for MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE." help=" Try \`$me --help' for more information." # Parse command line while test $# -gt 0 ; do case $1 in --time-stamp | --time* | -t ) echo "$timestamp" ; exit 0 ;; --version | -v ) echo "$version" ; exit 0 ;; --help | --h* | -h ) echo "$usage"; exit 0 ;; -- ) # Stop option processing shift; break ;; - ) # Use stdin as input. break ;; -* ) echo "$me: invalid option $1$help" >&2 exit 1 ;; * ) break ;; esac done if test $# != 0; then echo "$me: too many arguments$help" >&2 exit 1 fi trap 'exit 1' 1 2 15 # CC_FOR_BUILD -- compiler used by this script. Note that the use of a # compiler to aid in system detection is discouraged as it requires # temporary files to be created and, as you can see below, it is a # headache to deal with in a portable fashion. # Historically, `CC_FOR_BUILD' used to be named `HOST_CC'. We still # use `HOST_CC' if defined, but it is deprecated. # Portable tmp directory creation inspired by the Autoconf team. set_cc_for_build=' trap "exitcode=\$?; (rm -f \$tmpfiles 2>/dev/null; rmdir \$tmp 2>/dev/null) && exit \$exitcode" 0 ; trap "rm -f \$tmpfiles 2>/dev/null; rmdir \$tmp 2>/dev/null; exit 1" 1 2 13 15 ; : ${TMPDIR=/tmp} ; { tmp=`(umask 077 && mktemp -d -q "$TMPDIR/cgXXXXXX") 2>/dev/null` && test -n "$tmp" && test -d "$tmp" ; } || { test -n "$RANDOM" && tmp=$TMPDIR/cg$$-$RANDOM && (umask 077 && mkdir $tmp) ; } || { tmp=$TMPDIR/cg-$$ && (umask 077 && mkdir $tmp) && echo "Warning: creating insecure temp directory" >&2 ; } || { echo "$me: cannot create a temporary directory in $TMPDIR" >&2 ; exit 1 ; } ; dummy=$tmp/dummy ; tmpfiles="$dummy.c $dummy.o $dummy.rel $dummy" ; case $CC_FOR_BUILD,$HOST_CC,$CC in ,,) echo "int x;" > $dummy.c ; for c in cc gcc c89 c99 ; do if ($c -c -o $dummy.o $dummy.c) >/dev/null 2>&1 ; then CC_FOR_BUILD="$c"; break ; fi ; done ; if test x"$CC_FOR_BUILD" = x ; then CC_FOR_BUILD=no_compiler_found ; fi ;; ,,*) CC_FOR_BUILD=$CC ;; ,*,*) CC_FOR_BUILD=$HOST_CC ;; esac ;' # This is needed to find uname on a Pyramid OSx when run in the BSD universe. # (ghazi@noc.rutgers.edu 1994-08-24) if (test -f /.attbin/uname) >/dev/null 2>&1 ; then PATH=$PATH:/.attbin ; export PATH fi UNAME_MACHINE=`(uname -m) 2>/dev/null` || UNAME_MACHINE=unknown UNAME_RELEASE=`(uname -r) 2>/dev/null` || UNAME_RELEASE=unknown UNAME_SYSTEM=`(uname -s) 2>/dev/null` || UNAME_SYSTEM=unknown UNAME_VERSION=`(uname -v) 2>/dev/null` || UNAME_VERSION=unknown # Note: order is significant - the case branches are not exclusive. case "${UNAME_MACHINE}:${UNAME_SYSTEM}:${UNAME_RELEASE}:${UNAME_VERSION}" in *:NetBSD:*:*) # NetBSD (nbsd) targets should (where applicable) match one or # more of the tupples: *-*-netbsdelf*, *-*-netbsdaout*, # *-*-netbsdecoff* and *-*-netbsd*. For targets that recently # switched to ELF, *-*-netbsd* would select the old # object file format. This provides both forward # compatibility and a consistent mechanism for selecting the # object file format. # # Note: NetBSD doesn't particularly care about the vendor # portion of the name. We always set it to "unknown". sysctl="sysctl -n hw.machine_arch" UNAME_MACHINE_ARCH=`(/sbin/$sysctl 2>/dev/null || \ /usr/sbin/$sysctl 2>/dev/null || echo unknown)` case "${UNAME_MACHINE_ARCH}" in armeb) machine=armeb-unknown ;; arm*) machine=arm-unknown ;; sh3el) machine=shl-unknown ;; sh3eb) machine=sh-unknown ;; *) machine=${UNAME_MACHINE_ARCH}-unknown ;; esac # The Operating System including object format, if it has switched # to ELF recently, or will in the future. case "${UNAME_MACHINE_ARCH}" in arm*|i386|m68k|ns32k|sh3*|sparc|vax) eval $set_cc_for_build if echo __ELF__ | $CC_FOR_BUILD -E - 2>/dev/null \ | grep __ELF__ >/dev/null then # Once all utilities can be ECOFF (netbsdecoff) or a.out (netbsdaout). # Return netbsd for either. FIX? os=netbsd else os=netbsdelf fi ;; *) os=netbsd ;; esac # The OS release # Debian GNU/NetBSD machines have a different userland, and # thus, need a distinct triplet. However, they do not need # kernel version information, so it can be replaced with a # suitable tag, in the style of linux-gnu. case "${UNAME_VERSION}" in Debian*) release='-gnu' ;; *) release=`echo ${UNAME_RELEASE}|sed -e 's/[-_].*/\./'` ;; esac # Since CPU_TYPE-MANUFACTURER-KERNEL-OPERATING_SYSTEM: # contains redundant information, the shorter form: # CPU_TYPE-MANUFACTURER-OPERATING_SYSTEM is used. echo "${machine}-${os}${release}" exit 0 ;; amiga:OpenBSD:*:*) echo m68k-unknown-openbsd${UNAME_RELEASE} exit 0 ;; arc:OpenBSD:*:*) echo mipsel-unknown-openbsd${UNAME_RELEASE} exit 0 ;; hp300:OpenBSD:*:*) echo m68k-unknown-openbsd${UNAME_RELEASE} exit 0 ;; mac68k:OpenBSD:*:*) echo m68k-unknown-openbsd${UNAME_RELEASE} exit 0 ;; macppc:OpenBSD:*:*) echo powerpc-unknown-openbsd${UNAME_RELEASE} exit 0 ;; mvme68k:OpenBSD:*:*) echo m68k-unknown-openbsd${UNAME_RELEASE} exit 0 ;; mvme88k:OpenBSD:*:*) echo m88k-unknown-openbsd${UNAME_RELEASE} exit 0 ;; mvmeppc:OpenBSD:*:*) echo powerpc-unknown-openbsd${UNAME_RELEASE} exit 0 ;; pmax:OpenBSD:*:*) echo mipsel-unknown-openbsd${UNAME_RELEASE} exit 0 ;; sgi:OpenBSD:*:*) echo mipseb-unknown-openbsd${UNAME_RELEASE} exit 0 ;; sun3:OpenBSD:*:*) echo m68k-unknown-openbsd${UNAME_RELEASE} exit 0 ;; wgrisc:OpenBSD:*:*) echo mipsel-unknown-openbsd${UNAME_RELEASE} exit 0 ;; *:OpenBSD:*:*) echo ${UNAME_MACHINE}-unknown-openbsd${UNAME_RELEASE} exit 0 ;; alpha:OSF1:*:*) if test $UNAME_RELEASE = "V4.0"; then UNAME_RELEASE=`/usr/sbin/sizer -v | awk '{print $3}'` fi # According to Compaq, /usr/sbin/psrinfo has been available on # OSF/1 and Tru64 systems produced since 1995. I hope that # covers most systems running today. This code pipes the CPU # types through head -n 1, so we only detect the type of CPU 0. ALPHA_CPU_TYPE=`/usr/sbin/psrinfo -v | sed -n -e 's/^ The alpha \(.*\) processor.*$/\1/p' | head -n 1` case "$ALPHA_CPU_TYPE" in "EV4 (21064)") UNAME_MACHINE="alpha" ;; "EV4.5 (21064)") UNAME_MACHINE="alpha" ;; "LCA4 (21066/21068)") UNAME_MACHINE="alpha" ;; "EV5 (21164)") UNAME_MACHINE="alphaev5" ;; "EV5.6 (21164A)") UNAME_MACHINE="alphaev56" ;; "EV5.6 (21164PC)") UNAME_MACHINE="alphapca56" ;; "EV5.7 (21164PC)") UNAME_MACHINE="alphapca57" ;; "EV6 (21264)") UNAME_MACHINE="alphaev6" ;; "EV6.7 (21264A)") UNAME_MACHINE="alphaev67" ;; "EV6.8CB (21264C)") UNAME_MACHINE="alphaev68" ;; "EV6.8AL (21264B)") UNAME_MACHINE="alphaev68" ;; "EV6.8CX (21264D)") UNAME_MACHINE="alphaev68" ;; "EV6.9A (21264/EV69A)") UNAME_MACHINE="alphaev69" ;; "EV7 (21364)") UNAME_MACHINE="alphaev7" ;; "EV7.9 (21364A)") UNAME_MACHINE="alphaev79" ;; esac # A Vn.n version is a released version. # A Tn.n version is a released field test version. # A Xn.n version is an unreleased experimental baselevel. # 1.2 uses "1.2" for uname -r. echo ${UNAME_MACHINE}-dec-osf`echo ${UNAME_RELEASE} | sed -e 's/^[VTX]//' | tr 'ABCDEFGHIJKLMNOPQRSTUVWXYZ' 'abcdefghijklmnopqrstuvwxyz'` exit 0 ;; Alpha*:OpenVMS:*:*) echo alpha-hp-vms exit 0 ;; Alpha\ *:Windows_NT*:*) # How do we know it's Interix rather than the generic POSIX subsystem? # Should we change UNAME_MACHINE based on the output of uname instead # of the specific Alpha model? echo alpha-pc-interix exit 0 ;; 21064:Windows_NT:50:3) echo alpha-dec-winnt3.5 exit 0 ;; Amiga*:UNIX_System_V:4.0:*) echo m68k-unknown-sysv4 exit 0;; *:[Aa]miga[Oo][Ss]:*:*) echo ${UNAME_MACHINE}-unknown-amigaos exit 0 ;; *:[Mm]orph[Oo][Ss]:*:*) echo ${UNAME_MACHINE}-unknown-morphos exit 0 ;; *:OS/390:*:*) echo i370-ibm-openedition exit 0 ;; arm:RISC*:1.[012]*:*|arm:riscix:1.[012]*:*) echo arm-acorn-riscix${UNAME_RELEASE} exit 0;; SR2?01:HI-UX/MPP:*:* | SR8000:HI-UX/MPP:*:*) echo hppa1.1-hitachi-hiuxmpp exit 0;; Pyramid*:OSx*:*:* | MIS*:OSx*:*:* | MIS*:SMP_DC-OSx*:*:*) # akee@wpdis03.wpafb.af.mil (Earle F. Ake) contributed MIS and NILE. if test "`(/bin/universe) 2>/dev/null`" = att ; then echo pyramid-pyramid-sysv3 else echo pyramid-pyramid-bsd fi exit 0 ;; NILE*:*:*:dcosx) echo pyramid-pyramid-svr4 exit 0 ;; DRS?6000:unix:4.0:6*) echo sparc-icl-nx6 exit 0 ;; DRS?6000:UNIX_SV:4.2*:7*) case `/usr/bin/uname -p` in sparc) echo sparc-icl-nx7 && exit 0 ;; esac ;; sun4H:SunOS:5.*:*) echo sparc-hal-solaris2`echo ${UNAME_RELEASE}|sed -e 's/[^.]*//'` exit 0 ;; sun4*:SunOS:5.*:* | tadpole*:SunOS:5.*:*) echo sparc-sun-solaris2`echo ${UNAME_RELEASE}|sed -e 's/[^.]*//'` exit 0 ;; i86pc:SunOS:5.*:*) echo i386-pc-solaris2`echo ${UNAME_RELEASE}|sed -e 's/[^.]*//'` exit 0 ;; sun4*:SunOS:6*:*) # According to config.sub, this is the proper way to canonicalize # SunOS6. Hard to guess exactly what SunOS6 will be like, but # it's likely to be more like Solaris than SunOS4. echo sparc-sun-solaris3`echo ${UNAME_RELEASE}|sed -e 's/[^.]*//'` exit 0 ;; sun4*:SunOS:*:*) case "`/usr/bin/arch -k`" in Series*|S4*) UNAME_RELEASE=`uname -v` ;; esac # Japanese Language versions have a version number like `4.1.3-JL'. echo sparc-sun-sunos`echo ${UNAME_RELEASE}|sed -e 's/-/_/'` exit 0 ;; sun3*:SunOS:*:*) echo m68k-sun-sunos${UNAME_RELEASE} exit 0 ;; sun*:*:4.2BSD:*) UNAME_RELEASE=`(sed 1q /etc/motd | awk '{print substr($5,1,3)}') 2>/dev/null` test "x${UNAME_RELEASE}" = "x" && UNAME_RELEASE=3 case "`/bin/arch`" in sun3) echo m68k-sun-sunos${UNAME_RELEASE} ;; sun4) echo sparc-sun-sunos${UNAME_RELEASE} ;; esac exit 0 ;; aushp:SunOS:*:*) echo sparc-auspex-sunos${UNAME_RELEASE} exit 0 ;; # The situation for MiNT is a little confusing. The machine name # can be virtually everything (everything which is not # "atarist" or "atariste" at least should have a processor # > m68000). The system name ranges from "MiNT" over "FreeMiNT" # to the lowercase version "mint" (or "freemint"). Finally # the system name "TOS" denotes a system which is actually not # MiNT. But MiNT is downward compatible to TOS, so this should # be no problem. atarist[e]:*MiNT:*:* | atarist[e]:*mint:*:* | atarist[e]:*TOS:*:*) echo m68k-atari-mint${UNAME_RELEASE} exit 0 ;; atari*:*MiNT:*:* | atari*:*mint:*:* | atarist[e]:*TOS:*:*) echo m68k-atari-mint${UNAME_RELEASE} exit 0 ;; *falcon*:*MiNT:*:* | *falcon*:*mint:*:* | *falcon*:*TOS:*:*) echo m68k-atari-mint${UNAME_RELEASE} exit 0 ;; milan*:*MiNT:*:* | milan*:*mint:*:* | *milan*:*TOS:*:*) echo m68k-milan-mint${UNAME_RELEASE} exit 0 ;; hades*:*MiNT:*:* | hades*:*mint:*:* | *hades*:*TOS:*:*) echo m68k-hades-mint${UNAME_RELEASE} exit 0 ;; *:*MiNT:*:* | *:*mint:*:* | *:*TOS:*:*) echo m68k-unknown-mint${UNAME_RELEASE} exit 0 ;; powerpc:machten:*:*) echo powerpc-apple-machten${UNAME_RELEASE} exit 0 ;; RISC*:Mach:*:*) echo mips-dec-mach_bsd4.3 exit 0 ;; RISC*:ULTRIX:*:*) echo mips-dec-ultrix${UNAME_RELEASE} exit 0 ;; VAX*:ULTRIX*:*:*) echo vax-dec-ultrix${UNAME_RELEASE} exit 0 ;; 2020:CLIX:*:* | 2430:CLIX:*:*) echo clipper-intergraph-clix${UNAME_RELEASE} exit 0 ;; mips:*:*:UMIPS | mips:*:*:RISCos) eval $set_cc_for_build sed 's/^ //' << EOF >$dummy.c #ifdef __cplusplus #include /* for printf() prototype */ int main (int argc, char *argv[]) { #else int main (argc, argv) int argc; char *argv[]; { #endif #if defined (host_mips) && defined (MIPSEB) #if defined (SYSTYPE_SYSV) printf ("mips-mips-riscos%ssysv\n", argv[1]); exit (0); #endif #if defined (SYSTYPE_SVR4) printf ("mips-mips-riscos%ssvr4\n", argv[1]); exit (0); #endif #if defined (SYSTYPE_BSD43) || defined(SYSTYPE_BSD) printf ("mips-mips-riscos%sbsd\n", argv[1]); exit (0); #endif #endif exit (-1); } EOF $CC_FOR_BUILD -o $dummy $dummy.c \ && $dummy `echo "${UNAME_RELEASE}" | sed -n 's/\([0-9]*\).*/\1/p'` \ && exit 0 echo mips-mips-riscos${UNAME_RELEASE} exit 0 ;; Motorola:PowerMAX_OS:*:*) echo powerpc-motorola-powermax exit 0 ;; Motorola:*:4.3:PL8-*) echo powerpc-harris-powermax exit 0 ;; Night_Hawk:*:*:PowerMAX_OS | Synergy:PowerMAX_OS:*:*) echo powerpc-harris-powermax exit 0 ;; Night_Hawk:Power_UNIX:*:*) echo powerpc-harris-powerunix exit 0 ;; m88k:CX/UX:7*:*) echo m88k-harris-cxux7 exit 0 ;; m88k:*:4*:R4*) echo m88k-motorola-sysv4 exit 0 ;; m88k:*:3*:R3*) echo m88k-motorola-sysv3 exit 0 ;; AViiON:dgux:*:*) # DG/UX returns AViiON for all architectures UNAME_PROCESSOR=`/usr/bin/uname -p` if [ $UNAME_PROCESSOR = mc88100 ] || [ $UNAME_PROCESSOR = mc88110 ] then if [ ${TARGET_BINARY_INTERFACE}x = m88kdguxelfx ] || \ [ ${TARGET_BINARY_INTERFACE}x = x ] then echo m88k-dg-dgux${UNAME_RELEASE} else echo m88k-dg-dguxbcs${UNAME_RELEASE} fi else echo i586-dg-dgux${UNAME_RELEASE} fi exit 0 ;; M88*:DolphinOS:*:*) # DolphinOS (SVR3) echo m88k-dolphin-sysv3 exit 0 ;; M88*:*:R3*:*) # Delta 88k system running SVR3 echo m88k-motorola-sysv3 exit 0 ;; XD88*:*:*:*) # Tektronix XD88 system running UTekV (SVR3) echo m88k-tektronix-sysv3 exit 0 ;; Tek43[0-9][0-9]:UTek:*:*) # Tektronix 4300 system running UTek (BSD) echo m68k-tektronix-bsd exit 0 ;; *:IRIX*:*:*) echo mips-sgi-irix`echo ${UNAME_RELEASE}|sed -e 's/-/_/g'` exit 0 ;; ????????:AIX?:[12].1:2) # AIX 2.2.1 or AIX 2.1.1 is RT/PC AIX. echo romp-ibm-aix # uname -m gives an 8 hex-code CPU id exit 0 ;; # Note that: echo "'`uname -s`'" gives 'AIX ' i*86:AIX:*:*) echo i386-ibm-aix exit 0 ;; ia64:AIX:*:*) if [ -x /usr/bin/oslevel ] ; then IBM_REV=`/usr/bin/oslevel` else IBM_REV=${UNAME_VERSION}.${UNAME_RELEASE} fi echo ${UNAME_MACHINE}-ibm-aix${IBM_REV} exit 0 ;; *:AIX:2:3) if grep bos325 /usr/include/stdio.h >/dev/null 2>&1; then eval $set_cc_for_build sed 's/^ //' << EOF >$dummy.c #include main() { if (!__power_pc()) exit(1); puts("powerpc-ibm-aix3.2.5"); exit(0); } EOF $CC_FOR_BUILD -o $dummy $dummy.c && $dummy && exit 0 echo rs6000-ibm-aix3.2.5 elif grep bos324 /usr/include/stdio.h >/dev/null 2>&1; then echo rs6000-ibm-aix3.2.4 else echo rs6000-ibm-aix3.2 fi exit 0 ;; *:AIX:*:[45]) IBM_CPU_ID=`/usr/sbin/lsdev -C -c processor -S available | sed 1q | awk '{ print $1 }'` if /usr/sbin/lsattr -El ${IBM_CPU_ID} | grep ' POWER' >/dev/null 2>&1; then IBM_ARCH=rs6000 else IBM_ARCH=powerpc fi if [ -x /usr/bin/oslevel ] ; then IBM_REV=`/usr/bin/oslevel` else IBM_REV=${UNAME_VERSION}.${UNAME_RELEASE} fi echo ${IBM_ARCH}-ibm-aix${IBM_REV} exit 0 ;; *:AIX:*:*) echo rs6000-ibm-aix exit 0 ;; ibmrt:4.4BSD:*|romp-ibm:BSD:*) echo romp-ibm-bsd4.4 exit 0 ;; ibmrt:*BSD:*|romp-ibm:BSD:*) # covers RT/PC BSD and echo romp-ibm-bsd${UNAME_RELEASE} # 4.3 with uname added to exit 0 ;; # report: romp-ibm BSD 4.3 *:BOSX:*:*) echo rs6000-bull-bosx exit 0 ;; DPX/2?00:B.O.S.:*:*) echo m68k-bull-sysv3 exit 0 ;; 9000/[34]??:4.3bsd:1.*:*) echo m68k-hp-bsd exit 0 ;; hp300:4.4BSD:*:* | 9000/[34]??:4.3bsd:2.*:*) echo m68k-hp-bsd4.4 exit 0 ;; 9000/[34678]??:HP-UX:*:*) HPUX_REV=`echo ${UNAME_RELEASE}|sed -e 's/[^.]*.[0B]*//'` case "${UNAME_MACHINE}" in 9000/31? ) HP_ARCH=m68000 ;; 9000/[34]?? ) HP_ARCH=m68k ;; 9000/[678][0-9][0-9]) if [ -x /usr/bin/getconf ]; then sc_cpu_version=`/usr/bin/getconf SC_CPU_VERSION 2>/dev/null` sc_kernel_bits=`/usr/bin/getconf SC_KERNEL_BITS 2>/dev/null` case "${sc_cpu_version}" in 523) HP_ARCH="hppa1.0" ;; # CPU_PA_RISC1_0 528) HP_ARCH="hppa1.1" ;; # CPU_PA_RISC1_1 532) # CPU_PA_RISC2_0 case "${sc_kernel_bits}" in 32) HP_ARCH="hppa2.0n" ;; 64) HP_ARCH="hppa2.0w" ;; '') HP_ARCH="hppa2.0" ;; # HP-UX 10.20 esac ;; esac fi if [ "${HP_ARCH}" = "" ]; then eval $set_cc_for_build sed 's/^ //' << EOF >$dummy.c #define _HPUX_SOURCE #include #include int main () { #if defined(_SC_KERNEL_BITS) long bits = sysconf(_SC_KERNEL_BITS); #endif long cpu = sysconf (_SC_CPU_VERSION); switch (cpu) { case CPU_PA_RISC1_0: puts ("hppa1.0"); break; case CPU_PA_RISC1_1: puts ("hppa1.1"); break; case CPU_PA_RISC2_0: #if defined(_SC_KERNEL_BITS) switch (bits) { case 64: puts ("hppa2.0w"); break; case 32: puts ("hppa2.0n"); break; default: puts ("hppa2.0"); break; } break; #else /* !defined(_SC_KERNEL_BITS) */ puts ("hppa2.0"); break; #endif default: puts ("hppa1.0"); break; } exit (0); } EOF (CCOPTS= $CC_FOR_BUILD -o $dummy $dummy.c 2>/dev/null) && HP_ARCH=`$dummy` test -z "$HP_ARCH" && HP_ARCH=hppa fi ;; esac if [ ${HP_ARCH} = "hppa2.0w" ] then # avoid double evaluation of $set_cc_for_build test -n "$CC_FOR_BUILD" || eval $set_cc_for_build if echo __LP64__ | (CCOPTS= $CC_FOR_BUILD -E -) | grep __LP64__ >/dev/null then HP_ARCH="hppa2.0w" else HP_ARCH="hppa64" fi fi echo ${HP_ARCH}-hp-hpux${HPUX_REV} exit 0 ;; ia64:HP-UX:*:*) HPUX_REV=`echo ${UNAME_RELEASE}|sed -e 's/[^.]*.[0B]*//'` echo ia64-hp-hpux${HPUX_REV} exit 0 ;; 3050*:HI-UX:*:*) eval $set_cc_for_build sed 's/^ //' << EOF >$dummy.c #include int main () { long cpu = sysconf (_SC_CPU_VERSION); /* The order matters, because CPU_IS_HP_MC68K erroneously returns true for CPU_PA_RISC1_0. CPU_IS_PA_RISC returns correct results, however. */ if (CPU_IS_PA_RISC (cpu)) { switch (cpu) { case CPU_PA_RISC1_0: puts ("hppa1.0-hitachi-hiuxwe2"); break; case CPU_PA_RISC1_1: puts ("hppa1.1-hitachi-hiuxwe2"); break; case CPU_PA_RISC2_0: puts ("hppa2.0-hitachi-hiuxwe2"); break; default: puts ("hppa-hitachi-hiuxwe2"); break; } } else if (CPU_IS_HP_MC68K (cpu)) puts ("m68k-hitachi-hiuxwe2"); else puts ("unknown-hitachi-hiuxwe2"); exit (0); } EOF $CC_FOR_BUILD -o $dummy $dummy.c && $dummy && exit 0 echo unknown-hitachi-hiuxwe2 exit 0 ;; 9000/7??:4.3bsd:*:* | 9000/8?[79]:4.3bsd:*:* ) echo hppa1.1-hp-bsd exit 0 ;; 9000/8??:4.3bsd:*:*) echo hppa1.0-hp-bsd exit 0 ;; *9??*:MPE/iX:*:* | *3000*:MPE/iX:*:*) echo hppa1.0-hp-mpeix exit 0 ;; hp7??:OSF1:*:* | hp8?[79]:OSF1:*:* ) echo hppa1.1-hp-osf exit 0 ;; hp8??:OSF1:*:*) echo hppa1.0-hp-osf exit 0 ;; i*86:OSF1:*:*) if [ -x /usr/sbin/sysversion ] ; then echo ${UNAME_MACHINE}-unknown-osf1mk else echo ${UNAME_MACHINE}-unknown-osf1 fi exit 0 ;; parisc*:Lites*:*:*) echo hppa1.1-hp-lites exit 0 ;; C1*:ConvexOS:*:* | convex:ConvexOS:C1*:*) echo c1-convex-bsd exit 0 ;; C2*:ConvexOS:*:* | convex:ConvexOS:C2*:*) if getsysinfo -f scalar_acc then echo c32-convex-bsd else echo c2-convex-bsd fi exit 0 ;; C34*:ConvexOS:*:* | convex:ConvexOS:C34*:*) echo c34-convex-bsd exit 0 ;; C38*:ConvexOS:*:* | convex:ConvexOS:C38*:*) echo c38-convex-bsd exit 0 ;; C4*:ConvexOS:*:* | convex:ConvexOS:C4*:*) echo c4-convex-bsd exit 0 ;; CRAY*Y-MP:*:*:*) echo ymp-cray-unicos${UNAME_RELEASE} | sed -e 's/\.[^.]*$/.X/' exit 0 ;; CRAY*[A-Z]90:*:*:*) echo ${UNAME_MACHINE}-cray-unicos${UNAME_RELEASE} \ | sed -e 's/CRAY.*\([A-Z]90\)/\1/' \ -e y/ABCDEFGHIJKLMNOPQRSTUVWXYZ/abcdefghijklmnopqrstuvwxyz/ \ -e 's/\.[^.]*$/.X/' exit 0 ;; CRAY*TS:*:*:*) echo t90-cray-unicos${UNAME_RELEASE} | sed -e 's/\.[^.]*$/.X/' exit 0 ;; CRAY*T3E:*:*:*) echo alphaev5-cray-unicosmk${UNAME_RELEASE} | sed -e 's/\.[^.]*$/.X/' exit 0 ;; CRAY*SV1:*:*:*) echo sv1-cray-unicos${UNAME_RELEASE} | sed -e 's/\.[^.]*$/.X/' exit 0 ;; *:UNICOS/mp:*:*) echo nv1-cray-unicosmp${UNAME_RELEASE} | sed -e 's/\.[^.]*$/.X/' exit 0 ;; F30[01]:UNIX_System_V:*:* | F700:UNIX_System_V:*:*) FUJITSU_PROC=`uname -m | tr 'ABCDEFGHIJKLMNOPQRSTUVWXYZ' 'abcdefghijklmnopqrstuvwxyz'` FUJITSU_SYS=`uname -p | tr 'ABCDEFGHIJKLMNOPQRSTUVWXYZ' 'abcdefghijklmnopqrstuvwxyz' | sed -e 's/\///'` FUJITSU_REL=`echo ${UNAME_RELEASE} | sed -e 's/ /_/'` echo "${FUJITSU_PROC}-fujitsu-${FUJITSU_SYS}${FUJITSU_REL}" exit 0 ;; i*86:BSD/386:*:* | i*86:BSD/OS:*:* | *:Ascend\ Embedded/OS:*:*) echo ${UNAME_MACHINE}-pc-bsdi${UNAME_RELEASE} exit 0 ;; sparc*:BSD/OS:*:*) echo sparc-unknown-bsdi${UNAME_RELEASE} exit 0 ;; *:BSD/OS:*:*) echo ${UNAME_MACHINE}-unknown-bsdi${UNAME_RELEASE} exit 0 ;; *:FreeBSD:*:*|*:GNU/FreeBSD:*:*) # Determine whether the default compiler uses glibc. eval $set_cc_for_build sed 's/^ //' << EOF >$dummy.c #include #if __GLIBC__ >= 2 LIBC=gnu #else LIBC= #endif EOF eval `$CC_FOR_BUILD -E $dummy.c 2>/dev/null | grep ^LIBC=` # GNU/FreeBSD systems have a "k" prefix to indicate we are using # FreeBSD's kernel, but not the complete OS. case ${LIBC} in gnu) kernel_only='k' ;; esac echo ${UNAME_MACHINE}-unknown-${kernel_only}freebsd`echo ${UNAME_RELEASE}|sed -e 's/[-(].*//'`${LIBC:+-$LIBC} exit 0 ;; i*:CYGWIN*:*) echo ${UNAME_MACHINE}-pc-cygwin exit 0 ;; i*:MINGW*:*) echo ${UNAME_MACHINE}-pc-mingw32 exit 0 ;; i*:PW*:*) echo ${UNAME_MACHINE}-pc-pw32 exit 0 ;; x86:Interix*:[34]*) echo i586-pc-interix${UNAME_RELEASE}|sed -e 's/\..*//' exit 0 ;; [345]86:Windows_95:* | [345]86:Windows_98:* | [345]86:Windows_NT:*) echo i${UNAME_MACHINE}-pc-mks exit 0 ;; i*:Windows_NT*:* | Pentium*:Windows_NT*:*) # How do we know it's Interix rather than the generic POSIX subsystem? # It also conflicts with pre-2.0 versions of AT&T UWIN. Should we # UNAME_MACHINE based on the output of uname instead of i386? echo i586-pc-interix exit 0 ;; i*:UWIN*:*) echo ${UNAME_MACHINE}-pc-uwin exit 0 ;; p*:CYGWIN*:*) echo powerpcle-unknown-cygwin exit 0 ;; prep*:SunOS:5.*:*) echo powerpcle-unknown-solaris2`echo ${UNAME_RELEASE}|sed -e 's/[^.]*//'` exit 0 ;; *:GNU:*:*) echo `echo ${UNAME_MACHINE}|sed -e 's,[-/].*$,,'`-unknown-gnu`echo ${UNAME_RELEASE}|sed -e 's,/.*$,,'` exit 0 ;; i*86:Minix:*:*) echo ${UNAME_MACHINE}-pc-minix exit 0 ;; arm*:Linux:*:*) echo ${UNAME_MACHINE}-unknown-linux-gnu exit 0 ;; cris:Linux:*:*) echo cris-axis-linux-gnu exit 0 ;; ia64:Linux:*:*) echo ${UNAME_MACHINE}-unknown-linux-gnu exit 0 ;; m68*:Linux:*:*) echo ${UNAME_MACHINE}-unknown-linux-gnu exit 0 ;; mips:Linux:*:*) eval $set_cc_for_build sed 's/^ //' << EOF >$dummy.c #undef CPU #undef mips #undef mipsel #if defined(__MIPSEL__) || defined(__MIPSEL) || defined(_MIPSEL) || defined(MIPSEL) CPU=mipsel #else #if defined(__MIPSEB__) || defined(__MIPSEB) || defined(_MIPSEB) || defined(MIPSEB) CPU=mips #else CPU= #endif #endif EOF eval `$CC_FOR_BUILD -E $dummy.c 2>/dev/null | grep ^CPU=` test x"${CPU}" != x && echo "${CPU}-unknown-linux-gnu" && exit 0 ;; mips64:Linux:*:*) eval $set_cc_for_build sed 's/^ //' << EOF >$dummy.c #undef CPU #undef mips64 #undef mips64el #if defined(__MIPSEL__) || defined(__MIPSEL) || defined(_MIPSEL) || defined(MIPSEL) CPU=mips64el #else #if defined(__MIPSEB__) || defined(__MIPSEB) || defined(_MIPSEB) || defined(MIPSEB) CPU=mips64 #else CPU= #endif #endif EOF eval `$CC_FOR_BUILD -E $dummy.c 2>/dev/null | grep ^CPU=` test x"${CPU}" != x && echo "${CPU}-unknown-linux-gnu" && exit 0 ;; ppc:Linux:*:*) echo powerpc-unknown-linux-gnu exit 0 ;; ppc64:Linux:*:*) echo powerpc64-unknown-linux-gnu exit 0 ;; alpha:Linux:*:*) case `sed -n '/^cpu model/s/^.*: \(.*\)/\1/p' < /proc/cpuinfo` in EV5) UNAME_MACHINE=alphaev5 ;; EV56) UNAME_MACHINE=alphaev56 ;; PCA56) UNAME_MACHINE=alphapca56 ;; PCA57) UNAME_MACHINE=alphapca56 ;; EV6) UNAME_MACHINE=alphaev6 ;; EV67) UNAME_MACHINE=alphaev67 ;; EV68*) UNAME_MACHINE=alphaev68 ;; esac objdump --private-headers /bin/sh | grep ld.so.1 >/dev/null if test "$?" = 0 ; then LIBC="libc1" ; else LIBC="" ; fi echo ${UNAME_MACHINE}-unknown-linux-gnu${LIBC} exit 0 ;; parisc:Linux:*:* | hppa:Linux:*:*) # Look for CPU level case `grep '^cpu[^a-z]*:' /proc/cpuinfo 2>/dev/null | cut -d' ' -f2` in PA7*) echo hppa1.1-unknown-linux-gnu ;; PA8*) echo hppa2.0-unknown-linux-gnu ;; *) echo hppa-unknown-linux-gnu ;; esac exit 0 ;; parisc64:Linux:*:* | hppa64:Linux:*:*) echo hppa64-unknown-linux-gnu exit 0 ;; s390:Linux:*:* | s390x:Linux:*:*) echo ${UNAME_MACHINE}-ibm-linux exit 0 ;; sh64*:Linux:*:*) echo ${UNAME_MACHINE}-unknown-linux-gnu exit 0 ;; sh*:Linux:*:*) echo ${UNAME_MACHINE}-unknown-linux-gnu exit 0 ;; sparc:Linux:*:* | sparc64:Linux:*:*) echo ${UNAME_MACHINE}-unknown-linux-gnu exit 0 ;; x86_64:Linux:*:*) echo x86_64-unknown-linux-gnu exit 0 ;; i*86:Linux:*:*) # The BFD linker knows what the default object file format is, so # first see if it will tell us. cd to the root directory to prevent # problems with other programs or directories called `ld' in the path. # Set LC_ALL=C to ensure ld outputs messages in English. ld_supported_targets=`cd /; LC_ALL=C ld --help 2>&1 \ | sed -ne '/supported targets:/!d s/[ ][ ]*/ /g s/.*supported targets: *// s/ .*// p'` case "$ld_supported_targets" in elf32-i386) TENTATIVE="${UNAME_MACHINE}-pc-linux-gnu" ;; a.out-i386-linux) echo "${UNAME_MACHINE}-pc-linux-gnuaout" exit 0 ;; coff-i386) echo "${UNAME_MACHINE}-pc-linux-gnucoff" exit 0 ;; "") # Either a pre-BFD a.out linker (linux-gnuoldld) or # one that does not give us useful --help. echo "${UNAME_MACHINE}-pc-linux-gnuoldld" exit 0 ;; esac # Determine whether the default compiler is a.out or elf eval $set_cc_for_build sed 's/^ //' << EOF >$dummy.c #include #ifdef __ELF__ # ifdef __GLIBC__ # if __GLIBC__ >= 2 LIBC=gnu # else LIBC=gnulibc1 # endif # else LIBC=gnulibc1 # endif #else #ifdef __INTEL_COMPILER LIBC=gnu #else LIBC=gnuaout #endif #endif EOF eval `$CC_FOR_BUILD -E $dummy.c 2>/dev/null | grep ^LIBC=` test x"${LIBC}" != x && echo "${UNAME_MACHINE}-pc-linux-${LIBC}" && exit 0 test x"${TENTATIVE}" != x && echo "${TENTATIVE}" && exit 0 ;; i*86:DYNIX/ptx:4*:*) # ptx 4.0 does uname -s correctly, with DYNIX/ptx in there. # earlier versions are messed up and put the nodename in both # sysname and nodename. echo i386-sequent-sysv4 exit 0 ;; i*86:UNIX_SV:4.2MP:2.*) # Unixware is an offshoot of SVR4, but it has its own version # number series starting with 2... # I am not positive that other SVR4 systems won't match this, # I just have to hope. -- rms. # Use sysv4.2uw... so that sysv4* matches it. echo ${UNAME_MACHINE}-pc-sysv4.2uw${UNAME_VERSION} exit 0 ;; i*86:OS/2:*:*) # If we were able to find `uname', then EMX Unix compatibility # is probably installed. echo ${UNAME_MACHINE}-pc-os2-emx exit 0 ;; i*86:XTS-300:*:STOP) echo ${UNAME_MACHINE}-unknown-stop exit 0 ;; i*86:atheos:*:*) echo ${UNAME_MACHINE}-unknown-atheos exit 0 ;; i*86:LynxOS:2.*:* | i*86:LynxOS:3.[01]*:* | i*86:LynxOS:4.0*:*) echo i386-unknown-lynxos${UNAME_RELEASE} exit 0 ;; i*86:*DOS:*:*) echo ${UNAME_MACHINE}-pc-msdosdjgpp exit 0 ;; i*86:*:4.*:* | i*86:SYSTEM_V:4.*:*) UNAME_REL=`echo ${UNAME_RELEASE} | sed 's/\/MP$//'` if grep Novell /usr/include/link.h >/dev/null 2>/dev/null; then echo ${UNAME_MACHINE}-univel-sysv${UNAME_REL} else echo ${UNAME_MACHINE}-pc-sysv${UNAME_REL} fi exit 0 ;; i*86:*:5:[78]*) case `/bin/uname -X | grep "^Machine"` in *486*) UNAME_MACHINE=i486 ;; *Pentium) UNAME_MACHINE=i586 ;; *Pent*|*Celeron) UNAME_MACHINE=i686 ;; esac echo ${UNAME_MACHINE}-unknown-sysv${UNAME_RELEASE}${UNAME_SYSTEM}${UNAME_VERSION} exit 0 ;; i*86:*:3.2:*) if test -f /usr/options/cb.name; then UNAME_REL=`sed -n 's/.*Version //p' /dev/null >/dev/null ; then UNAME_REL=`(/bin/uname -X|grep Release|sed -e 's/.*= //')` (/bin/uname -X|grep i80486 >/dev/null) && UNAME_MACHINE=i486 (/bin/uname -X|grep '^Machine.*Pentium' >/dev/null) \ && UNAME_MACHINE=i586 (/bin/uname -X|grep '^Machine.*Pent *II' >/dev/null) \ && UNAME_MACHINE=i686 (/bin/uname -X|grep '^Machine.*Pentium Pro' >/dev/null) \ && UNAME_MACHINE=i686 echo ${UNAME_MACHINE}-pc-sco$UNAME_REL else echo ${UNAME_MACHINE}-pc-sysv32 fi exit 0 ;; pc:*:*:*) # Left here for compatibility: # uname -m prints for DJGPP always 'pc', but it prints nothing about # the processor, so we play safe by assuming i386. echo i386-pc-msdosdjgpp exit 0 ;; Intel:Mach:3*:*) echo i386-pc-mach3 exit 0 ;; paragon:*:*:*) echo i860-intel-osf1 exit 0 ;; i860:*:4.*:*) # i860-SVR4 if grep Stardent /usr/include/sys/uadmin.h >/dev/null 2>&1 ; then echo i860-stardent-sysv${UNAME_RELEASE} # Stardent Vistra i860-SVR4 else # Add other i860-SVR4 vendors below as they are discovered. echo i860-unknown-sysv${UNAME_RELEASE} # Unknown i860-SVR4 fi exit 0 ;; mini*:CTIX:SYS*5:*) # "miniframe" echo m68010-convergent-sysv exit 0 ;; mc68k:UNIX:SYSTEM5:3.51m) echo m68k-convergent-sysv exit 0 ;; M680?0:D-NIX:5.3:*) echo m68k-diab-dnix exit 0 ;; M68*:*:R3V[567]*:*) test -r /sysV68 && echo 'm68k-motorola-sysv' && exit 0 ;; 3[34]??:*:4.0:3.0 | 3[34]??A:*:4.0:3.0 | 3[34]??,*:*:4.0:3.0 | 3[34]??/*:*:4.0:3.0 | 4400:*:4.0:3.0 | 4850:*:4.0:3.0 | SKA40:*:4.0:3.0 | SDS2:*:4.0:3.0 | SHG2:*:4.0:3.0) OS_REL='' test -r /etc/.relid \ && OS_REL=.`sed -n 's/[^ ]* [^ ]* \([0-9][0-9]\).*/\1/p' < /etc/.relid` /bin/uname -p 2>/dev/null | grep 86 >/dev/null \ && echo i486-ncr-sysv4.3${OS_REL} && exit 0 /bin/uname -p 2>/dev/null | /bin/grep entium >/dev/null \ && echo i586-ncr-sysv4.3${OS_REL} && exit 0 ;; 3[34]??:*:4.0:* | 3[34]??,*:*:4.0:*) /bin/uname -p 2>/dev/null | grep 86 >/dev/null \ && echo i486-ncr-sysv4 && exit 0 ;; m68*:LynxOS:2.*:* | m68*:LynxOS:3.0*:*) echo m68k-unknown-lynxos${UNAME_RELEASE} exit 0 ;; mc68030:UNIX_System_V:4.*:*) echo m68k-atari-sysv4 exit 0 ;; TSUNAMI:LynxOS:2.*:*) echo sparc-unknown-lynxos${UNAME_RELEASE} exit 0 ;; rs6000:LynxOS:2.*:*) echo rs6000-unknown-lynxos${UNAME_RELEASE} exit 0 ;; PowerPC:LynxOS:2.*:* | PowerPC:LynxOS:3.[01]*:* | PowerPC:LynxOS:4.0*:*) echo powerpc-unknown-lynxos${UNAME_RELEASE} exit 0 ;; SM[BE]S:UNIX_SV:*:*) echo mips-dde-sysv${UNAME_RELEASE} exit 0 ;; RM*:ReliantUNIX-*:*:*) echo mips-sni-sysv4 exit 0 ;; RM*:SINIX-*:*:*) echo mips-sni-sysv4 exit 0 ;; *:SINIX-*:*:*) if uname -p 2>/dev/null >/dev/null ; then UNAME_MACHINE=`(uname -p) 2>/dev/null` echo ${UNAME_MACHINE}-sni-sysv4 else echo ns32k-sni-sysv fi exit 0 ;; PENTIUM:*:4.0*:*) # Unisys `ClearPath HMP IX 4000' SVR4/MP effort # says echo i586-unisys-sysv4 exit 0 ;; *:UNIX_System_V:4*:FTX*) # From Gerald Hewes . # How about differentiating between stratus architectures? -djm echo hppa1.1-stratus-sysv4 exit 0 ;; *:*:*:FTX*) # From seanf@swdc.stratus.com. echo i860-stratus-sysv4 exit 0 ;; *:VOS:*:*) # From Paul.Green@stratus.com. echo hppa1.1-stratus-vos exit 0 ;; mc68*:A/UX:*:*) echo m68k-apple-aux${UNAME_RELEASE} exit 0 ;; news*:NEWS-OS:6*:*) echo mips-sony-newsos6 exit 0 ;; R[34]000:*System_V*:*:* | R4000:UNIX_SYSV:*:* | R*000:UNIX_SV:*:*) if [ -d /usr/nec ]; then echo mips-nec-sysv${UNAME_RELEASE} else echo mips-unknown-sysv${UNAME_RELEASE} fi exit 0 ;; BeBox:BeOS:*:*) # BeOS running on hardware made by Be, PPC only. echo powerpc-be-beos exit 0 ;; BeMac:BeOS:*:*) # BeOS running on Mac or Mac clone, PPC only. echo powerpc-apple-beos exit 0 ;; BePC:BeOS:*:*) # BeOS running on Intel PC compatible. echo i586-pc-beos exit 0 ;; SX-4:SUPER-UX:*:*) echo sx4-nec-superux${UNAME_RELEASE} exit 0 ;; SX-5:SUPER-UX:*:*) echo sx5-nec-superux${UNAME_RELEASE} exit 0 ;; SX-6:SUPER-UX:*:*) echo sx6-nec-superux${UNAME_RELEASE} exit 0 ;; Power*:Rhapsody:*:*) echo powerpc-apple-rhapsody${UNAME_RELEASE} exit 0 ;; *:Rhapsody:*:*) echo ${UNAME_MACHINE}-apple-rhapsody${UNAME_RELEASE} exit 0 ;; *:Darwin:*:*) case `uname -p` in *86) UNAME_PROCESSOR=i686 ;; powerpc) UNAME_PROCESSOR=powerpc ;; esac echo ${UNAME_PROCESSOR}-apple-darwin${UNAME_RELEASE} exit 0 ;; *:procnto*:*:* | *:QNX:[0123456789]*:*) UNAME_PROCESSOR=`uname -p` if test "$UNAME_PROCESSOR" = "x86"; then UNAME_PROCESSOR=i386 UNAME_MACHINE=pc fi echo ${UNAME_PROCESSOR}-${UNAME_MACHINE}-nto-qnx${UNAME_RELEASE} exit 0 ;; *:QNX:*:4*) echo i386-pc-qnx exit 0 ;; NSR-[DGKLNPTVW]:NONSTOP_KERNEL:*:*) echo nsr-tandem-nsk${UNAME_RELEASE} exit 0 ;; *:NonStop-UX:*:*) echo mips-compaq-nonstopux exit 0 ;; BS2000:POSIX*:*:*) echo bs2000-siemens-sysv exit 0 ;; DS/*:UNIX_System_V:*:*) echo ${UNAME_MACHINE}-${UNAME_SYSTEM}-${UNAME_RELEASE} exit 0 ;; *:Plan9:*:*) # "uname -m" is not consistent, so use $cputype instead. 386 # is converted to i386 for consistency with other x86 # operating systems. if test "$cputype" = "386"; then UNAME_MACHINE=i386 else UNAME_MACHINE="$cputype" fi echo ${UNAME_MACHINE}-unknown-plan9 exit 0 ;; *:TOPS-10:*:*) echo pdp10-unknown-tops10 exit 0 ;; *:TENEX:*:*) echo pdp10-unknown-tenex exit 0 ;; KS10:TOPS-20:*:* | KL10:TOPS-20:*:* | TYPE4:TOPS-20:*:*) echo pdp10-dec-tops20 exit 0 ;; XKL-1:TOPS-20:*:* | TYPE5:TOPS-20:*:*) echo pdp10-xkl-tops20 exit 0 ;; *:TOPS-20:*:*) echo pdp10-unknown-tops20 exit 0 ;; *:ITS:*:*) echo pdp10-unknown-its exit 0 ;; SEI:*:*:SEIUX) echo mips-sei-seiux${UNAME_RELEASE} exit 0 ;; esac #echo '(No uname command or uname output not recognized.)' 1>&2 #echo "${UNAME_MACHINE}:${UNAME_SYSTEM}:${UNAME_RELEASE}:${UNAME_VERSION}" 1>&2 eval $set_cc_for_build cat >$dummy.c < # include #endif main () { #if defined (sony) #if defined (MIPSEB) /* BFD wants "bsd" instead of "newsos". Perhaps BFD should be changed, I don't know.... */ printf ("mips-sony-bsd\n"); exit (0); #else #include printf ("m68k-sony-newsos%s\n", #ifdef NEWSOS4 "4" #else "" #endif ); exit (0); #endif #endif #if defined (__arm) && defined (__acorn) && defined (__unix) printf ("arm-acorn-riscix"); exit (0); #endif #if defined (hp300) && !defined (hpux) printf ("m68k-hp-bsd\n"); exit (0); #endif #if defined (NeXT) #if !defined (__ARCHITECTURE__) #define __ARCHITECTURE__ "m68k" #endif int version; version=`(hostinfo | sed -n 's/.*NeXT Mach \([0-9]*\).*/\1/p') 2>/dev/null`; if (version < 4) printf ("%s-next-nextstep%d\n", __ARCHITECTURE__, version); else printf ("%s-next-openstep%d\n", __ARCHITECTURE__, version); exit (0); #endif #if defined (MULTIMAX) || defined (n16) #if defined (UMAXV) printf ("ns32k-encore-sysv\n"); exit (0); #else #if defined (CMU) printf ("ns32k-encore-mach\n"); exit (0); #else printf ("ns32k-encore-bsd\n"); exit (0); #endif #endif #endif #if defined (__386BSD__) printf ("i386-pc-bsd\n"); exit (0); #endif #if defined (sequent) #if defined (i386) printf ("i386-sequent-dynix\n"); exit (0); #endif #if defined (ns32000) printf ("ns32k-sequent-dynix\n"); exit (0); #endif #endif #if defined (_SEQUENT_) struct utsname un; uname(&un); if (strncmp(un.version, "V2", 2) == 0) { printf ("i386-sequent-ptx2\n"); exit (0); } if (strncmp(un.version, "V1", 2) == 0) { /* XXX is V1 correct? */ printf ("i386-sequent-ptx1\n"); exit (0); } printf ("i386-sequent-ptx\n"); exit (0); #endif #if defined (vax) # if !defined (ultrix) # include # if defined (BSD) # if BSD == 43 printf ("vax-dec-bsd4.3\n"); exit (0); # else # if BSD == 199006 printf ("vax-dec-bsd4.3reno\n"); exit (0); # else printf ("vax-dec-bsd\n"); exit (0); # endif # endif # else printf ("vax-dec-bsd\n"); exit (0); # endif # else printf ("vax-dec-ultrix\n"); exit (0); # endif #endif #if defined (alliant) && defined (i860) printf ("i860-alliant-bsd\n"); exit (0); #endif exit (1); } EOF $CC_FOR_BUILD -o $dummy $dummy.c 2>/dev/null && $dummy && exit 0 # Apollos put the system type in the environment. test -d /usr/apollo && { echo ${ISP}-apollo-${SYSTYPE}; exit 0; } # Convex versions that predate uname can use getsysinfo(1) if [ -x /usr/convex/getsysinfo ] then case `getsysinfo -f cpu_type` in c1*) echo c1-convex-bsd exit 0 ;; c2*) if getsysinfo -f scalar_acc then echo c32-convex-bsd else echo c2-convex-bsd fi exit 0 ;; c34*) echo c34-convex-bsd exit 0 ;; c38*) echo c38-convex-bsd exit 0 ;; c4*) echo c4-convex-bsd exit 0 ;; esac fi cat >&2 < in order to provide the needed information to handle your system. config.guess timestamp = $timestamp uname -m = `(uname -m) 2>/dev/null || echo unknown` uname -r = `(uname -r) 2>/dev/null || echo unknown` uname -s = `(uname -s) 2>/dev/null || echo unknown` uname -v = `(uname -v) 2>/dev/null || echo unknown` /usr/bin/uname -p = `(/usr/bin/uname -p) 2>/dev/null` /bin/uname -X = `(/bin/uname -X) 2>/dev/null` hostinfo = `(hostinfo) 2>/dev/null` /bin/universe = `(/bin/universe) 2>/dev/null` /usr/bin/arch -k = `(/usr/bin/arch -k) 2>/dev/null` /bin/arch = `(/bin/arch) 2>/dev/null` /usr/bin/oslevel = `(/usr/bin/oslevel) 2>/dev/null` /usr/convex/getsysinfo = `(/usr/convex/getsysinfo) 2>/dev/null` UNAME_MACHINE = ${UNAME_MACHINE} UNAME_RELEASE = ${UNAME_RELEASE} UNAME_SYSTEM = ${UNAME_SYSTEM} UNAME_VERSION = ${UNAME_VERSION} EOF exit 1 # Local variables: # eval: (add-hook 'write-file-hooks 'time-stamp) # time-stamp-start: "timestamp='" # time-stamp-format: "%:y-%02m-%02d" # time-stamp-end: "'" # End: libtranslate-0.99/config.sub000555 001750 001750 00000073153 10145502334 017664 0ustar00jylefortjylefort000000 000000 #! /bin/sh # Configuration validation subroutine script. # Copyright (C) 1992, 1993, 1994, 1995, 1996, 1997, 1998, 1999, # 2000, 2001, 2002, 2003 Free Software Foundation, Inc. timestamp='2003-07-04' # This file is (in principle) common to ALL GNU software. # The presence of a machine in this file suggests that SOME GNU software # can handle that machine. It does not imply ALL GNU software can. # # This file is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2 of the License, or # (at your option) any later version. # # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 59 Temple Place - Suite 330, # Boston, MA 02111-1307, USA. # As a special exception to the GNU General Public License, if you # distribute this file as part of a program that contains a # configuration script generated by Autoconf, you may include it under # the same distribution terms that you use for the rest of that program. # Please send patches to . Submit a context # diff and a properly formatted ChangeLog entry. # # Configuration subroutine to validate and canonicalize a configuration type. # Supply the specified configuration type as an argument. # If it is invalid, we print an error message on stderr and exit with code 1. # Otherwise, we print the canonical config type on stdout and succeed. # This file is supposed to be the same for all GNU packages # and recognize all the CPU types, system types and aliases # that are meaningful with *any* GNU software. # Each package is responsible for reporting which valid configurations # it does not support. The user should be able to distinguish # a failure to support a valid configuration from a meaningless # configuration. # The goal of this file is to map all the various variations of a given # machine specification into a single specification in the form: # CPU_TYPE-MANUFACTURER-OPERATING_SYSTEM # or in some cases, the newer four-part form: # CPU_TYPE-MANUFACTURER-KERNEL-OPERATING_SYSTEM # It is wrong to echo any other type of specification. me=`echo "$0" | sed -e 's,.*/,,'` usage="\ Usage: $0 [OPTION] CPU-MFR-OPSYS $0 [OPTION] ALIAS Canonicalize a configuration name. Operation modes: -h, --help print this help, then exit -t, --time-stamp print date of last modification, then exit -v, --version print version number, then exit Report bugs and patches to ." version="\ GNU config.sub ($timestamp) Copyright (C) 1992, 1993, 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001 Free Software Foundation, Inc. This is free software; see the source for copying conditions. There is NO warranty; not even for MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE." help=" Try \`$me --help' for more information." # Parse command line while test $# -gt 0 ; do case $1 in --time-stamp | --time* | -t ) echo "$timestamp" ; exit 0 ;; --version | -v ) echo "$version" ; exit 0 ;; --help | --h* | -h ) echo "$usage"; exit 0 ;; -- ) # Stop option processing shift; break ;; - ) # Use stdin as input. break ;; -* ) echo "$me: invalid option $1$help" exit 1 ;; *local*) # First pass through any local machine types. echo $1 exit 0;; * ) break ;; esac done case $# in 0) echo "$me: missing argument$help" >&2 exit 1;; 1) ;; *) echo "$me: too many arguments$help" >&2 exit 1;; esac # Separate what the user gave into CPU-COMPANY and OS or KERNEL-OS (if any). # Here we must recognize all the valid KERNEL-OS combinations. maybe_os=`echo $1 | sed 's/^\(.*\)-\([^-]*-[^-]*\)$/\2/'` case $maybe_os in nto-qnx* | linux-gnu* | kfreebsd*-gnu* | netbsd*-gnu* | storm-chaos* | os2-emx* | rtmk-nova*) os=-$maybe_os basic_machine=`echo $1 | sed 's/^\(.*\)-\([^-]*-[^-]*\)$/\1/'` ;; *) basic_machine=`echo $1 | sed 's/-[^-]*$//'` if [ $basic_machine != $1 ] then os=`echo $1 | sed 's/.*-/-/'` else os=; fi ;; esac ### Let's recognize common machines as not being operating systems so ### that things like config.sub decstation-3100 work. We also ### recognize some manufacturers as not being operating systems, so we ### can provide default operating systems below. case $os in -sun*os*) # Prevent following clause from handling this invalid input. ;; -dec* | -mips* | -sequent* | -encore* | -pc532* | -sgi* | -sony* | \ -att* | -7300* | -3300* | -delta* | -motorola* | -sun[234]* | \ -unicom* | -ibm* | -next | -hp | -isi* | -apollo | -altos* | \ -convergent* | -ncr* | -news | -32* | -3600* | -3100* | -hitachi* |\ -c[123]* | -convex* | -sun | -crds | -omron* | -dg | -ultra | -tti* | \ -harris | -dolphin | -highlevel | -gould | -cbm | -ns | -masscomp | \ -apple | -axis) os= basic_machine=$1 ;; -sim | -cisco | -oki | -wec | -winbond) os= basic_machine=$1 ;; -scout) ;; -wrs) os=-vxworks basic_machine=$1 ;; -chorusos*) os=-chorusos basic_machine=$1 ;; -chorusrdb) os=-chorusrdb basic_machine=$1 ;; -hiux*) os=-hiuxwe2 ;; -sco5) os=-sco3.2v5 basic_machine=`echo $1 | sed -e 's/86-.*/86-pc/'` ;; -sco4) os=-sco3.2v4 basic_machine=`echo $1 | sed -e 's/86-.*/86-pc/'` ;; -sco3.2.[4-9]*) os=`echo $os | sed -e 's/sco3.2./sco3.2v/'` basic_machine=`echo $1 | sed -e 's/86-.*/86-pc/'` ;; -sco3.2v[4-9]*) # Don't forget version if it is 3.2v4 or newer. basic_machine=`echo $1 | sed -e 's/86-.*/86-pc/'` ;; -sco*) os=-sco3.2v2 basic_machine=`echo $1 | sed -e 's/86-.*/86-pc/'` ;; -udk*) basic_machine=`echo $1 | sed -e 's/86-.*/86-pc/'` ;; -isc) os=-isc2.2 basic_machine=`echo $1 | sed -e 's/86-.*/86-pc/'` ;; -clix*) basic_machine=clipper-intergraph ;; -isc*) basic_machine=`echo $1 | sed -e 's/86-.*/86-pc/'` ;; -lynx*) os=-lynxos ;; -ptx*) basic_machine=`echo $1 | sed -e 's/86-.*/86-sequent/'` ;; -windowsnt*) os=`echo $os | sed -e 's/windowsnt/winnt/'` ;; -psos*) os=-psos ;; -mint | -mint[0-9]*) basic_machine=m68k-atari os=-mint ;; esac # Decode aliases for certain CPU-COMPANY combinations. case $basic_machine in # Recognize the basic CPU types without company name. # Some are omitted here because they have special meanings below. 1750a | 580 \ | a29k \ | alpha | alphaev[4-8] | alphaev56 | alphaev6[78] | alphapca5[67] \ | alpha64 | alpha64ev[4-8] | alpha64ev56 | alpha64ev6[78] | alpha64pca5[67] \ | arc | arm | arm[bl]e | arme[lb] | armv[2345] | armv[345][lb] | avr \ | c4x | clipper \ | d10v | d30v | dlx | dsp16xx \ | fr30 | frv \ | h8300 | h8500 | hppa | hppa1.[01] | hppa2.0 | hppa2.0[nw] | hppa64 \ | i370 | i860 | i960 | ia64 \ | ip2k \ | m32r | m68000 | m68k | m88k | mcore \ | mips | mipsbe | mipseb | mipsel | mipsle \ | mips16 \ | mips64 | mips64el \ | mips64vr | mips64vrel \ | mips64orion | mips64orionel \ | mips64vr4100 | mips64vr4100el \ | mips64vr4300 | mips64vr4300el \ | mips64vr5000 | mips64vr5000el \ | mipsisa32 | mipsisa32el \ | mipsisa32r2 | mipsisa32r2el \ | mipsisa64 | mipsisa64el \ | mipsisa64sb1 | mipsisa64sb1el \ | mipsisa64sr71k | mipsisa64sr71kel \ | mipstx39 | mipstx39el \ | mn10200 | mn10300 \ | msp430 \ | ns16k | ns32k \ | openrisc | or32 \ | pdp10 | pdp11 | pj | pjl \ | powerpc | powerpc64 | powerpc64le | powerpcle | ppcbe \ | pyramid \ | sh | sh[1234] | sh[23]e | sh[34]eb | shbe | shle | sh[1234]le | sh3ele \ | sh64 | sh64le \ | sparc | sparc64 | sparc86x | sparclet | sparclite | sparcv9 | sparcv9b \ | strongarm \ | tahoe | thumb | tic4x | tic80 | tron \ | v850 | v850e \ | we32k \ | x86 | xscale | xstormy16 | xtensa \ | z8k) basic_machine=$basic_machine-unknown ;; m6811 | m68hc11 | m6812 | m68hc12) # Motorola 68HC11/12. basic_machine=$basic_machine-unknown os=-none ;; m88110 | m680[12346]0 | m683?2 | m68360 | m5200 | v70 | w65 | z8k) ;; # We use `pc' rather than `unknown' # because (1) that's what they normally are, and # (2) the word "unknown" tends to confuse beginning users. i*86 | x86_64) basic_machine=$basic_machine-pc ;; # Object if more than one company name word. *-*-*) echo Invalid configuration \`$1\': machine \`$basic_machine\' not recognized 1>&2 exit 1 ;; # Recognize the basic CPU types with company name. 580-* \ | a29k-* \ | alpha-* | alphaev[4-8]-* | alphaev56-* | alphaev6[78]-* \ | alpha64-* | alpha64ev[4-8]-* | alpha64ev56-* | alpha64ev6[78]-* \ | alphapca5[67]-* | alpha64pca5[67]-* | amd64-* | arc-* \ | arm-* | armbe-* | armle-* | armeb-* | armv*-* \ | avr-* \ | bs2000-* \ | c[123]* | c30-* | [cjt]90-* | c4x-* | c54x-* | c55x-* | c6x-* \ | clipper-* | cydra-* \ | d10v-* | d30v-* | dlx-* \ | elxsi-* \ | f30[01]-* | f700-* | fr30-* | frv-* | fx80-* \ | h8300-* | h8500-* \ | hppa-* | hppa1.[01]-* | hppa2.0-* | hppa2.0[nw]-* | hppa64-* \ | i*86-* | i860-* | i960-* | ia64-* \ | ip2k-* \ | m32r-* \ | m68000-* | m680[012346]0-* | m68360-* | m683?2-* | m68k-* \ | m88110-* | m88k-* | mcore-* \ | mips-* | mipsbe-* | mipseb-* | mipsel-* | mipsle-* \ | mips16-* \ | mips64-* | mips64el-* \ | mips64vr-* | mips64vrel-* \ | mips64orion-* | mips64orionel-* \ | mips64vr4100-* | mips64vr4100el-* \ | mips64vr4300-* | mips64vr4300el-* \ | mips64vr5000-* | mips64vr5000el-* \ | mipsisa32-* | mipsisa32el-* \ | mipsisa32r2-* | mipsisa32r2el-* \ | mipsisa64-* | mipsisa64el-* \ | mipsisa64sb1-* | mipsisa64sb1el-* \ | mipsisa64sr71k-* | mipsisa64sr71kel-* \ | mipstx39-* | mipstx39el-* \ | msp430-* \ | none-* | np1-* | nv1-* | ns16k-* | ns32k-* \ | orion-* \ | pdp10-* | pdp11-* | pj-* | pjl-* | pn-* | power-* \ | powerpc-* | powerpc64-* | powerpc64le-* | powerpcle-* | ppcbe-* \ | pyramid-* \ | romp-* | rs6000-* \ | sh-* | sh[1234]-* | sh[23]e-* | sh[34]eb-* | shbe-* \ | shle-* | sh[1234]le-* | sh3ele-* | sh64-* | sh64le-* \ | sparc-* | sparc64-* | sparc86x-* | sparclet-* | sparclite-* \ | sparcv9-* | sparcv9b-* | strongarm-* | sv1-* | sx?-* \ | tahoe-* | thumb-* \ | tic30-* | tic4x-* | tic54x-* | tic55x-* | tic6x-* | tic80-* \ | tron-* \ | v850-* | v850e-* | vax-* \ | we32k-* \ | x86-* | x86_64-* | xps100-* | xscale-* | xstormy16-* \ | xtensa-* \ | ymp-* \ | z8k-*) ;; # Recognize the various machine names and aliases which stand # for a CPU type and a company and sometimes even an OS. 386bsd) basic_machine=i386-unknown os=-bsd ;; 3b1 | 7300 | 7300-att | att-7300 | pc7300 | safari | unixpc) basic_machine=m68000-att ;; 3b*) basic_machine=we32k-att ;; a29khif) basic_machine=a29k-amd os=-udi ;; adobe68k) basic_machine=m68010-adobe os=-scout ;; alliant | fx80) basic_machine=fx80-alliant ;; altos | altos3068) basic_machine=m68k-altos ;; am29k) basic_machine=a29k-none os=-bsd ;; amd64) basic_machine=x86_64-pc ;; amdahl) basic_machine=580-amdahl os=-sysv ;; amiga | amiga-*) basic_machine=m68k-unknown ;; amigaos | amigados) basic_machine=m68k-unknown os=-amigaos ;; amigaunix | amix) basic_machine=m68k-unknown os=-sysv4 ;; apollo68) basic_machine=m68k-apollo os=-sysv ;; apollo68bsd) basic_machine=m68k-apollo os=-bsd ;; aux) basic_machine=m68k-apple os=-aux ;; balance) basic_machine=ns32k-sequent os=-dynix ;; c90) basic_machine=c90-cray os=-unicos ;; convex-c1) basic_machine=c1-convex os=-bsd ;; convex-c2) basic_machine=c2-convex os=-bsd ;; convex-c32) basic_machine=c32-convex os=-bsd ;; convex-c34) basic_machine=c34-convex os=-bsd ;; convex-c38) basic_machine=c38-convex os=-bsd ;; cray | j90) basic_machine=j90-cray os=-unicos ;; crds | unos) basic_machine=m68k-crds ;; cris | cris-* | etrax*) basic_machine=cris-axis ;; da30 | da30-*) basic_machine=m68k-da30 ;; decstation | decstation-3100 | pmax | pmax-* | pmin | dec3100 | decstatn) basic_machine=mips-dec ;; decsystem10* | dec10*) basic_machine=pdp10-dec os=-tops10 ;; decsystem20* | dec20*) basic_machine=pdp10-dec os=-tops20 ;; delta | 3300 | motorola-3300 | motorola-delta \ | 3300-motorola | delta-motorola) basic_machine=m68k-motorola ;; delta88) basic_machine=m88k-motorola os=-sysv3 ;; dpx20 | dpx20-*) basic_machine=rs6000-bull os=-bosx ;; dpx2* | dpx2*-bull) basic_machine=m68k-bull os=-sysv3 ;; ebmon29k) basic_machine=a29k-amd os=-ebmon ;; elxsi) basic_machine=elxsi-elxsi os=-bsd ;; encore | umax | mmax) basic_machine=ns32k-encore ;; es1800 | OSE68k | ose68k | ose | OSE) basic_machine=m68k-ericsson os=-ose ;; fx2800) basic_machine=i860-alliant ;; genix) basic_machine=ns32k-ns ;; gmicro) basic_machine=tron-gmicro os=-sysv ;; go32) basic_machine=i386-pc os=-go32 ;; h3050r* | hiux*) basic_machine=hppa1.1-hitachi os=-hiuxwe2 ;; h8300hms) basic_machine=h8300-hitachi os=-hms ;; h8300xray) basic_machine=h8300-hitachi os=-xray ;; h8500hms) basic_machine=h8500-hitachi os=-hms ;; harris) basic_machine=m88k-harris os=-sysv3 ;; hp300-*) basic_machine=m68k-hp ;; hp300bsd) basic_machine=m68k-hp os=-bsd ;; hp300hpux) basic_machine=m68k-hp os=-hpux ;; hp3k9[0-9][0-9] | hp9[0-9][0-9]) basic_machine=hppa1.0-hp ;; hp9k2[0-9][0-9] | hp9k31[0-9]) basic_machine=m68000-hp ;; hp9k3[2-9][0-9]) basic_machine=m68k-hp ;; hp9k6[0-9][0-9] | hp6[0-9][0-9]) basic_machine=hppa1.0-hp ;; hp9k7[0-79][0-9] | hp7[0-79][0-9]) basic_machine=hppa1.1-hp ;; hp9k78[0-9] | hp78[0-9]) # FIXME: really hppa2.0-hp basic_machine=hppa1.1-hp ;; hp9k8[67]1 | hp8[67]1 | hp9k80[24] | hp80[24] | hp9k8[78]9 | hp8[78]9 | hp9k893 | hp893) # FIXME: really hppa2.0-hp basic_machine=hppa1.1-hp ;; hp9k8[0-9][13679] | hp8[0-9][13679]) basic_machine=hppa1.1-hp ;; hp9k8[0-9][0-9] | hp8[0-9][0-9]) basic_machine=hppa1.0-hp ;; hppa-next) os=-nextstep3 ;; hppaosf) basic_machine=hppa1.1-hp os=-osf ;; hppro) basic_machine=hppa1.1-hp os=-proelf ;; i370-ibm* | ibm*) basic_machine=i370-ibm ;; # I'm not sure what "Sysv32" means. Should this be sysv3.2? i*86v32) basic_machine=`echo $1 | sed -e 's/86.*/86-pc/'` os=-sysv32 ;; i*86v4*) basic_machine=`echo $1 | sed -e 's/86.*/86-pc/'` os=-sysv4 ;; i*86v) basic_machine=`echo $1 | sed -e 's/86.*/86-pc/'` os=-sysv ;; i*86sol2) basic_machine=`echo $1 | sed -e 's/86.*/86-pc/'` os=-solaris2 ;; i386mach) basic_machine=i386-mach os=-mach ;; i386-vsta | vsta) basic_machine=i386-unknown os=-vsta ;; iris | iris4d) basic_machine=mips-sgi case $os in -irix*) ;; *) os=-irix4 ;; esac ;; isi68 | isi) basic_machine=m68k-isi os=-sysv ;; m88k-omron*) basic_machine=m88k-omron ;; magnum | m3230) basic_machine=mips-mips os=-sysv ;; merlin) basic_machine=ns32k-utek os=-sysv ;; mingw32) basic_machine=i386-pc os=-mingw32 ;; miniframe) basic_machine=m68000-convergent ;; *mint | -mint[0-9]* | *MiNT | *MiNT[0-9]*) basic_machine=m68k-atari os=-mint ;; mips3*-*) basic_machine=`echo $basic_machine | sed -e 's/mips3/mips64/'` ;; mips3*) basic_machine=`echo $basic_machine | sed -e 's/mips3/mips64/'`-unknown ;; mmix*) basic_machine=mmix-knuth os=-mmixware ;; monitor) basic_machine=m68k-rom68k os=-coff ;; morphos) basic_machine=powerpc-unknown os=-morphos ;; msdos) basic_machine=i386-pc os=-msdos ;; mvs) basic_machine=i370-ibm os=-mvs ;; ncr3000) basic_machine=i486-ncr os=-sysv4 ;; netbsd386) basic_machine=i386-unknown os=-netbsd ;; netwinder) basic_machine=armv4l-rebel os=-linux ;; news | news700 | news800 | news900) basic_machine=m68k-sony os=-newsos ;; news1000) basic_machine=m68030-sony os=-newsos ;; news-3600 | risc-news) basic_machine=mips-sony os=-newsos ;; necv70) basic_machine=v70-nec os=-sysv ;; next | m*-next ) basic_machine=m68k-next case $os in -nextstep* ) ;; -ns2*) os=-nextstep2 ;; *) os=-nextstep3 ;; esac ;; nh3000) basic_machine=m68k-harris os=-cxux ;; nh[45]000) basic_machine=m88k-harris os=-cxux ;; nindy960) basic_machine=i960-intel os=-nindy ;; mon960) basic_machine=i960-intel os=-mon960 ;; nonstopux) basic_machine=mips-compaq os=-nonstopux ;; np1) basic_machine=np1-gould ;; nv1) basic_machine=nv1-cray os=-unicosmp ;; nsr-tandem) basic_machine=nsr-tandem ;; op50n-* | op60c-*) basic_machine=hppa1.1-oki os=-proelf ;; or32 | or32-*) basic_machine=or32-unknown os=-coff ;; OSE68000 | ose68000) basic_machine=m68000-ericsson os=-ose ;; os68k) basic_machine=m68k-none os=-os68k ;; pa-hitachi) basic_machine=hppa1.1-hitachi os=-hiuxwe2 ;; paragon) basic_machine=i860-intel os=-osf ;; pbd) basic_machine=sparc-tti ;; pbb) basic_machine=m68k-tti ;; pc532 | pc532-*) basic_machine=ns32k-pc532 ;; pentium | p5 | k5 | k6 | nexgen | viac3) basic_machine=i586-pc ;; pentiumpro | p6 | 6x86 | athlon | athlon_*) basic_machine=i686-pc ;; pentiumii | pentium2 | pentiumiii | pentium3) basic_machine=i686-pc ;; pentium4) basic_machine=i786-pc ;; pentium-* | p5-* | k5-* | k6-* | nexgen-* | viac3-*) basic_machine=i586-`echo $basic_machine | sed 's/^[^-]*-//'` ;; pentiumpro-* | p6-* | 6x86-* | athlon-*) basic_machine=i686-`echo $basic_machine | sed 's/^[^-]*-//'` ;; pentiumii-* | pentium2-* | pentiumiii-* | pentium3-*) basic_machine=i686-`echo $basic_machine | sed 's/^[^-]*-//'` ;; pentium4-*) basic_machine=i786-`echo $basic_machine | sed 's/^[^-]*-//'` ;; pn) basic_machine=pn-gould ;; power) basic_machine=power-ibm ;; ppc) basic_machine=powerpc-unknown ;; ppc-*) basic_machine=powerpc-`echo $basic_machine | sed 's/^[^-]*-//'` ;; ppcle | powerpclittle | ppc-le | powerpc-little) basic_machine=powerpcle-unknown ;; ppcle-* | powerpclittle-*) basic_machine=powerpcle-`echo $basic_machine | sed 's/^[^-]*-//'` ;; ppc64) basic_machine=powerpc64-unknown ;; ppc64-*) basic_machine=powerpc64-`echo $basic_machine | sed 's/^[^-]*-//'` ;; ppc64le | powerpc64little | ppc64-le | powerpc64-little) basic_machine=powerpc64le-unknown ;; ppc64le-* | powerpc64little-*) basic_machine=powerpc64le-`echo $basic_machine | sed 's/^[^-]*-//'` ;; ps2) basic_machine=i386-ibm ;; pw32) basic_machine=i586-unknown os=-pw32 ;; rom68k) basic_machine=m68k-rom68k os=-coff ;; rm[46]00) basic_machine=mips-siemens ;; rtpc | rtpc-*) basic_machine=romp-ibm ;; s390 | s390-*) basic_machine=s390-ibm ;; s390x | s390x-*) basic_machine=s390x-ibm ;; sa29200) basic_machine=a29k-amd os=-udi ;; sb1) basic_machine=mipsisa64sb1-unknown ;; sb1el) basic_machine=mipsisa64sb1el-unknown ;; sei) basic_machine=mips-sei os=-seiux ;; sequent) basic_machine=i386-sequent ;; sh) basic_machine=sh-hitachi os=-hms ;; sh64) basic_machine=sh64-unknown ;; sparclite-wrs | simso-wrs) basic_machine=sparclite-wrs os=-vxworks ;; sps7) basic_machine=m68k-bull os=-sysv2 ;; spur) basic_machine=spur-unknown ;; st2000) basic_machine=m68k-tandem ;; stratus) basic_machine=i860-stratus os=-sysv4 ;; sun2) basic_machine=m68000-sun ;; sun2os3) basic_machine=m68000-sun os=-sunos3 ;; sun2os4) basic_machine=m68000-sun os=-sunos4 ;; sun3os3) basic_machine=m68k-sun os=-sunos3 ;; sun3os4) basic_machine=m68k-sun os=-sunos4 ;; sun4os3) basic_machine=sparc-sun os=-sunos3 ;; sun4os4) basic_machine=sparc-sun os=-sunos4 ;; sun4sol2) basic_machine=sparc-sun os=-solaris2 ;; sun3 | sun3-*) basic_machine=m68k-sun ;; sun4) basic_machine=sparc-sun ;; sun386 | sun386i | roadrunner) basic_machine=i386-sun ;; sv1) basic_machine=sv1-cray os=-unicos ;; symmetry) basic_machine=i386-sequent os=-dynix ;; t3e) basic_machine=alphaev5-cray os=-unicos ;; t90) basic_machine=t90-cray os=-unicos ;; tic54x | c54x*) basic_machine=tic54x-unknown os=-coff ;; tic55x | c55x*) basic_machine=tic55x-unknown os=-coff ;; tic6x | c6x*) basic_machine=tic6x-unknown os=-coff ;; tx39) basic_machine=mipstx39-unknown ;; tx39el) basic_machine=mipstx39el-unknown ;; toad1) basic_machine=pdp10-xkl os=-tops20 ;; tower | tower-32) basic_machine=m68k-ncr ;; udi29k) basic_machine=a29k-amd os=-udi ;; ultra3) basic_machine=a29k-nyu os=-sym1 ;; v810 | necv810) basic_machine=v810-nec os=-none ;; vaxv) basic_machine=vax-dec os=-sysv ;; vms) basic_machine=vax-dec os=-vms ;; vpp*|vx|vx-*) basic_machine=f301-fujitsu ;; vxworks960) basic_machine=i960-wrs os=-vxworks ;; vxworks68) basic_machine=m68k-wrs os=-vxworks ;; vxworks29k) basic_machine=a29k-wrs os=-vxworks ;; w65*) basic_machine=w65-wdc os=-none ;; w89k-*) basic_machine=hppa1.1-winbond os=-proelf ;; xps | xps100) basic_machine=xps100-honeywell ;; ymp) basic_machine=ymp-cray os=-unicos ;; z8k-*-coff) basic_machine=z8k-unknown os=-sim ;; none) basic_machine=none-none os=-none ;; # Here we handle the default manufacturer of certain CPU types. It is in # some cases the only manufacturer, in others, it is the most popular. w89k) basic_machine=hppa1.1-winbond ;; op50n) basic_machine=hppa1.1-oki ;; op60c) basic_machine=hppa1.1-oki ;; romp) basic_machine=romp-ibm ;; rs6000) basic_machine=rs6000-ibm ;; vax) basic_machine=vax-dec ;; pdp10) # there are many clones, so DEC is not a safe bet basic_machine=pdp10-unknown ;; pdp11) basic_machine=pdp11-dec ;; we32k) basic_machine=we32k-att ;; sh3 | sh4 | sh[34]eb | sh[1234]le | sh[23]ele) basic_machine=sh-unknown ;; sh64) basic_machine=sh64-unknown ;; sparc | sparcv9 | sparcv9b) basic_machine=sparc-sun ;; cydra) basic_machine=cydra-cydrome ;; orion) basic_machine=orion-highlevel ;; orion105) basic_machine=clipper-highlevel ;; mac | mpw | mac-mpw) basic_machine=m68k-apple ;; pmac | pmac-mpw) basic_machine=powerpc-apple ;; *-unknown) # Make sure to match an already-canonicalized machine name. ;; *) echo Invalid configuration \`$1\': machine \`$basic_machine\' not recognized 1>&2 exit 1 ;; esac # Here we canonicalize certain aliases for manufacturers. case $basic_machine in *-digital*) basic_machine=`echo $basic_machine | sed 's/digital.*/dec/'` ;; *-commodore*) basic_machine=`echo $basic_machine | sed 's/commodore.*/cbm/'` ;; *) ;; esac # Decode manufacturer-specific aliases for certain operating systems. if [ x"$os" != x"" ] then case $os in # First match some system type aliases # that might get confused with valid system types. # -solaris* is a basic system type, with this one exception. -solaris1 | -solaris1.*) os=`echo $os | sed -e 's|solaris1|sunos4|'` ;; -solaris) os=-solaris2 ;; -svr4*) os=-sysv4 ;; -unixware*) os=-sysv4.2uw ;; -gnu/linux*) os=`echo $os | sed -e 's|gnu/linux|linux-gnu|'` ;; # First accept the basic system types. # The portable systems comes first. # Each alternative MUST END IN A *, to match a version number. # -sysv* is not here because it comes later, after sysvr4. -gnu* | -bsd* | -mach* | -minix* | -genix* | -ultrix* | -irix* \ | -*vms* | -sco* | -esix* | -isc* | -aix* | -sunos | -sunos[34]*\ | -hpux* | -unos* | -osf* | -luna* | -dgux* | -solaris* | -sym* \ | -amigaos* | -amigados* | -msdos* | -newsos* | -unicos* | -aof* \ | -aos* \ | -nindy* | -vxsim* | -vxworks* | -ebmon* | -hms* | -mvs* \ | -clix* | -riscos* | -uniplus* | -iris* | -rtu* | -xenix* \ | -hiux* | -386bsd* | -netbsd* | -openbsd* | -kfreebsd* | -freebsd* | -riscix* \ | -lynxos* | -bosx* | -nextstep* | -cxux* | -aout* | -elf* | -oabi* \ | -ptx* | -coff* | -ecoff* | -winnt* | -domain* | -vsta* \ | -udi* | -eabi* | -lites* | -ieee* | -go32* | -aux* \ | -chorusos* | -chorusrdb* \ | -cygwin* | -pe* | -psos* | -moss* | -proelf* | -rtems* \ | -mingw32* | -linux-gnu* | -uxpv* | -beos* | -mpeix* | -udk* \ | -interix* | -uwin* | -mks* | -rhapsody* | -darwin* | -opened* \ | -openstep* | -oskit* | -conix* | -pw32* | -nonstopux* \ | -storm-chaos* | -tops10* | -tenex* | -tops20* | -its* \ | -os2* | -vos* | -palmos* | -uclinux* | -nucleus* \ | -morphos* | -superux* | -rtmk* | -rtmk-nova* | -windiss* \ | -powermax* | -dnix* | -nx6 | -nx7 | -sei*) # Remember, each alternative MUST END IN *, to match a version number. ;; -qnx*) case $basic_machine in x86-* | i*86-*) ;; *) os=-nto$os ;; esac ;; -nto-qnx*) ;; -nto*) os=`echo $os | sed -e 's|nto|nto-qnx|'` ;; -sim | -es1800* | -hms* | -xray | -os68k* | -none* | -v88r* \ | -windows* | -osx | -abug | -netware* | -os9* | -beos* \ | -macos* | -mpw* | -magic* | -mmixware* | -mon960* | -lnews*) ;; -mac*) os=`echo $os | sed -e 's|mac|macos|'` ;; -linux*) os=`echo $os | sed -e 's|linux|linux-gnu|'` ;; -sunos5*) os=`echo $os | sed -e 's|sunos5|solaris2|'` ;; -sunos6*) os=`echo $os | sed -e 's|sunos6|solaris3|'` ;; -opened*) os=-openedition ;; -wince*) os=-wince ;; -osfrose*) os=-osfrose ;; -osf*) os=-osf ;; -utek*) os=-bsd ;; -dynix*) os=-bsd ;; -acis*) os=-aos ;; -atheos*) os=-atheos ;; -386bsd) os=-bsd ;; -ctix* | -uts*) os=-sysv ;; -nova*) os=-rtmk-nova ;; -ns2 ) os=-nextstep2 ;; -nsk*) os=-nsk ;; # Preserve the version number of sinix5. -sinix5.*) os=`echo $os | sed -e 's|sinix|sysv|'` ;; -sinix*) os=-sysv4 ;; -triton*) os=-sysv3 ;; -oss*) os=-sysv3 ;; -svr4) os=-sysv4 ;; -svr3) os=-sysv3 ;; -sysvr4) os=-sysv4 ;; # This must come after -sysvr4. -sysv*) ;; -ose*) os=-ose ;; -es1800*) os=-ose ;; -xenix) os=-xenix ;; -*mint | -mint[0-9]* | -*MiNT | -MiNT[0-9]*) os=-mint ;; -aros*) os=-aros ;; -kaos*) os=-kaos ;; -none) ;; *) # Get rid of the `-' at the beginning of $os. os=`echo $os | sed 's/[^-]*-//'` echo Invalid configuration \`$1\': system \`$os\' not recognized 1>&2 exit 1 ;; esac else # Here we handle the default operating systems that come with various machines. # The value should be what the vendor currently ships out the door with their # machine or put another way, the most popular os provided with the machine. # Note that if you're going to try to match "-MANUFACTURER" here (say, # "-sun"), then you have to tell the case statement up towards the top # that MANUFACTURER isn't an operating system. Otherwise, code above # will signal an error saying that MANUFACTURER isn't an operating # system, and we'll never get to this point. case $basic_machine in *-acorn) os=-riscix1.2 ;; arm*-rebel) os=-linux ;; arm*-semi) os=-aout ;; c4x-* | tic4x-*) os=-coff ;; # This must come before the *-dec entry. pdp10-*) os=-tops20 ;; pdp11-*) os=-none ;; *-dec | vax-*) os=-ultrix4.2 ;; m68*-apollo) os=-domain ;; i386-sun) os=-sunos4.0.2 ;; m68000-sun) os=-sunos3 # This also exists in the configure program, but was not the # default. # os=-sunos4 ;; m68*-cisco) os=-aout ;; mips*-cisco) os=-elf ;; mips*-*) os=-elf ;; or32-*) os=-coff ;; *-tti) # must be before sparc entry or we get the wrong os. os=-sysv3 ;; sparc-* | *-sun) os=-sunos4.1.1 ;; *-be) os=-beos ;; *-ibm) os=-aix ;; *-wec) os=-proelf ;; *-winbond) os=-proelf ;; *-oki) os=-proelf ;; *-hp) os=-hpux ;; *-hitachi) os=-hiux ;; i860-* | *-att | *-ncr | *-altos | *-motorola | *-convergent) os=-sysv ;; *-cbm) os=-amigaos ;; *-dg) os=-dgux ;; *-dolphin) os=-sysv3 ;; m68k-ccur) os=-rtu ;; m88k-omron*) os=-luna ;; *-next ) os=-nextstep ;; *-sequent) os=-ptx ;; *-crds) os=-unos ;; *-ns) os=-genix ;; i370-*) os=-mvs ;; *-next) os=-nextstep3 ;; *-gould) os=-sysv ;; *-highlevel) os=-bsd ;; *-encore) os=-bsd ;; *-sgi) os=-irix ;; *-siemens) os=-sysv4 ;; *-masscomp) os=-rtu ;; f30[01]-fujitsu | f700-fujitsu) os=-uxpv ;; *-rom68k) os=-coff ;; *-*bug) os=-coff ;; *-apple) os=-macos ;; *-atari*) os=-mint ;; *) os=-none ;; esac fi # Here we handle the case where we know the os, and the CPU type, but not the # manufacturer. We pick the logical manufacturer. vendor=unknown case $basic_machine in *-unknown) case $os in -riscix*) vendor=acorn ;; -sunos*) vendor=sun ;; -aix*) vendor=ibm ;; -beos*) vendor=be ;; -hpux*) vendor=hp ;; -mpeix*) vendor=hp ;; -hiux*) vendor=hitachi ;; -unos*) vendor=crds ;; -dgux*) vendor=dg ;; -luna*) vendor=omron ;; -genix*) vendor=ns ;; -mvs* | -opened*) vendor=ibm ;; -ptx*) vendor=sequent ;; -vxsim* | -vxworks* | -windiss*) vendor=wrs ;; -aux*) vendor=apple ;; -hms*) vendor=hitachi ;; -mpw* | -macos*) vendor=apple ;; -*mint | -mint[0-9]* | -*MiNT | -MiNT[0-9]*) vendor=atari ;; -vos*) vendor=stratus ;; esac basic_machine=`echo $basic_machine | sed "s/unknown/$vendor/"` ;; esac echo $basic_machine$os exit 0 # Local variables: # eval: (add-hook 'write-file-hooks 'time-stamp) # time-stamp-start: "timestamp='" # time-stamp-format: "%:y-%02m-%02d" # time-stamp-end: "'" # End: libtranslate-0.99/depcomp000755 001750 001750 00000027525 10161371573 017271 0ustar00jylefortjylefort000000 000000 #! /bin/sh # depcomp - compile a program generating dependencies as side-effects # Copyright 1999, 2000 Free Software Foundation, Inc. # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2, or (at your option) # any later version. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA # 02111-1307, USA. # As a special exception to the GNU General Public License, if you # distribute this file as part of a program that contains a # configuration script generated by Autoconf, you may include it under # the same distribution terms that you use for the rest of that program. # Originally written by Alexandre Oliva . if test -z "$depmode" || test -z "$source" || test -z "$object"; then echo "depcomp: Variables source, object and depmode must be set" 1>&2 exit 1 fi # `libtool' can also be set to `yes' or `no'. depfile=${depfile-`echo "$object" | sed 's,\([^/]*\)$,.deps/\1,;s/\.\([^.]*\)$/.P\1/'`} tmpdepfile=${tmpdepfile-`echo "$depfile" | sed 's/\.\([^.]*\)$/.T\1/'`} rm -f "$tmpdepfile" # Some modes work just like other modes, but use different flags. We # parameterize here, but still list the modes in the big case below, # to make depend.m4 easier to write. Note that we *cannot* use a case # here, because this file can only contain one case statement. if test "$depmode" = hp; then # HP compiler uses -M and no extra arg. gccflag=-M depmode=gcc fi if test "$depmode" = dashXmstdout; then # This is just like dashmstdout with a different argument. dashmflag=-xM depmode=dashmstdout fi case "$depmode" in gcc3) ## gcc 3 implements dependency tracking that does exactly what ## we want. Yay! Note: for some reason libtool 1.4 doesn't like ## it if -MD -MP comes after the -MF stuff. Hmm. "$@" -MT "$object" -MD -MP -MF "$tmpdepfile" stat=$? if test $stat -eq 0; then : else rm -f "$tmpdepfile" exit $stat fi mv "$tmpdepfile" "$depfile" ;; gcc) ## There are various ways to get dependency output from gcc. Here's ## why we pick this rather obscure method: ## - Don't want to use -MD because we'd like the dependencies to end ## up in a subdir. Having to rename by hand is ugly. ## (We might end up doing this anyway to support other compilers.) ## - The DEPENDENCIES_OUTPUT environment variable makes gcc act like ## -MM, not -M (despite what the docs say). ## - Using -M directly means running the compiler twice (even worse ## than renaming). if test -z "$gccflag"; then gccflag=-MD, fi "$@" -Wp,"$gccflag$tmpdepfile" stat=$? if test $stat -eq 0; then : else rm -f "$tmpdepfile" exit $stat fi rm -f "$depfile" echo "$object : \\" > "$depfile" alpha=ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz ## The second -e expression handles DOS-style file names with drive letters. sed -e 's/^[^:]*: / /' \ -e 's/^['$alpha']:\/[^:]*: / /' < "$tmpdepfile" >> "$depfile" ## This next piece of magic avoids the `deleted header file' problem. ## The problem is that when a header file which appears in a .P file ## is deleted, the dependency causes make to die (because there is ## typically no way to rebuild the header). We avoid this by adding ## dummy dependencies for each header file. Too bad gcc doesn't do ## this for us directly. tr ' ' ' ' < "$tmpdepfile" | ## Some versions of gcc put a space before the `:'. On the theory ## that the space means something, we add a space to the output as ## well. ## Some versions of the HPUX 10.20 sed can't process this invocation ## correctly. Breaking it into two sed invocations is a workaround. sed -e 's/^\\$//' -e '/^$/d' -e '/:$/d' | sed -e 's/$/ :/' >> "$depfile" rm -f "$tmpdepfile" ;; hp) # This case exists only to let depend.m4 do its work. It works by # looking at the text of this script. This case will never be run, # since it is checked for above. exit 1 ;; sgi) if test "$libtool" = yes; then "$@" "-Wp,-MDupdate,$tmpdepfile" else "$@" -MDupdate "$tmpdepfile" fi stat=$? if test $stat -eq 0; then : else rm -f "$tmpdepfile" exit $stat fi rm -f "$depfile" if test -f "$tmpdepfile"; then # yes, the sourcefile depend on other files echo "$object : \\" > "$depfile" # Clip off the initial element (the dependent). Don't try to be # clever and replace this with sed code, as IRIX sed won't handle # lines with more than a fixed number of characters (4096 in # IRIX 6.2 sed, 8192 in IRIX 6.5). We also remove comment lines; # the IRIX cc adds comments like `#:fec' to the end of the # dependency line. tr ' ' ' ' < "$tmpdepfile" \ | sed -e 's/^.*\.o://' -e 's/#.*$//' -e '/^$/ d' | \ tr ' ' ' ' >> $depfile echo >> $depfile # The second pass generates a dummy entry for each header file. tr ' ' ' ' < "$tmpdepfile" \ | sed -e 's/^.*\.o://' -e 's/#.*$//' -e '/^$/ d' -e 's/$/:/' \ >> $depfile else # The sourcefile does not contain any dependencies, so just # store a dummy comment line, to avoid errors with the Makefile # "include basename.Plo" scheme. echo "#dummy" > "$depfile" fi rm -f "$tmpdepfile" ;; aix) # The C for AIX Compiler uses -M and outputs the dependencies # in a .u file. This file always lives in the current directory. # Also, the AIX compiler puts `$object:' at the start of each line; # $object doesn't have directory information. stripped=`echo "$object" | sed -e 's,^.*/,,' -e 's/\(.*\)\..*$/\1/'` tmpdepfile="$stripped.u" outname="$stripped.o" if test "$libtool" = yes; then "$@" -Wc,-M else "$@" -M fi stat=$? if test $stat -eq 0; then : else rm -f "$tmpdepfile" exit $stat fi if test -f "$tmpdepfile"; then # Each line is of the form `foo.o: dependent.h'. # Do two passes, one to just change these to # `$object: dependent.h' and one to simply `dependent.h:'. sed -e "s,^$outname:,$object :," < "$tmpdepfile" > "$depfile" sed -e "s,^$outname: \(.*\)$,\1:," < "$tmpdepfile" >> "$depfile" else # The sourcefile does not contain any dependencies, so just # store a dummy comment line, to avoid errors with the Makefile # "include basename.Plo" scheme. echo "#dummy" > "$depfile" fi rm -f "$tmpdepfile" ;; tru64) # The Tru64 AIX compiler uses -MD to generate dependencies as a side # effect. `cc -MD -o foo.o ...' puts the dependencies into `foo.o.d'. # At least on Alpha/Redhat 6.1, Compaq CCC V6.2-504 seems to put # dependencies in `foo.d' instead, so we check for that too. # Subdirectories are respected. tmpdepfile1="$object.d" tmpdepfile2=`echo "$object" | sed -e 's/.o$/.d/'` if test "$libtool" = yes; then "$@" -Wc,-MD else "$@" -MD fi stat=$? if test $stat -eq 0; then : else rm -f "$tmpdepfile1" "$tmpdepfile2" exit $stat fi if test -f "$tmpdepfile1"; then tmpdepfile="$tmpdepfile1" else tmpdepfile="$tmpdepfile2" fi if test -f "$tmpdepfile"; then sed -e "s,^.*\.[a-z]*:,$object:," < "$tmpdepfile" > "$depfile" # That's a space and a tab in the []. sed -e 's,^.*\.[a-z]*:[ ]*,,' -e 's,$,:,' < "$tmpdepfile" >> "$depfile" else echo "#dummy" > "$depfile" fi rm -f "$tmpdepfile" ;; #nosideeffect) # This comment above is used by automake to tell side-effect # dependency tracking mechanisms from slower ones. dashmstdout) # Important note: in order to support this mode, a compiler *must* # always write the proprocessed file to stdout, regardless of -o, # because we must use -o when running libtool. test -z "$dashmflag" && dashmflag=-M ( IFS=" " case " $* " in *" --mode=compile "*) # this is libtool, let us make it quiet for arg do # cycle over the arguments case "$arg" in "--mode=compile") # insert --quiet before "--mode=compile" set fnord "$@" --quiet shift # fnord ;; esac set fnord "$@" "$arg" shift # fnord shift # "$arg" done ;; esac "$@" $dashmflag | sed 's:^[^:]*\:[ ]*:'"$object"'\: :' > "$tmpdepfile" ) & proc=$! "$@" stat=$? wait "$proc" if test "$stat" != 0; then exit $stat; fi rm -f "$depfile" cat < "$tmpdepfile" > "$depfile" tr ' ' ' ' < "$tmpdepfile" | \ ## Some versions of the HPUX 10.20 sed can't process this invocation ## correctly. Breaking it into two sed invocations is a workaround. sed -e 's/^\\$//' -e '/^$/d' -e '/:$/d' | sed -e 's/$/ :/' >> "$depfile" rm -f "$tmpdepfile" ;; dashXmstdout) # This case only exists to satisfy depend.m4. It is never actually # run, as this mode is specially recognized in the preamble. exit 1 ;; makedepend) # X makedepend ( shift cleared=no for arg in "$@"; do case $cleared in no) set ""; shift cleared=yes esac case "$arg" in -D*|-I*) set fnord "$@" "$arg"; shift;; -*) ;; *) set fnord "$@" "$arg"; shift;; esac done obj_suffix="`echo $object | sed 's/^.*\././'`" touch "$tmpdepfile" ${MAKEDEPEND-makedepend} 2>/dev/null -o"$obj_suffix" -f"$tmpdepfile" "$@" ) & proc=$! "$@" stat=$? wait "$proc" if test "$stat" != 0; then exit $stat; fi rm -f "$depfile" cat < "$tmpdepfile" > "$depfile" tail +3 "$tmpdepfile" | tr ' ' ' ' | \ ## Some versions of the HPUX 10.20 sed can't process this invocation ## correctly. Breaking it into two sed invocations is a workaround. sed -e 's/^\\$//' -e '/^$/d' -e '/:$/d' | sed -e 's/$/ :/' >> "$depfile" rm -f "$tmpdepfile" "$tmpdepfile".bak ;; cpp) # Important note: in order to support this mode, a compiler *must* # always write the proprocessed file to stdout, regardless of -o, # because we must use -o when running libtool. ( IFS=" " case " $* " in *" --mode=compile "*) for arg do # cycle over the arguments case $arg in "--mode=compile") # insert --quiet before "--mode=compile" set fnord "$@" --quiet shift # fnord ;; esac set fnord "$@" "$arg" shift # fnord shift # "$arg" done ;; esac "$@" -E | sed -n '/^# [0-9][0-9]* "\([^"]*\)".*/ s:: \1 \\:p' | sed '$ s: \\$::' > "$tmpdepfile" ) & proc=$! "$@" stat=$? wait "$proc" if test "$stat" != 0; then exit $stat; fi rm -f "$depfile" echo "$object : \\" > "$depfile" cat < "$tmpdepfile" >> "$depfile" sed < "$tmpdepfile" '/^$/d;s/^ //;s/ \\$//;s/$/ :/' >> "$depfile" rm -f "$tmpdepfile" ;; msvisualcpp) # Important note: in order to support this mode, a compiler *must* # always write the proprocessed file to stdout, regardless of -o, # because we must use -o when running libtool. ( IFS=" " case " $* " in *" --mode=compile "*) for arg do # cycle over the arguments case $arg in "--mode=compile") # insert --quiet before "--mode=compile" set fnord "$@" --quiet shift # fnord ;; esac set fnord "$@" "$arg" shift # fnord shift # "$arg" done ;; esac "$@" -E | sed -n '/^#line [0-9][0-9]* "\([^"]*\)"/ s::echo "`cygpath -u \\"\1\\"`":p' | sort | uniq > "$tmpdepfile" ) & proc=$! "$@" stat=$? wait "$proc" if test "$stat" != 0; then exit $stat; fi rm -f "$depfile" echo "$object : \\" > "$depfile" . "$tmpdepfile" | sed 's% %\\ %g' | sed -n '/^\(.*\)$/ s:: \1 \\:p' >> "$depfile" echo " " >> "$depfile" . "$tmpdepfile" | sed 's% %\\ %g' | sed -n '/^\(.*\)$/ s::\1\::p' >> "$depfile" rm -f "$tmpdepfile" ;; none) exec "$@" ;; *) echo "Unknown depmode $depmode" 1>&2 exit 1 ;; esac exit 0 libtranslate-0.99/install-sh000755 001750 001750 00000012736 10161371573 017716 0ustar00jylefortjylefort000000 000000 #!/bin/sh # # install - install a program, script, or datafile # This comes from X11R5 (mit/util/scripts/install.sh). # # Copyright 1991 by the Massachusetts Institute of Technology # # Permission to use, copy, modify, distribute, and sell this software and its # documentation for any purpose is hereby granted without fee, provided that # the above copyright notice appear in all copies and that both that # copyright notice and this permission notice appear in supporting # documentation, and that the name of M.I.T. not be used in advertising or # publicity pertaining to distribution of the software without specific, # written prior permission. M.I.T. makes no representations about the # suitability of this software for any purpose. It is provided "as is" # without express or implied warranty. # # Calling this script install-sh is preferred over install.sh, to prevent # `make' implicit rules from creating a file called install from it # when there is no Makefile. # # This script is compatible with the BSD install script, but was written # from scratch. It can only install one file at a time, a restriction # shared with many OS's install programs. # set DOITPROG to echo to test this script # Don't use :- since 4.3BSD and earlier shells don't like it. doit="${DOITPROG-}" # put in absolute paths if you don't have them in your path; or use env. vars. mvprog="${MVPROG-mv}" cpprog="${CPPROG-cp}" chmodprog="${CHMODPROG-chmod}" chownprog="${CHOWNPROG-chown}" chgrpprog="${CHGRPPROG-chgrp}" stripprog="${STRIPPROG-strip}" rmprog="${RMPROG-rm}" mkdirprog="${MKDIRPROG-mkdir}" transformbasename="" transform_arg="" instcmd="$mvprog" chmodcmd="$chmodprog 0755" chowncmd="" chgrpcmd="" stripcmd="" rmcmd="$rmprog -f" mvcmd="$mvprog" src="" dst="" dir_arg="" while [ x"$1" != x ]; do case $1 in -c) instcmd="$cpprog" shift continue;; -d) dir_arg=true shift continue;; -m) chmodcmd="$chmodprog $2" shift shift continue;; -o) chowncmd="$chownprog $2" shift shift continue;; -g) chgrpcmd="$chgrpprog $2" shift shift continue;; -s) stripcmd="$stripprog" shift continue;; -t=*) transformarg=`echo $1 | sed 's/-t=//'` shift continue;; -b=*) transformbasename=`echo $1 | sed 's/-b=//'` shift continue;; *) if [ x"$src" = x ] then src=$1 else # this colon is to work around a 386BSD /bin/sh bug : dst=$1 fi shift continue;; esac done if [ x"$src" = x ] then echo "install: no input file specified" exit 1 else true fi if [ x"$dir_arg" != x ]; then dst=$src src="" if [ -d $dst ]; then instcmd=: chmodcmd="" else instcmd=mkdir fi else # Waiting for this to be detected by the "$instcmd $src $dsttmp" command # might cause directories to be created, which would be especially bad # if $src (and thus $dsttmp) contains '*'. if [ -f $src -o -d $src ] then true else echo "install: $src does not exist" exit 1 fi if [ x"$dst" = x ] then echo "install: no destination specified" exit 1 else true fi # If destination is a directory, append the input filename; if your system # does not like double slashes in filenames, you may need to add some logic if [ -d $dst ] then dst="$dst"/`basename $src` else true fi fi ## this sed command emulates the dirname command dstdir=`echo $dst | sed -e 's,[^/]*$,,;s,/$,,;s,^$,.,'` # Make sure that the destination directory exists. # this part is taken from Noah Friedman's mkinstalldirs script # Skip lots of stat calls in the usual case. if [ ! -d "$dstdir" ]; then defaultIFS=' ' IFS="${IFS-${defaultIFS}}" oIFS="${IFS}" # Some sh's can't handle IFS=/ for some reason. IFS='%' set - `echo ${dstdir} | sed -e 's@/@%@g' -e 's@^%@/@'` IFS="${oIFS}" pathcomp='' while [ $# -ne 0 ] ; do pathcomp="${pathcomp}${1}" shift if [ ! -d "${pathcomp}" ] ; then $mkdirprog "${pathcomp}" else true fi pathcomp="${pathcomp}/" done fi if [ x"$dir_arg" != x ] then $doit $instcmd $dst && if [ x"$chowncmd" != x ]; then $doit $chowncmd $dst; else true ; fi && if [ x"$chgrpcmd" != x ]; then $doit $chgrpcmd $dst; else true ; fi && if [ x"$stripcmd" != x ]; then $doit $stripcmd $dst; else true ; fi && if [ x"$chmodcmd" != x ]; then $doit $chmodcmd $dst; else true ; fi else # If we're going to rename the final executable, determine the name now. if [ x"$transformarg" = x ] then dstfile=`basename $dst` else dstfile=`basename $dst $transformbasename | sed $transformarg`$transformbasename fi # don't allow the sed command to completely eliminate the filename if [ x"$dstfile" = x ] then dstfile=`basename $dst` else true fi # Make a temp file name in the proper directory. dsttmp=$dstdir/#inst.$$# # Move or copy the file name to the temp name $doit $instcmd $src $dsttmp && trap "rm -f ${dsttmp}" 0 && # and set any options; do chmod last to preserve setuid bits # If any of these fail, we abort the whole thing. If we want to # ignore errors from any of these, just make sure not to ignore # errors from the above "$doit $instcmd $src $dsttmp" command. if [ x"$chowncmd" != x ]; then $doit $chowncmd $dsttmp; else true;fi && if [ x"$chgrpcmd" != x ]; then $doit $chgrpcmd $dsttmp; else true;fi && if [ x"$stripcmd" != x ]; then $doit $stripcmd $dsttmp; else true;fi && if [ x"$chmodcmd" != x ]; then $doit $chmodcmd $dsttmp; else true;fi && # Now rename the file to the real destination. $doit $rmcmd -f $dstdir/$dstfile && $doit $mvcmd $dsttmp $dstdir/$dstfile fi && exit 0 libtranslate-0.99/ltmain.sh000444 001750 001750 00000546561 10145502334 017531 0ustar00jylefortjylefort000000 000000 # ltmain.sh - Provide generalized library-building support services. # NOTE: Changing this file will not affect anything until you rerun configure. # # Copyright (C) 1996, 1997, 1998, 1999, 2000, 2001, 2003, 2004 # Free Software Foundation, Inc. # Originally by Gordon Matzigkeit , 1996 # # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2 of the License, or # (at your option) any later version. # # This program is distributed in the hope that it will be useful, but # WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU # General Public License for more details. # # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA. # # As a special exception to the GNU General Public License, if you # distribute this file as part of a program that contains a # configuration script generated by Autoconf, you may include it under # the same distribution terms that you use for the rest of that program. basename="s,^.*/,,g" # Work around backward compatibility issue on IRIX 6.5. On IRIX 6.4+, sh # is ksh but when the shell is invoked as "sh" and the current value of # the _XPG environment variable is not equal to 1 (one), the special # positional parameter $0, within a function call, is the name of the # function. progpath="$0" # The name of this program: progname=`echo "$progpath" | $SED $basename` modename="$progname" # Global variables: EXIT_SUCCESS=0 EXIT_FAILURE=1 PROGRAM=ltmain.sh PACKAGE=libtool VERSION=1.5.10 TIMESTAMP=" (1.1220.2.130 2004/09/19 12:13:49)" # See if we are running on zsh, and set the options which allow our # commands through without removal of \ escapes. if test -n "${ZSH_VERSION+set}" ; then setopt NO_GLOB_SUBST fi # Check that we have a working $echo. if test "X$1" = X--no-reexec; then # Discard the --no-reexec flag, and continue. shift elif test "X$1" = X--fallback-echo; then # Avoid inline document here, it may be left over : elif test "X`($echo '\t') 2>/dev/null`" = 'X\t'; then # Yippee, $echo works! : else # Restart under the correct shell, and then maybe $echo will work. exec $SHELL "$progpath" --no-reexec ${1+"$@"} fi if test "X$1" = X--fallback-echo; then # used as fallback echo shift cat <&2 $echo "Fatal configuration error. See the $PACKAGE docs for more information." 1>&2 exit $EXIT_FAILURE fi # Global variables. mode=$default_mode nonopt= prev= prevopt= run= show="$echo" show_help= execute_dlfiles= lo2o="s/\\.lo\$/.${objext}/" o2lo="s/\\.${objext}\$/.lo/" ##################################### # Shell function definitions: # This seems to be the best place for them # func_win32_libid arg # return the library type of file 'arg' # # Need a lot of goo to handle *both* DLLs and import libs # Has to be a shell function in order to 'eat' the argument # that is supplied when $file_magic_command is called. func_win32_libid () { win32_libid_type="unknown" win32_fileres=`file -L $1 2>/dev/null` case $win32_fileres in *ar\ archive\ import\ library*) # definitely import win32_libid_type="x86 archive import" ;; *ar\ archive*) # could be an import, or static if eval $OBJDUMP -f $1 | $SED -e '10q' 2>/dev/null | \ $EGREP -e 'file format pe-i386(.*architecture: i386)?' >/dev/null ; then win32_nmres=`eval $NM -f posix -A $1 | \ sed -n -e '1,100{/ I /{x;/import/!{s/^/import/;h;p;};x;};}'` if test "X$win32_nmres" = "Ximport" ; then win32_libid_type="x86 archive import" else win32_libid_type="x86 archive static" fi fi ;; *DLL*) win32_libid_type="x86 DLL" ;; *executable*) # but shell scripts are "executable" too... case $win32_fileres in *MS\ Windows\ PE\ Intel*) win32_libid_type="x86 DLL" ;; esac ;; esac $echo $win32_libid_type } # func_infer_tag arg # Infer tagged configuration to use if any are available and # if one wasn't chosen via the "--tag" command line option. # Only attempt this if the compiler in the base compile # command doesn't match the default compiler. # arg is usually of the form 'gcc ...' func_infer_tag () { if test -n "$available_tags" && test -z "$tagname"; then CC_quoted= for arg in $CC; do case $arg in *[\[\~\#\^\&\*\(\)\{\}\|\;\<\>\?\'\ \ ]*|*]*|"") arg="\"$arg\"" ;; esac CC_quoted="$CC_quoted $arg" done case $@ in # Blanks in the command may have been stripped by the calling shell, # but not from the CC environment variable when configure was run. " $CC "* | "$CC "* | " `$echo $CC` "* | "`$echo $CC` "* | " $CC_quoted"* | "$CC_quoted "* | " `$echo $CC_quoted` "* | "`$echo $CC_quoted` "*) ;; # Blanks at the start of $base_compile will cause this to fail # if we don't check for them as well. *) for z in $available_tags; do if grep "^# ### BEGIN LIBTOOL TAG CONFIG: $z$" < "$progpath" > /dev/null; then # Evaluate the configuration. eval "`${SED} -n -e '/^# ### BEGIN LIBTOOL TAG CONFIG: '$z'$/,/^# ### END LIBTOOL TAG CONFIG: '$z'$/p' < $progpath`" CC_quoted= for arg in $CC; do # Double-quote args containing other shell metacharacters. case $arg in *[\[\~\#\^\&\*\(\)\{\}\|\;\<\>\?\'\ \ ]*|*]*|"") arg="\"$arg\"" ;; esac CC_quoted="$CC_quoted $arg" done case "$@ " in " $CC "* | "$CC "* | " `$echo $CC` "* | "`$echo $CC` "* | " $CC_quoted"* | "$CC_quoted "* | " `$echo $CC_quoted` "* | "`$echo $CC_quoted` "*) # The compiler in the base compile command matches # the one in the tagged configuration. # Assume this is the tagged configuration we want. tagname=$z break ;; esac fi done # If $tagname still isn't set, then no tagged configuration # was found and let the user know that the "--tag" command # line option must be used. if test -z "$tagname"; then $echo "$modename: unable to infer tagged configuration" $echo "$modename: specify a tag with \`--tag'" 1>&2 exit $EXIT_FAILURE # else # $echo "$modename: using $tagname tagged configuration" fi ;; esac fi } # func_extract_archives gentop oldlib ... func_extract_archives () { my_gentop="$1"; shift my_oldlibs=${1+"$@"} my_oldobjs="" my_xlib="" my_xabs="" my_xdir="" my_status="" $show "${rm}r $my_gentop" $run ${rm}r "$my_gentop" $show "$mkdir $my_gentop" $run $mkdir "$my_gentop" my_status=$? if test "$my_status" -ne 0 && test ! -d "$my_gentop"; then exit $my_status fi for my_xlib in $my_oldlibs; do # Extract the objects. case $my_xlib in [\\/]* | [A-Za-z]:[\\/]*) my_xabs="$my_xlib" ;; *) my_xabs=`pwd`"/$my_xlib" ;; esac my_xlib=`$echo "X$my_xlib" | $Xsed -e 's%^.*/%%'` my_xdir="$my_gentop/$my_xlib" $show "${rm}r $my_xdir" $run ${rm}r "$my_xdir" $show "$mkdir $my_xdir" $run $mkdir "$my_xdir" status=$? if test "$status" -ne 0 && test ! -d "$my_xdir"; then exit $status fi case $host in *-darwin*) $show "Extracting $my_xabs" # Do not bother doing anything if just a dry run if test -z "$run"; then darwin_orig_dir=`pwd` cd $my_xdir || exit $? darwin_archive=$my_xabs darwin_curdir=`pwd` darwin_base_archive=`basename $darwin_archive` darwin_arches=`lipo -info "$darwin_archive" 2>/dev/null | $EGREP Architectures 2>/dev/null` if test -n "$darwin_arches"; then darwin_arches=`echo "$darwin_arches" | $SED -e 's/.*are://'` darwin_arch= $show "$darwin_base_archive has multiple architectures $darwin_arches" for darwin_arch in $darwin_arches ; do mkdir -p "unfat-$$/${darwin_base_archive}-${darwin_arch}" lipo -thin $darwin_arch -output "unfat-$$/${darwin_base_archive}-${darwin_arch}/${darwin_base_archive}" "${darwin_archive}" # Remove the table of contents from the thin files. $AR -d "unfat-$$/${darwin_base_archive}-${darwin_arch}/${darwin_base_archive}" __.SYMDEF 2>/dev/null || true $AR -d "unfat-$$/${darwin_base_archive}-${darwin_arch}/${darwin_base_archive}" __.SYMDEF\ SORTED 2>/dev/null || true cd "unfat-$$/${darwin_base_archive}-${darwin_arch}" $AR -xo "${darwin_base_archive}" rm "${darwin_base_archive}" cd "$darwin_curdir" done # $darwin_arches ## Okay now we have a bunch of thin objects, gotta fatten them up :) darwin_filelist=`find unfat-$$ -type f | xargs basename | sort -u | $NL2SP` darwin_file= darwin_files= for darwin_file in $darwin_filelist; do darwin_files=`find unfat-$$ -name $darwin_file -print | $NL2SP` lipo -create -output "$darwin_file" $darwin_files done # $darwin_filelist rm -rf unfat-$$ cd "$darwin_orig_dir" else cd $darwin_orig_dir (cd $my_xdir && $AR x $my_xabs) || exit $? fi # $darwin_arches fi # $run ;; *) # We will extract separately just the conflicting names and we will # no longer touch any unique names. It is faster to leave these # extract automatically by $AR in one run. $show "(cd $my_xdir && $AR x $my_xabs)" $run eval "(cd \$my_xdir && $AR x \$my_xabs)" || exit $? if ($AR t "$my_xabs" | sort | sort -uc >/dev/null 2>&1); then : else $echo "$modename: warning: object name conflicts; renaming object files" 1>&2 $echo "$modename: warning: to ensure that they will not overwrite" 1>&2 $AR t "$my_xabs" | sort | uniq -cd | while read -r count name do i=1 while test "$i" -le "$count" do # Put our $i before any first dot (extension) # Never overwrite any file name_to="$name" while test "X$name_to" = "X$name" || test -f "$my_xdir/$name_to" do name_to=`$echo "X$name_to" | $Xsed -e "s/\([^.]*\)/\1-$i/"` done $show "(cd $my_xdir && $AR xN $i $my_xabs '$name' && $mv '$name' '$name_to')" $run eval "(cd \$my_xdir && $AR xN $i \$my_xabs '$name' && $mv '$name' '$name_to')" || exit $? i=`expr $i + 1` done done fi ;; esac my_oldobjs="$my_oldobjs "`find $my_xdir -name \*.$objext -print -o -name \*.lo -print | $NL2SP` done func_extract_archives_result="$my_oldobjs" } # End of Shell function definitions ##################################### # Darwin sucks eval std_shrext=\"$shrext_cmds\" # Parse our command line options once, thoroughly. while test "$#" -gt 0 do arg="$1" shift case $arg in -*=*) optarg=`$echo "X$arg" | $Xsed -e 's/[-_a-zA-Z0-9]*=//'` ;; *) optarg= ;; esac # If the previous option needs an argument, assign it. if test -n "$prev"; then case $prev in execute_dlfiles) execute_dlfiles="$execute_dlfiles $arg" ;; tag) tagname="$arg" preserve_args="${preserve_args}=$arg" # Check whether tagname contains only valid characters case $tagname in *[!-_A-Za-z0-9,/]*) $echo "$progname: invalid tag name: $tagname" 1>&2 exit $EXIT_FAILURE ;; esac case $tagname in CC) # Don't test for the "default" C tag, as we know, it's there, but # not specially marked. ;; *) if grep "^# ### BEGIN LIBTOOL TAG CONFIG: $tagname$" < "$progpath" > /dev/null; then taglist="$taglist $tagname" # Evaluate the configuration. eval "`${SED} -n -e '/^# ### BEGIN LIBTOOL TAG CONFIG: '$tagname'$/,/^# ### END LIBTOOL TAG CONFIG: '$tagname'$/p' < $progpath`" else $echo "$progname: ignoring unknown tag $tagname" 1>&2 fi ;; esac ;; *) eval "$prev=\$arg" ;; esac prev= prevopt= continue fi # Have we seen a non-optional argument yet? case $arg in --help) show_help=yes ;; --version) $echo "$PROGRAM (GNU $PACKAGE) $VERSION$TIMESTAMP" $echo $echo "Copyright (C) 2003 Free Software Foundation, Inc." $echo "This is free software; see the source for copying conditions. There is NO" $echo "warranty; not even for MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE." exit $EXIT_SUCCESS ;; --config) ${SED} -e '1,/^# ### BEGIN LIBTOOL CONFIG/d' -e '/^# ### END LIBTOOL CONFIG/,$d' $progpath # Now print the configurations for the tags. for tagname in $taglist; do ${SED} -n -e "/^# ### BEGIN LIBTOOL TAG CONFIG: $tagname$/,/^# ### END LIBTOOL TAG CONFIG: $tagname$/p" < "$progpath" done exit $EXIT_SUCCESS ;; --debug) $echo "$progname: enabling shell trace mode" set -x preserve_args="$preserve_args $arg" ;; --dry-run | -n) run=: ;; --features) $echo "host: $host" if test "$build_libtool_libs" = yes; then $echo "enable shared libraries" else $echo "disable shared libraries" fi if test "$build_old_libs" = yes; then $echo "enable static libraries" else $echo "disable static libraries" fi exit $EXIT_SUCCESS ;; --finish) mode="finish" ;; --mode) prevopt="--mode" prev=mode ;; --mode=*) mode="$optarg" ;; --preserve-dup-deps) duplicate_deps="yes" ;; --quiet | --silent) show=: preserve_args="$preserve_args $arg" ;; --tag) prevopt="--tag" prev=tag ;; --tag=*) set tag "$optarg" ${1+"$@"} shift prev=tag preserve_args="$preserve_args --tag" ;; -dlopen) prevopt="-dlopen" prev=execute_dlfiles ;; -*) $echo "$modename: unrecognized option \`$arg'" 1>&2 $echo "$help" 1>&2 exit $EXIT_FAILURE ;; *) nonopt="$arg" break ;; esac done if test -n "$prevopt"; then $echo "$modename: option \`$prevopt' requires an argument" 1>&2 $echo "$help" 1>&2 exit $EXIT_FAILURE fi # If this variable is set in any of the actions, the command in it # will be execed at the end. This prevents here-documents from being # left over by shells. exec_cmd= if test -z "$show_help"; then # Infer the operation mode. if test -z "$mode"; then $echo "*** Warning: inferring the mode of operation is deprecated." 1>&2 $echo "*** Future versions of Libtool will require -mode=MODE be specified." 1>&2 case $nonopt in *cc | cc* | *++ | gcc* | *-gcc* | g++* | xlc*) mode=link for arg do case $arg in -c) mode=compile break ;; esac done ;; *db | *dbx | *strace | *truss) mode=execute ;; *install*|cp|mv) mode=install ;; *rm) mode=uninstall ;; *) # If we have no mode, but dlfiles were specified, then do execute mode. test -n "$execute_dlfiles" && mode=execute # Just use the default operation mode. if test -z "$mode"; then if test -n "$nonopt"; then $echo "$modename: warning: cannot infer operation mode from \`$nonopt'" 1>&2 else $echo "$modename: warning: cannot infer operation mode without MODE-ARGS" 1>&2 fi fi ;; esac fi # Only execute mode is allowed to have -dlopen flags. if test -n "$execute_dlfiles" && test "$mode" != execute; then $echo "$modename: unrecognized option \`-dlopen'" 1>&2 $echo "$help" 1>&2 exit $EXIT_FAILURE fi # Change the help message to a mode-specific one. generic_help="$help" help="Try \`$modename --help --mode=$mode' for more information." # These modes are in order of execution frequency so that they run quickly. case $mode in # libtool compile mode compile) modename="$modename: compile" # Get the compilation command and the source file. base_compile= srcfile="$nonopt" # always keep a non-empty value in "srcfile" suppress_opt=yes suppress_output= arg_mode=normal libobj= later= for arg do case "$arg_mode" in arg ) # do not "continue". Instead, add this to base_compile lastarg="$arg" arg_mode=normal ;; target ) libobj="$arg" arg_mode=normal continue ;; normal ) # Accept any command-line options. case $arg in -o) if test -n "$libobj" ; then $echo "$modename: you cannot specify \`-o' more than once" 1>&2 exit $EXIT_FAILURE fi arg_mode=target continue ;; -static | -prefer-pic | -prefer-non-pic) later="$later $arg" continue ;; -no-suppress) suppress_opt=no continue ;; -Xcompiler) arg_mode=arg # the next one goes into the "base_compile" arg list continue # The current "srcfile" will either be retained or ;; # replaced later. I would guess that would be a bug. -Wc,*) args=`$echo "X$arg" | $Xsed -e "s/^-Wc,//"` lastarg= save_ifs="$IFS"; IFS=',' for arg in $args; do IFS="$save_ifs" # Double-quote args containing other shell metacharacters. # Many Bourne shells cannot handle close brackets correctly # in scan sets, so we specify it separately. case $arg in *[\[\~\#\^\&\*\(\)\{\}\|\;\<\>\?\'\ \ ]*|*]*|"") arg="\"$arg\"" ;; esac lastarg="$lastarg $arg" done IFS="$save_ifs" lastarg=`$echo "X$lastarg" | $Xsed -e "s/^ //"` # Add the arguments to base_compile. base_compile="$base_compile $lastarg" continue ;; * ) # Accept the current argument as the source file. # The previous "srcfile" becomes the current argument. # lastarg="$srcfile" srcfile="$arg" ;; esac # case $arg ;; esac # case $arg_mode # Aesthetically quote the previous argument. lastarg=`$echo "X$lastarg" | $Xsed -e "$sed_quote_subst"` case $lastarg in # Double-quote args containing other shell metacharacters. # Many Bourne shells cannot handle close brackets correctly # in scan sets, so we specify it separately. *[\[\~\#\^\&\*\(\)\{\}\|\;\<\>\?\'\ \ ]*|*]*|"") lastarg="\"$lastarg\"" ;; esac base_compile="$base_compile $lastarg" done # for arg case $arg_mode in arg) $echo "$modename: you must specify an argument for -Xcompile" exit $EXIT_FAILURE ;; target) $echo "$modename: you must specify a target with \`-o'" 1>&2 exit $EXIT_FAILURE ;; *) # Get the name of the library object. [ -z "$libobj" ] && libobj=`$echo "X$srcfile" | $Xsed -e 's%^.*/%%'` ;; esac # Recognize several different file suffixes. # If the user specifies -o file.o, it is replaced with file.lo xform='[cCFSifmso]' case $libobj in *.ada) xform=ada ;; *.adb) xform=adb ;; *.ads) xform=ads ;; *.asm) xform=asm ;; *.c++) xform=c++ ;; *.cc) xform=cc ;; *.ii) xform=ii ;; *.class) xform=class ;; *.cpp) xform=cpp ;; *.cxx) xform=cxx ;; *.f90) xform=f90 ;; *.for) xform=for ;; *.java) xform=java ;; esac libobj=`$echo "X$libobj" | $Xsed -e "s/\.$xform$/.lo/"` case $libobj in *.lo) obj=`$echo "X$libobj" | $Xsed -e "$lo2o"` ;; *) $echo "$modename: cannot determine name of library object from \`$libobj'" 1>&2 exit $EXIT_FAILURE ;; esac func_infer_tag $base_compile for arg in $later; do case $arg in -static) build_old_libs=yes continue ;; -prefer-pic) pic_mode=yes continue ;; -prefer-non-pic) pic_mode=no continue ;; esac done objname=`$echo "X$obj" | $Xsed -e 's%^.*/%%'` xdir=`$echo "X$obj" | $Xsed -e 's%/[^/]*$%%'` if test "X$xdir" = "X$obj"; then xdir= else xdir=$xdir/ fi lobj=${xdir}$objdir/$objname if test -z "$base_compile"; then $echo "$modename: you must specify a compilation command" 1>&2 $echo "$help" 1>&2 exit $EXIT_FAILURE fi # Delete any leftover library objects. if test "$build_old_libs" = yes; then removelist="$obj $lobj $libobj ${libobj}T" else removelist="$lobj $libobj ${libobj}T" fi $run $rm $removelist trap "$run $rm $removelist; exit $EXIT_FAILURE" 1 2 15 # On Cygwin there's no "real" PIC flag so we must build both object types case $host_os in cygwin* | mingw* | pw32* | os2*) pic_mode=default ;; esac if test "$pic_mode" = no && test "$deplibs_check_method" != pass_all; then # non-PIC code in shared libraries is not supported pic_mode=default fi # Calculate the filename of the output object if compiler does # not support -o with -c if test "$compiler_c_o" = no; then output_obj=`$echo "X$srcfile" | $Xsed -e 's%^.*/%%' -e 's%\.[^.]*$%%'`.${objext} lockfile="$output_obj.lock" removelist="$removelist $output_obj $lockfile" trap "$run $rm $removelist; exit $EXIT_FAILURE" 1 2 15 else output_obj= need_locks=no lockfile= fi # Lock this critical section if it is needed # We use this script file to make the link, it avoids creating a new file if test "$need_locks" = yes; then until $run ln "$progpath" "$lockfile" 2>/dev/null; do $show "Waiting for $lockfile to be removed" sleep 2 done elif test "$need_locks" = warn; then if test -f "$lockfile"; then $echo "\ *** ERROR, $lockfile exists and contains: `cat $lockfile 2>/dev/null` This indicates that another process is trying to use the same temporary object file, and libtool could not work around it because your compiler does not support \`-c' and \`-o' together. If you repeat this compilation, it may succeed, by chance, but you had better avoid parallel builds (make -j) in this platform, or get a better compiler." $run $rm $removelist exit $EXIT_FAILURE fi $echo $srcfile > "$lockfile" fi if test -n "$fix_srcfile_path"; then eval srcfile=\"$fix_srcfile_path\" fi $run $rm "$libobj" "${libobj}T" # Create a libtool object file (analogous to a ".la" file), # but don't create it if we're doing a dry run. test -z "$run" && cat > ${libobj}T </dev/null`" != "X$srcfile"; then $echo "\ *** ERROR, $lockfile contains: `cat $lockfile 2>/dev/null` but it should contain: $srcfile This indicates that another process is trying to use the same temporary object file, and libtool could not work around it because your compiler does not support \`-c' and \`-o' together. If you repeat this compilation, it may succeed, by chance, but you had better avoid parallel builds (make -j) in this platform, or get a better compiler." $run $rm $removelist exit $EXIT_FAILURE fi # Just move the object if needed, then go on to compile the next one if test -n "$output_obj" && test "X$output_obj" != "X$lobj"; then $show "$mv $output_obj $lobj" if $run $mv $output_obj $lobj; then : else error=$? $run $rm $removelist exit $error fi fi # Append the name of the PIC object to the libtool object file. test -z "$run" && cat >> ${libobj}T <> ${libobj}T </dev/null`" != "X$srcfile"; then $echo "\ *** ERROR, $lockfile contains: `cat $lockfile 2>/dev/null` but it should contain: $srcfile This indicates that another process is trying to use the same temporary object file, and libtool could not work around it because your compiler does not support \`-c' and \`-o' together. If you repeat this compilation, it may succeed, by chance, but you had better avoid parallel builds (make -j) in this platform, or get a better compiler." $run $rm $removelist exit $EXIT_FAILURE fi # Just move the object if needed if test -n "$output_obj" && test "X$output_obj" != "X$obj"; then $show "$mv $output_obj $obj" if $run $mv $output_obj $obj; then : else error=$? $run $rm $removelist exit $error fi fi # Append the name of the non-PIC object the libtool object file. # Only append if the libtool object file exists. test -z "$run" && cat >> ${libobj}T <> ${libobj}T <&2 fi if test -n "$link_static_flag"; then dlopen_self=$dlopen_self_static fi else if test -z "$pic_flag" && test -n "$link_static_flag"; then dlopen_self=$dlopen_self_static fi fi build_libtool_libs=no build_old_libs=yes prefer_static_libs=yes break ;; esac done # See if our shared archives depend on static archives. test -n "$old_archive_from_new_cmds" && build_old_libs=yes # Go through the arguments, transforming them on the way. while test "$#" -gt 0; do arg="$1" shift case $arg in *[\[\~\#\^\&\*\(\)\{\}\|\;\<\>\?\'\ \ ]*|*]*|"") qarg=\"`$echo "X$arg" | $Xsed -e "$sed_quote_subst"`\" ### testsuite: skip nested quoting test ;; *) qarg=$arg ;; esac libtool_args="$libtool_args $qarg" # If the previous option needs an argument, assign it. if test -n "$prev"; then case $prev in output) compile_command="$compile_command @OUTPUT@" finalize_command="$finalize_command @OUTPUT@" ;; esac case $prev in dlfiles|dlprefiles) if test "$preload" = no; then # Add the symbol object into the linking commands. compile_command="$compile_command @SYMFILE@" finalize_command="$finalize_command @SYMFILE@" preload=yes fi case $arg in *.la | *.lo) ;; # We handle these cases below. force) if test "$dlself" = no; then dlself=needless export_dynamic=yes fi prev= continue ;; self) if test "$prev" = dlprefiles; then dlself=yes elif test "$prev" = dlfiles && test "$dlopen_self" != yes; then dlself=yes else dlself=needless export_dynamic=yes fi prev= continue ;; *) if test "$prev" = dlfiles; then dlfiles="$dlfiles $arg" else dlprefiles="$dlprefiles $arg" fi prev= continue ;; esac ;; expsyms) export_symbols="$arg" if test ! -f "$arg"; then $echo "$modename: symbol file \`$arg' does not exist" exit $EXIT_FAILURE fi prev= continue ;; expsyms_regex) export_symbols_regex="$arg" prev= continue ;; inst_prefix) inst_prefix_dir="$arg" prev= continue ;; precious_regex) precious_files_regex="$arg" prev= continue ;; release) release="-$arg" prev= continue ;; objectlist) if test -f "$arg"; then save_arg=$arg moreargs= for fil in `cat $save_arg` do # moreargs="$moreargs $fil" arg=$fil # A libtool-controlled object. # Check to see that this really is a libtool object. if (${SED} -e '2q' $arg | grep "^# Generated by .*$PACKAGE") >/dev/null 2>&1; then pic_object= non_pic_object= # Read the .lo file # If there is no directory component, then add one. case $arg in */* | *\\*) . $arg ;; *) . ./$arg ;; esac if test -z "$pic_object" || \ test -z "$non_pic_object" || test "$pic_object" = none && \ test "$non_pic_object" = none; then $echo "$modename: cannot find name of object for \`$arg'" 1>&2 exit $EXIT_FAILURE fi # Extract subdirectory from the argument. xdir=`$echo "X$arg" | $Xsed -e 's%/[^/]*$%%'` if test "X$xdir" = "X$arg"; then xdir= else xdir="$xdir/" fi if test "$pic_object" != none; then # Prepend the subdirectory the object is found in. pic_object="$xdir$pic_object" if test "$prev" = dlfiles; then if test "$build_libtool_libs" = yes && test "$dlopen_support" = yes; then dlfiles="$dlfiles $pic_object" prev= continue else # If libtool objects are unsupported, then we need to preload. prev=dlprefiles fi fi # CHECK ME: I think I busted this. -Ossama if test "$prev" = dlprefiles; then # Preload the old-style object. dlprefiles="$dlprefiles $pic_object" prev= fi # A PIC object. libobjs="$libobjs $pic_object" arg="$pic_object" fi # Non-PIC object. if test "$non_pic_object" != none; then # Prepend the subdirectory the object is found in. non_pic_object="$xdir$non_pic_object" # A standard non-PIC object non_pic_objects="$non_pic_objects $non_pic_object" if test -z "$pic_object" || test "$pic_object" = none ; then arg="$non_pic_object" fi fi else # Only an error if not doing a dry-run. if test -z "$run"; then $echo "$modename: \`$arg' is not a valid libtool object" 1>&2 exit $EXIT_FAILURE else # Dry-run case. # Extract subdirectory from the argument. xdir=`$echo "X$arg" | $Xsed -e 's%/[^/]*$%%'` if test "X$xdir" = "X$arg"; then xdir= else xdir="$xdir/" fi pic_object=`$echo "X${xdir}${objdir}/${arg}" | $Xsed -e "$lo2o"` non_pic_object=`$echo "X${xdir}${arg}" | $Xsed -e "$lo2o"` libobjs="$libobjs $pic_object" non_pic_objects="$non_pic_objects $non_pic_object" fi fi done else $echo "$modename: link input file \`$save_arg' does not exist" exit $EXIT_FAILURE fi arg=$save_arg prev= continue ;; rpath | xrpath) # We need an absolute path. case $arg in [\\/]* | [A-Za-z]:[\\/]*) ;; *) $echo "$modename: only absolute run-paths are allowed" 1>&2 exit $EXIT_FAILURE ;; esac if test "$prev" = rpath; then case "$rpath " in *" $arg "*) ;; *) rpath="$rpath $arg" ;; esac else case "$xrpath " in *" $arg "*) ;; *) xrpath="$xrpath $arg" ;; esac fi prev= continue ;; xcompiler) compiler_flags="$compiler_flags $qarg" prev= compile_command="$compile_command $qarg" finalize_command="$finalize_command $qarg" continue ;; xlinker) linker_flags="$linker_flags $qarg" compiler_flags="$compiler_flags $wl$qarg" prev= compile_command="$compile_command $wl$qarg" finalize_command="$finalize_command $wl$qarg" continue ;; xcclinker) linker_flags="$linker_flags $qarg" compiler_flags="$compiler_flags $qarg" prev= compile_command="$compile_command $qarg" finalize_command="$finalize_command $qarg" continue ;; shrext) shrext_cmds="$arg" prev= continue ;; *) eval "$prev=\"\$arg\"" prev= continue ;; esac fi # test -n "$prev" prevarg="$arg" case $arg in -all-static) if test -n "$link_static_flag"; then compile_command="$compile_command $link_static_flag" finalize_command="$finalize_command $link_static_flag" fi continue ;; -allow-undefined) # FIXME: remove this flag sometime in the future. $echo "$modename: \`-allow-undefined' is deprecated because it is the default" 1>&2 continue ;; -avoid-version) avoid_version=yes continue ;; -dlopen) prev=dlfiles continue ;; -dlpreopen) prev=dlprefiles continue ;; -export-dynamic) export_dynamic=yes continue ;; -export-symbols | -export-symbols-regex) if test -n "$export_symbols" || test -n "$export_symbols_regex"; then $echo "$modename: more than one -exported-symbols argument is not allowed" exit $EXIT_FAILURE fi if test "X$arg" = "X-export-symbols"; then prev=expsyms else prev=expsyms_regex fi continue ;; -inst-prefix-dir) prev=inst_prefix continue ;; # The native IRIX linker understands -LANG:*, -LIST:* and -LNO:* # so, if we see these flags be careful not to treat them like -L -L[A-Z][A-Z]*:*) case $with_gcc/$host in no/*-*-irix* | /*-*-irix*) compile_command="$compile_command $arg" finalize_command="$finalize_command $arg" ;; esac continue ;; -L*) dir=`$echo "X$arg" | $Xsed -e 's/^-L//'` # We need an absolute path. case $dir in [\\/]* | [A-Za-z]:[\\/]*) ;; *) absdir=`cd "$dir" && pwd` if test -z "$absdir"; then $echo "$modename: cannot determine absolute directory name of \`$dir'" 1>&2 exit $EXIT_FAILURE fi dir="$absdir" ;; esac case "$deplibs " in *" -L$dir "*) ;; *) deplibs="$deplibs -L$dir" lib_search_path="$lib_search_path $dir" ;; esac case $host in *-*-cygwin* | *-*-mingw* | *-*-pw32* | *-*-os2*) case :$dllsearchpath: in *":$dir:"*) ;; *) dllsearchpath="$dllsearchpath:$dir";; esac ;; esac continue ;; -l*) if test "X$arg" = "X-lc" || test "X$arg" = "X-lm"; then case $host in *-*-cygwin* | *-*-pw32* | *-*-beos*) # These systems don't actually have a C or math library (as such) continue ;; *-*-mingw* | *-*-os2*) # These systems don't actually have a C library (as such) test "X$arg" = "X-lc" && continue ;; *-*-openbsd* | *-*-freebsd*) # Do not include libc due to us having libc/libc_r. test "X$arg" = "X-lc" && continue ;; *-*-rhapsody* | *-*-darwin1.[012]) # Rhapsody C and math libraries are in the System framework deplibs="$deplibs -framework System" continue esac elif test "X$arg" = "X-lc_r"; then case $host in *-*-openbsd* | *-*-freebsd4*) # Do not include libc_r directly, use -pthread flag. continue ;; esac fi deplibs="$deplibs $arg" continue ;; -mt|-mthreads|-kthread|-Kthread|-pthread|-pthreads|--thread-safe) deplibs="$deplibs $arg" continue ;; -module) module=yes case $host in *-*-freebsd*) # Do not build the useless static library build_old_libs=no ;; esac continue ;; # gcc -m* arguments should be passed to the linker via $compiler_flags # in order to pass architecture information to the linker # (e.g. 32 vs 64-bit). This may also be accomplished via -Wl,-mfoo # but this is not reliable with gcc because gcc may use -mfoo to # select a different linker, different libraries, etc, while # -Wl,-mfoo simply passes -mfoo to the linker. -m*) # Unknown arguments in both finalize_command and compile_command need # to be aesthetically quoted because they are evaled later. arg=`$echo "X$arg" | $Xsed -e "$sed_quote_subst"` case $arg in *[\[\~\#\^\&\*\(\)\{\}\|\;\<\>\?\'\ \ ]*|*]*|"") arg="\"$arg\"" ;; esac compile_command="$compile_command $arg" finalize_command="$finalize_command $arg" if test "$with_gcc" = "yes" ; then compiler_flags="$compiler_flags $arg" fi continue ;; -shrext) prev=shrext continue ;; -no-fast-install) fast_install=no continue ;; -no-install) case $host in *-*-cygwin* | *-*-mingw* | *-*-pw32* | *-*-os2*) # The PATH hackery in wrapper scripts is required on Windows # in order for the loader to find any dlls it needs. $echo "$modename: warning: \`-no-install' is ignored for $host" 1>&2 $echo "$modename: warning: assuming \`-no-fast-install' instead" 1>&2 fast_install=no ;; *) no_install=yes ;; esac continue ;; -no-undefined) allow_undefined=no continue ;; -objectlist) prev=objectlist continue ;; -o) prev=output ;; -precious-files-regex) prev=precious_regex continue ;; -release) prev=release continue ;; -rpath) prev=rpath continue ;; -R) prev=xrpath continue ;; -R*) dir=`$echo "X$arg" | $Xsed -e 's/^-R//'` # We need an absolute path. case $dir in [\\/]* | [A-Za-z]:[\\/]*) ;; *) $echo "$modename: only absolute run-paths are allowed" 1>&2 exit $EXIT_FAILURE ;; esac case "$xrpath " in *" $dir "*) ;; *) xrpath="$xrpath $dir" ;; esac continue ;; -static) # The effects of -static are defined in a previous loop. # We used to do the same as -all-static on platforms that # didn't have a PIC flag, but the assumption that the effects # would be equivalent was wrong. It would break on at least # Digital Unix and AIX. continue ;; -thread-safe) thread_safe=yes continue ;; -version-info) prev=vinfo continue ;; -version-number) prev=vinfo vinfo_number=yes continue ;; -Wc,*) args=`$echo "X$arg" | $Xsed -e "$sed_quote_subst" -e 's/^-Wc,//'` arg= save_ifs="$IFS"; IFS=',' for flag in $args; do IFS="$save_ifs" case $flag in *[\[\~\#\^\&\*\(\)\{\}\|\;\<\>\?\'\ \ ]*|*]*|"") flag="\"$flag\"" ;; esac arg="$arg $wl$flag" compiler_flags="$compiler_flags $flag" done IFS="$save_ifs" arg=`$echo "X$arg" | $Xsed -e "s/^ //"` ;; -Wl,*) args=`$echo "X$arg" | $Xsed -e "$sed_quote_subst" -e 's/^-Wl,//'` arg= save_ifs="$IFS"; IFS=',' for flag in $args; do IFS="$save_ifs" case $flag in *[\[\~\#\^\&\*\(\)\{\}\|\;\<\>\?\'\ \ ]*|*]*|"") flag="\"$flag\"" ;; esac arg="$arg $wl$flag" compiler_flags="$compiler_flags $wl$flag" linker_flags="$linker_flags $flag" done IFS="$save_ifs" arg=`$echo "X$arg" | $Xsed -e "s/^ //"` ;; -Xcompiler) prev=xcompiler continue ;; -Xlinker) prev=xlinker continue ;; -XCClinker) prev=xcclinker continue ;; # Some other compiler flag. -* | +*) # Unknown arguments in both finalize_command and compile_command need # to be aesthetically quoted because they are evaled later. arg=`$echo "X$arg" | $Xsed -e "$sed_quote_subst"` case $arg in *[\[\~\#\^\&\*\(\)\{\}\|\;\<\>\?\'\ \ ]*|*]*|"") arg="\"$arg\"" ;; esac ;; *.$objext) # A standard object. objs="$objs $arg" ;; *.lo) # A libtool-controlled object. # Check to see that this really is a libtool object. if (${SED} -e '2q' $arg | grep "^# Generated by .*$PACKAGE") >/dev/null 2>&1; then pic_object= non_pic_object= # Read the .lo file # If there is no directory component, then add one. case $arg in */* | *\\*) . $arg ;; *) . ./$arg ;; esac if test -z "$pic_object" || \ test -z "$non_pic_object" || test "$pic_object" = none && \ test "$non_pic_object" = none; then $echo "$modename: cannot find name of object for \`$arg'" 1>&2 exit $EXIT_FAILURE fi # Extract subdirectory from the argument. xdir=`$echo "X$arg" | $Xsed -e 's%/[^/]*$%%'` if test "X$xdir" = "X$arg"; then xdir= else xdir="$xdir/" fi if test "$pic_object" != none; then # Prepend the subdirectory the object is found in. pic_object="$xdir$pic_object" if test "$prev" = dlfiles; then if test "$build_libtool_libs" = yes && test "$dlopen_support" = yes; then dlfiles="$dlfiles $pic_object" prev= continue else # If libtool objects are unsupported, then we need to preload. prev=dlprefiles fi fi # CHECK ME: I think I busted this. -Ossama if test "$prev" = dlprefiles; then # Preload the old-style object. dlprefiles="$dlprefiles $pic_object" prev= fi # A PIC object. libobjs="$libobjs $pic_object" arg="$pic_object" fi # Non-PIC object. if test "$non_pic_object" != none; then # Prepend the subdirectory the object is found in. non_pic_object="$xdir$non_pic_object" # A standard non-PIC object non_pic_objects="$non_pic_objects $non_pic_object" if test -z "$pic_object" || test "$pic_object" = none ; then arg="$non_pic_object" fi fi else # Only an error if not doing a dry-run. if test -z "$run"; then $echo "$modename: \`$arg' is not a valid libtool object" 1>&2 exit $EXIT_FAILURE else # Dry-run case. # Extract subdirectory from the argument. xdir=`$echo "X$arg" | $Xsed -e 's%/[^/]*$%%'` if test "X$xdir" = "X$arg"; then xdir= else xdir="$xdir/" fi pic_object=`$echo "X${xdir}${objdir}/${arg}" | $Xsed -e "$lo2o"` non_pic_object=`$echo "X${xdir}${arg}" | $Xsed -e "$lo2o"` libobjs="$libobjs $pic_object" non_pic_objects="$non_pic_objects $non_pic_object" fi fi ;; *.$libext) # An archive. deplibs="$deplibs $arg" old_deplibs="$old_deplibs $arg" continue ;; *.la) # A libtool-controlled library. if test "$prev" = dlfiles; then # This library was specified with -dlopen. dlfiles="$dlfiles $arg" prev= elif test "$prev" = dlprefiles; then # The library was specified with -dlpreopen. dlprefiles="$dlprefiles $arg" prev= else deplibs="$deplibs $arg" fi continue ;; # Some other compiler argument. *) # Unknown arguments in both finalize_command and compile_command need # to be aesthetically quoted because they are evaled later. arg=`$echo "X$arg" | $Xsed -e "$sed_quote_subst"` case $arg in *[\[\~\#\^\&\*\(\)\{\}\|\;\<\>\?\'\ \ ]*|*]*|"") arg="\"$arg\"" ;; esac ;; esac # arg # Now actually substitute the argument into the commands. if test -n "$arg"; then compile_command="$compile_command $arg" finalize_command="$finalize_command $arg" fi done # argument parsing loop if test -n "$prev"; then $echo "$modename: the \`$prevarg' option requires an argument" 1>&2 $echo "$help" 1>&2 exit $EXIT_FAILURE fi if test "$export_dynamic" = yes && test -n "$export_dynamic_flag_spec"; then eval arg=\"$export_dynamic_flag_spec\" compile_command="$compile_command $arg" finalize_command="$finalize_command $arg" fi oldlibs= # calculate the name of the file, without its directory outputname=`$echo "X$output" | $Xsed -e 's%^.*/%%'` libobjs_save="$libobjs" if test -n "$shlibpath_var"; then # get the directories listed in $shlibpath_var eval shlib_search_path=\`\$echo \"X\${$shlibpath_var}\" \| \$Xsed -e \'s/:/ /g\'\` else shlib_search_path= fi eval sys_lib_search_path=\"$sys_lib_search_path_spec\" eval sys_lib_dlsearch_path=\"$sys_lib_dlsearch_path_spec\" output_objdir=`$echo "X$output" | $Xsed -e 's%/[^/]*$%%'` if test "X$output_objdir" = "X$output"; then output_objdir="$objdir" else output_objdir="$output_objdir/$objdir" fi # Create the object directory. if test ! -d "$output_objdir"; then $show "$mkdir $output_objdir" $run $mkdir $output_objdir status=$? if test "$status" -ne 0 && test ! -d "$output_objdir"; then exit $status fi fi # Determine the type of output case $output in "") $echo "$modename: you must specify an output file" 1>&2 $echo "$help" 1>&2 exit $EXIT_FAILURE ;; *.$libext) linkmode=oldlib ;; *.lo | *.$objext) linkmode=obj ;; *.la) linkmode=lib ;; *) linkmode=prog ;; # Anything else should be a program. esac case $host in *cygwin* | *mingw* | *pw32*) # don't eliminate duplications in $postdeps and $predeps duplicate_compiler_generated_deps=yes ;; *) duplicate_compiler_generated_deps=$duplicate_deps ;; esac specialdeplibs= libs= # Find all interdependent deplibs by searching for libraries # that are linked more than once (e.g. -la -lb -la) for deplib in $deplibs; do if test "X$duplicate_deps" = "Xyes" ; then case "$libs " in *" $deplib "*) specialdeplibs="$specialdeplibs $deplib" ;; esac fi libs="$libs $deplib" done if test "$linkmode" = lib; then libs="$predeps $libs $compiler_lib_search_path $postdeps" # Compute libraries that are listed more than once in $predeps # $postdeps and mark them as special (i.e., whose duplicates are # not to be eliminated). pre_post_deps= if test "X$duplicate_compiler_generated_deps" = "Xyes" ; then for pre_post_dep in $predeps $postdeps; do case "$pre_post_deps " in *" $pre_post_dep "*) specialdeplibs="$specialdeplibs $pre_post_deps" ;; esac pre_post_deps="$pre_post_deps $pre_post_dep" done fi pre_post_deps= fi deplibs= newdependency_libs= newlib_search_path= need_relink=no # whether we're linking any uninstalled libtool libraries notinst_deplibs= # not-installed libtool libraries notinst_path= # paths that contain not-installed libtool libraries case $linkmode in lib) passes="conv link" for file in $dlfiles $dlprefiles; do case $file in *.la) ;; *) $echo "$modename: libraries can \`-dlopen' only libtool libraries: $file" 1>&2 exit $EXIT_FAILURE ;; esac done ;; prog) compile_deplibs= finalize_deplibs= alldeplibs=no newdlfiles= newdlprefiles= passes="conv scan dlopen dlpreopen link" ;; *) passes="conv" ;; esac for pass in $passes; do if test "$linkmode,$pass" = "lib,link" || test "$linkmode,$pass" = "prog,scan"; then libs="$deplibs" deplibs= fi if test "$linkmode" = prog; then case $pass in dlopen) libs="$dlfiles" ;; dlpreopen) libs="$dlprefiles" ;; link) libs="$deplibs %DEPLIBS% $dependency_libs" ;; esac fi if test "$pass" = dlopen; then # Collect dlpreopened libraries save_deplibs="$deplibs" deplibs= fi for deplib in $libs; do lib= found=no case $deplib in -mt|-mthreads|-kthread|-Kthread|-pthread|-pthreads|--thread-safe) if test "$linkmode,$pass" = "prog,link"; then compile_deplibs="$deplib $compile_deplibs" finalize_deplibs="$deplib $finalize_deplibs" else deplibs="$deplib $deplibs" test "$linkmode" = lib && newdependency_libs="$deplib $newdependency_libs" fi continue ;; -l*) if test "$linkmode" != lib && test "$linkmode" != prog; then $echo "$modename: warning: \`-l' is ignored for archives/objects" 1>&2 continue fi if test "$pass" = conv; then deplibs="$deplib $deplibs" continue fi name=`$echo "X$deplib" | $Xsed -e 's/^-l//'` for searchdir in $newlib_search_path $lib_search_path $sys_lib_search_path $shlib_search_path; do for search_ext in .la $std_shrext .so .a; do # Search the libtool library lib="$searchdir/lib${name}${search_ext}" if test -f "$lib"; then if test "$search_ext" = ".la"; then found=yes else found=no fi break 2 fi done done if test "$found" != yes; then # deplib doesn't seem to be a libtool library if test "$linkmode,$pass" = "prog,link"; then compile_deplibs="$deplib $compile_deplibs" finalize_deplibs="$deplib $finalize_deplibs" else deplibs="$deplib $deplibs" test "$linkmode" = lib && newdependency_libs="$deplib $newdependency_libs" fi continue else # deplib is a libtool library # If $allow_libtool_libs_with_static_runtimes && $deplib is a stdlib, # We need to do some special things here, and not later. if test "X$allow_libtool_libs_with_static_runtimes" = "Xyes" ; then case " $predeps $postdeps " in *" $deplib "*) if (${SED} -e '2q' $lib | grep "^# Generated by .*$PACKAGE") >/dev/null 2>&1; then library_names= old_library= case $lib in */* | *\\*) . $lib ;; *) . ./$lib ;; esac for l in $old_library $library_names; do ll="$l" done if test "X$ll" = "X$old_library" ; then # only static version available found=no ladir=`$echo "X$lib" | $Xsed -e 's%/[^/]*$%%'` test "X$ladir" = "X$lib" && ladir="." lib=$ladir/$old_library if test "$linkmode,$pass" = "prog,link"; then compile_deplibs="$deplib $compile_deplibs" finalize_deplibs="$deplib $finalize_deplibs" else deplibs="$deplib $deplibs" test "$linkmode" = lib && newdependency_libs="$deplib $newdependency_libs" fi continue fi fi ;; *) ;; esac fi fi ;; # -l -L*) case $linkmode in lib) deplibs="$deplib $deplibs" test "$pass" = conv && continue newdependency_libs="$deplib $newdependency_libs" newlib_search_path="$newlib_search_path "`$echo "X$deplib" | $Xsed -e 's/^-L//'` ;; prog) if test "$pass" = conv; then deplibs="$deplib $deplibs" continue fi if test "$pass" = scan; then deplibs="$deplib $deplibs" else compile_deplibs="$deplib $compile_deplibs" finalize_deplibs="$deplib $finalize_deplibs" fi newlib_search_path="$newlib_search_path "`$echo "X$deplib" | $Xsed -e 's/^-L//'` ;; *) $echo "$modename: warning: \`-L' is ignored for archives/objects" 1>&2 ;; esac # linkmode continue ;; # -L -R*) if test "$pass" = link; then dir=`$echo "X$deplib" | $Xsed -e 's/^-R//'` # Make sure the xrpath contains only unique directories. case "$xrpath " in *" $dir "*) ;; *) xrpath="$xrpath $dir" ;; esac fi deplibs="$deplib $deplibs" continue ;; *.la) lib="$deplib" ;; *.$libext) if test "$pass" = conv; then deplibs="$deplib $deplibs" continue fi case $linkmode in lib) valid_a_lib=no case $deplibs_check_method in match_pattern*) set dummy $deplibs_check_method match_pattern_regex=`expr "$deplibs_check_method" : "$2 \(.*\)"` if eval $echo \"$deplib\" 2>/dev/null \ | $SED 10q \ | $EGREP "$match_pattern_regex" > /dev/null; then valid_a_lib=yes fi ;; pass_all) valid_a_lib=yes ;; esac if test "$valid_a_lib" != yes; then $echo $echo "*** Warning: Trying to link with static lib archive $deplib." $echo "*** I have the capability to make that library automatically link in when" $echo "*** you link to this library. But I can only do this if you have a" $echo "*** shared version of the library, which you do not appear to have" $echo "*** because the file extensions .$libext of this argument makes me believe" $echo "*** that it is just a static archive that I should not used here." else $echo $echo "*** Warning: Linking the shared library $output against the" $echo "*** static library $deplib is not portable!" deplibs="$deplib $deplibs" fi continue ;; prog) if test "$pass" != link; then deplibs="$deplib $deplibs" else compile_deplibs="$deplib $compile_deplibs" finalize_deplibs="$deplib $finalize_deplibs" fi continue ;; esac # linkmode ;; # *.$libext *.lo | *.$objext) if test "$pass" = conv; then deplibs="$deplib $deplibs" elif test "$linkmode" = prog; then if test "$pass" = dlpreopen || test "$dlopen_support" != yes || test "$build_libtool_libs" = no; then # If there is no dlopen support or we're linking statically, # we need to preload. newdlprefiles="$newdlprefiles $deplib" compile_deplibs="$deplib $compile_deplibs" finalize_deplibs="$deplib $finalize_deplibs" else newdlfiles="$newdlfiles $deplib" fi fi continue ;; %DEPLIBS%) alldeplibs=yes continue ;; esac # case $deplib if test "$found" = yes || test -f "$lib"; then : else $echo "$modename: cannot find the library \`$lib'" 1>&2 exit $EXIT_FAILURE fi # Check to see that this really is a libtool archive. if (${SED} -e '2q' $lib | grep "^# Generated by .*$PACKAGE") >/dev/null 2>&1; then : else $echo "$modename: \`$lib' is not a valid libtool archive" 1>&2 exit $EXIT_FAILURE fi ladir=`$echo "X$lib" | $Xsed -e 's%/[^/]*$%%'` test "X$ladir" = "X$lib" && ladir="." dlname= dlopen= dlpreopen= libdir= library_names= old_library= # If the library was installed with an old release of libtool, # it will not redefine variables installed, or shouldnotlink installed=yes shouldnotlink=no # Read the .la file case $lib in */* | *\\*) . $lib ;; *) . ./$lib ;; esac if test "$linkmode,$pass" = "lib,link" || test "$linkmode,$pass" = "prog,scan" || { test "$linkmode" != prog && test "$linkmode" != lib; }; then test -n "$dlopen" && dlfiles="$dlfiles $dlopen" test -n "$dlpreopen" && dlprefiles="$dlprefiles $dlpreopen" fi if test "$pass" = conv; then # Only check for convenience libraries deplibs="$lib $deplibs" if test -z "$libdir"; then if test -z "$old_library"; then $echo "$modename: cannot find name of link library for \`$lib'" 1>&2 exit $EXIT_FAILURE fi # It is a libtool convenience library, so add in its objects. convenience="$convenience $ladir/$objdir/$old_library" old_convenience="$old_convenience $ladir/$objdir/$old_library" tmp_libs= for deplib in $dependency_libs; do deplibs="$deplib $deplibs" if test "X$duplicate_deps" = "Xyes" ; then case "$tmp_libs " in *" $deplib "*) specialdeplibs="$specialdeplibs $deplib" ;; esac fi tmp_libs="$tmp_libs $deplib" done elif test "$linkmode" != prog && test "$linkmode" != lib; then $echo "$modename: \`$lib' is not a convenience library" 1>&2 exit $EXIT_FAILURE fi continue fi # $pass = conv # Get the name of the library we link against. linklib= for l in $old_library $library_names; do linklib="$l" done if test -z "$linklib"; then $echo "$modename: cannot find name of link library for \`$lib'" 1>&2 exit $EXIT_FAILURE fi # This library was specified with -dlopen. if test "$pass" = dlopen; then if test -z "$libdir"; then $echo "$modename: cannot -dlopen a convenience library: \`$lib'" 1>&2 exit $EXIT_FAILURE fi if test -z "$dlname" || test "$dlopen_support" != yes || test "$build_libtool_libs" = no; then # If there is no dlname, no dlopen support or we're linking # statically, we need to preload. We also need to preload any # dependent libraries so libltdl's deplib preloader doesn't # bomb out in the load deplibs phase. dlprefiles="$dlprefiles $lib $dependency_libs" else newdlfiles="$newdlfiles $lib" fi continue fi # $pass = dlopen # We need an absolute path. case $ladir in [\\/]* | [A-Za-z]:[\\/]*) abs_ladir="$ladir" ;; *) abs_ladir=`cd "$ladir" && pwd` if test -z "$abs_ladir"; then $echo "$modename: warning: cannot determine absolute directory name of \`$ladir'" 1>&2 $echo "$modename: passing it literally to the linker, although it might fail" 1>&2 abs_ladir="$ladir" fi ;; esac laname=`$echo "X$lib" | $Xsed -e 's%^.*/%%'` # Find the relevant object directory and library name. if test "X$installed" = Xyes; then if test ! -f "$libdir/$linklib" && test -f "$abs_ladir/$linklib"; then $echo "$modename: warning: library \`$lib' was moved." 1>&2 dir="$ladir" absdir="$abs_ladir" libdir="$abs_ladir" else dir="$libdir" absdir="$libdir" fi else if test ! -f "$ladir/$objdir/$linklib" && test -f "$abs_ladir/$linklib"; then dir="$ladir" absdir="$abs_ladir" # Remove this search path later notinst_path="$notinst_path $abs_ladir" else dir="$ladir/$objdir" absdir="$abs_ladir/$objdir" # Remove this search path later notinst_path="$notinst_path $abs_ladir" fi fi # $installed = yes name=`$echo "X$laname" | $Xsed -e 's/\.la$//' -e 's/^lib//'` # This library was specified with -dlpreopen. if test "$pass" = dlpreopen; then if test -z "$libdir"; then $echo "$modename: cannot -dlpreopen a convenience library: \`$lib'" 1>&2 exit $EXIT_FAILURE fi # Prefer using a static library (so that no silly _DYNAMIC symbols # are required to link). if test -n "$old_library"; then newdlprefiles="$newdlprefiles $dir/$old_library" # Otherwise, use the dlname, so that lt_dlopen finds it. elif test -n "$dlname"; then newdlprefiles="$newdlprefiles $dir/$dlname" else newdlprefiles="$newdlprefiles $dir/$linklib" fi fi # $pass = dlpreopen if test -z "$libdir"; then # Link the convenience library if test "$linkmode" = lib; then deplibs="$dir/$old_library $deplibs" elif test "$linkmode,$pass" = "prog,link"; then compile_deplibs="$dir/$old_library $compile_deplibs" finalize_deplibs="$dir/$old_library $finalize_deplibs" else deplibs="$lib $deplibs" # used for prog,scan pass fi continue fi if test "$linkmode" = prog && test "$pass" != link; then newlib_search_path="$newlib_search_path $ladir" deplibs="$lib $deplibs" linkalldeplibs=no if test "$link_all_deplibs" != no || test -z "$library_names" || test "$build_libtool_libs" = no; then linkalldeplibs=yes fi tmp_libs= for deplib in $dependency_libs; do case $deplib in -L*) newlib_search_path="$newlib_search_path "`$echo "X$deplib" | $Xsed -e 's/^-L//'`;; ### testsuite: skip nested quoting test esac # Need to link against all dependency_libs? if test "$linkalldeplibs" = yes; then deplibs="$deplib $deplibs" else # Need to hardcode shared library paths # or/and link against static libraries newdependency_libs="$deplib $newdependency_libs" fi if test "X$duplicate_deps" = "Xyes" ; then case "$tmp_libs " in *" $deplib "*) specialdeplibs="$specialdeplibs $deplib" ;; esac fi tmp_libs="$tmp_libs $deplib" done # for deplib continue fi # $linkmode = prog... if test "$linkmode,$pass" = "prog,link"; then if test -n "$library_names" && { test "$prefer_static_libs" = no || test -z "$old_library"; }; then # We need to hardcode the library path if test -n "$shlibpath_var"; then # Make sure the rpath contains only unique directories. case "$temp_rpath " in *" $dir "*) ;; *" $absdir "*) ;; *) temp_rpath="$temp_rpath $dir" ;; esac fi # Hardcode the library path. # Skip directories that are in the system default run-time # search path. case " $sys_lib_dlsearch_path " in *" $absdir "*) ;; *) case "$compile_rpath " in *" $absdir "*) ;; *) compile_rpath="$compile_rpath $absdir" esac ;; esac case " $sys_lib_dlsearch_path " in *" $libdir "*) ;; *) case "$finalize_rpath " in *" $libdir "*) ;; *) finalize_rpath="$finalize_rpath $libdir" esac ;; esac fi # $linkmode,$pass = prog,link... if test "$alldeplibs" = yes && { test "$deplibs_check_method" = pass_all || { test "$build_libtool_libs" = yes && test -n "$library_names"; }; }; then # We only need to search for static libraries continue fi fi link_static=no # Whether the deplib will be linked statically if test -n "$library_names" && { test "$prefer_static_libs" = no || test -z "$old_library"; }; then if test "$installed" = no; then notinst_deplibs="$notinst_deplibs $lib" need_relink=yes fi # This is a shared library # Warn about portability, can't link against -module's on # some systems (darwin) if test "$shouldnotlink" = yes && test "$pass" = link ; then $echo if test "$linkmode" = prog; then $echo "*** Warning: Linking the executable $output against the loadable module" else $echo "*** Warning: Linking the shared library $output against the loadable module" fi $echo "*** $linklib is not portable!" fi if test "$linkmode" = lib && test "$hardcode_into_libs" = yes; then # Hardcode the library path. # Skip directories that are in the system default run-time # search path. case " $sys_lib_dlsearch_path " in *" $absdir "*) ;; *) case "$compile_rpath " in *" $absdir "*) ;; *) compile_rpath="$compile_rpath $absdir" esac ;; esac case " $sys_lib_dlsearch_path " in *" $libdir "*) ;; *) case "$finalize_rpath " in *" $libdir "*) ;; *) finalize_rpath="$finalize_rpath $libdir" esac ;; esac fi if test -n "$old_archive_from_expsyms_cmds"; then # figure out the soname set dummy $library_names realname="$2" shift; shift libname=`eval \\$echo \"$libname_spec\"` # use dlname if we got it. it's perfectly good, no? if test -n "$dlname"; then soname="$dlname" elif test -n "$soname_spec"; then # bleh windows case $host in *cygwin* | mingw*) major=`expr $current - $age` versuffix="-$major" ;; esac eval soname=\"$soname_spec\" else soname="$realname" fi # Make a new name for the extract_expsyms_cmds to use soroot="$soname" soname=`$echo $soroot | ${SED} -e 's/^.*\///'` newlib="libimp-`$echo $soname | ${SED} 's/^lib//;s/\.dll$//'`.a" # If the library has no export list, then create one now if test -f "$output_objdir/$soname-def"; then : else $show "extracting exported symbol list from \`$soname'" save_ifs="$IFS"; IFS='~' cmds=$extract_expsyms_cmds for cmd in $cmds; do IFS="$save_ifs" eval cmd=\"$cmd\" $show "$cmd" $run eval "$cmd" || exit $? done IFS="$save_ifs" fi # Create $newlib if test -f "$output_objdir/$newlib"; then :; else $show "generating import library for \`$soname'" save_ifs="$IFS"; IFS='~' cmds=$old_archive_from_expsyms_cmds for cmd in $cmds; do IFS="$save_ifs" eval cmd=\"$cmd\" $show "$cmd" $run eval "$cmd" || exit $? done IFS="$save_ifs" fi # make sure the library variables are pointing to the new library dir=$output_objdir linklib=$newlib fi # test -n "$old_archive_from_expsyms_cmds" if test "$linkmode" = prog || test "$mode" != relink; then add_shlibpath= add_dir= add= lib_linked=yes case $hardcode_action in immediate | unsupported) if test "$hardcode_direct" = no; then add="$dir/$linklib" case $host in *-*-sco3.2v5* ) add_dir="-L$dir" ;; *-*-darwin* ) # if the lib is a module then we can not link against # it, someone is ignoring the new warnings I added if /usr/bin/file -L $add 2> /dev/null | $EGREP "bundle" >/dev/null ; then $echo "** Warning, lib $linklib is a module, not a shared library" if test -z "$old_library" ; then $echo $echo "** And there doesn't seem to be a static archive available" $echo "** The link will probably fail, sorry" else add="$dir/$old_library" fi fi esac elif test "$hardcode_minus_L" = no; then case $host in *-*-sunos*) add_shlibpath="$dir" ;; esac add_dir="-L$dir" add="-l$name" elif test "$hardcode_shlibpath_var" = no; then add_shlibpath="$dir" add="-l$name" else lib_linked=no fi ;; relink) if test "$hardcode_direct" = yes; then add="$dir/$linklib" elif test "$hardcode_minus_L" = yes; then add_dir="-L$dir" # Try looking first in the location we're being installed to. if test -n "$inst_prefix_dir"; then case "$libdir" in [\\/]*) add_dir="$add_dir -L$inst_prefix_dir$libdir" ;; esac fi add="-l$name" elif test "$hardcode_shlibpath_var" = yes; then add_shlibpath="$dir" add="-l$name" else lib_linked=no fi ;; *) lib_linked=no ;; esac if test "$lib_linked" != yes; then $echo "$modename: configuration error: unsupported hardcode properties" exit $EXIT_FAILURE fi if test -n "$add_shlibpath"; then case :$compile_shlibpath: in *":$add_shlibpath:"*) ;; *) compile_shlibpath="$compile_shlibpath$add_shlibpath:" ;; esac fi if test "$linkmode" = prog; then test -n "$add_dir" && compile_deplibs="$add_dir $compile_deplibs" test -n "$add" && compile_deplibs="$add $compile_deplibs" else test -n "$add_dir" && deplibs="$add_dir $deplibs" test -n "$add" && deplibs="$add $deplibs" if test "$hardcode_direct" != yes && \ test "$hardcode_minus_L" != yes && \ test "$hardcode_shlibpath_var" = yes; then case :$finalize_shlibpath: in *":$libdir:"*) ;; *) finalize_shlibpath="$finalize_shlibpath$libdir:" ;; esac fi fi fi if test "$linkmode" = prog || test "$mode" = relink; then add_shlibpath= add_dir= add= # Finalize command for both is simple: just hardcode it. if test "$hardcode_direct" = yes; then add="$libdir/$linklib" elif test "$hardcode_minus_L" = yes; then add_dir="-L$libdir" add="-l$name" elif test "$hardcode_shlibpath_var" = yes; then case :$finalize_shlibpath: in *":$libdir:"*) ;; *) finalize_shlibpath="$finalize_shlibpath$libdir:" ;; esac add="-l$name" elif test "$hardcode_automatic" = yes; then if test -n "$inst_prefix_dir" && test -f "$inst_prefix_dir$libdir/$linklib" ; then add="$inst_prefix_dir$libdir/$linklib" else add="$libdir/$linklib" fi else # We cannot seem to hardcode it, guess we'll fake it. add_dir="-L$libdir" # Try looking first in the location we're being installed to. if test -n "$inst_prefix_dir"; then case "$libdir" in [\\/]*) add_dir="$add_dir -L$inst_prefix_dir$libdir" ;; esac fi add="-l$name" fi if test "$linkmode" = prog; then test -n "$add_dir" && finalize_deplibs="$add_dir $finalize_deplibs" test -n "$add" && finalize_deplibs="$add $finalize_deplibs" else test -n "$add_dir" && deplibs="$add_dir $deplibs" test -n "$add" && deplibs="$add $deplibs" fi fi elif test "$linkmode" = prog; then # Here we assume that one of hardcode_direct or hardcode_minus_L # is not unsupported. This is valid on all known static and # shared platforms. if test "$hardcode_direct" != unsupported; then test -n "$old_library" && linklib="$old_library" compile_deplibs="$dir/$linklib $compile_deplibs" finalize_deplibs="$dir/$linklib $finalize_deplibs" else compile_deplibs="-l$name -L$dir $compile_deplibs" finalize_deplibs="-l$name -L$dir $finalize_deplibs" fi elif test "$build_libtool_libs" = yes; then # Not a shared library if test "$deplibs_check_method" != pass_all; then # We're trying link a shared library against a static one # but the system doesn't support it. # Just print a warning and add the library to dependency_libs so # that the program can be linked against the static library. $echo $echo "*** Warning: This system can not link to static lib archive $lib." $echo "*** I have the capability to make that library automatically link in when" $echo "*** you link to this library. But I can only do this if you have a" $echo "*** shared version of the library, which you do not appear to have." if test "$module" = yes; then $echo "*** But as you try to build a module library, libtool will still create " $echo "*** a static module, that should work as long as the dlopening application" $echo "*** is linked with the -dlopen flag to resolve symbols at runtime." if test -z "$global_symbol_pipe"; then $echo $echo "*** However, this would only work if libtool was able to extract symbol" $echo "*** lists from a program, using \`nm' or equivalent, but libtool could" $echo "*** not find such a program. So, this module is probably useless." $echo "*** \`nm' from GNU binutils and a full rebuild may help." fi if test "$build_old_libs" = no; then build_libtool_libs=module build_old_libs=yes else build_libtool_libs=no fi fi else convenience="$convenience $dir/$old_library" old_convenience="$old_convenience $dir/$old_library" deplibs="$dir/$old_library $deplibs" link_static=yes fi fi # link shared/static library? if test "$linkmode" = lib; then if test -n "$dependency_libs" && { test "$hardcode_into_libs" != yes || test "$build_old_libs" = yes || test "$link_static" = yes; }; then # Extract -R from dependency_libs temp_deplibs= for libdir in $dependency_libs; do case $libdir in -R*) temp_xrpath=`$echo "X$libdir" | $Xsed -e 's/^-R//'` case " $xrpath " in *" $temp_xrpath "*) ;; *) xrpath="$xrpath $temp_xrpath";; esac;; *) temp_deplibs="$temp_deplibs $libdir";; esac done dependency_libs="$temp_deplibs" fi newlib_search_path="$newlib_search_path $absdir" # Link against this library test "$link_static" = no && newdependency_libs="$abs_ladir/$laname $newdependency_libs" # ... and its dependency_libs tmp_libs= for deplib in $dependency_libs; do newdependency_libs="$deplib $newdependency_libs" if test "X$duplicate_deps" = "Xyes" ; then case "$tmp_libs " in *" $deplib "*) specialdeplibs="$specialdeplibs $deplib" ;; esac fi tmp_libs="$tmp_libs $deplib" done if test "$link_all_deplibs" != no; then # Add the search paths of all dependency libraries for deplib in $dependency_libs; do case $deplib in -L*) path="$deplib" ;; *.la) dir=`$echo "X$deplib" | $Xsed -e 's%/[^/]*$%%'` test "X$dir" = "X$deplib" && dir="." # We need an absolute path. case $dir in [\\/]* | [A-Za-z]:[\\/]*) absdir="$dir" ;; *) absdir=`cd "$dir" && pwd` if test -z "$absdir"; then $echo "$modename: warning: cannot determine absolute directory name of \`$dir'" 1>&2 absdir="$dir" fi ;; esac if grep "^installed=no" $deplib > /dev/null; then path="$absdir/$objdir" else eval libdir=`${SED} -n -e 's/^libdir=\(.*\)$/\1/p' $deplib` if test -z "$libdir"; then $echo "$modename: \`$deplib' is not a valid libtool archive" 1>&2 exit $EXIT_FAILURE fi if test "$absdir" != "$libdir"; then $echo "$modename: warning: \`$deplib' seems to be moved" 1>&2 fi path="$absdir" fi depdepl= case $host in *-*-darwin*) # we do not want to link against static libs, # but need to link against shared eval deplibrary_names=`${SED} -n -e 's/^library_names=\(.*\)$/\1/p' $deplib` if test -n "$deplibrary_names" ; then for tmp in $deplibrary_names ; do depdepl=$tmp done if test -f "$path/$depdepl" ; then depdepl="$path/$depdepl" fi # do not add paths which are already there case " $newlib_search_path " in *" $path "*) ;; *) newlib_search_path="$newlib_search_path $path";; esac fi path="" ;; *) path="-L$path" ;; esac ;; -l*) case $host in *-*-darwin*) # Again, we only want to link against shared libraries eval tmp_libs=`$echo "X$deplib" | $Xsed -e "s,^\-l,,"` for tmp in $newlib_search_path ; do if test -f "$tmp/lib$tmp_libs.dylib" ; then eval depdepl="$tmp/lib$tmp_libs.dylib" break fi done path="" ;; *) continue ;; esac ;; *) continue ;; esac case " $deplibs " in *" $depdepl "*) ;; *) deplibs="$depdepl $deplibs" ;; esac case " $deplibs " in *" $path "*) ;; *) deplibs="$deplibs $path" ;; esac done fi # link_all_deplibs != no fi # linkmode = lib done # for deplib in $libs dependency_libs="$newdependency_libs" if test "$pass" = dlpreopen; then # Link the dlpreopened libraries before other libraries for deplib in $save_deplibs; do deplibs="$deplib $deplibs" done fi if test "$pass" != dlopen; then if test "$pass" != conv; then # Make sure lib_search_path contains only unique directories. lib_search_path= for dir in $newlib_search_path; do case "$lib_search_path " in *" $dir "*) ;; *) lib_search_path="$lib_search_path $dir" ;; esac done newlib_search_path= fi if test "$linkmode,$pass" != "prog,link"; then vars="deplibs" else vars="compile_deplibs finalize_deplibs" fi for var in $vars dependency_libs; do # Add libraries to $var in reverse order eval tmp_libs=\"\$$var\" new_libs= for deplib in $tmp_libs; do # FIXME: Pedantically, this is the right thing to do, so # that some nasty dependency loop isn't accidentally # broken: #new_libs="$deplib $new_libs" # Pragmatically, this seems to cause very few problems in # practice: case $deplib in -L*) new_libs="$deplib $new_libs" ;; -R*) ;; *) # And here is the reason: when a library appears more # than once as an explicit dependence of a library, or # is implicitly linked in more than once by the # compiler, it is considered special, and multiple # occurrences thereof are not removed. Compare this # with having the same library being listed as a # dependency of multiple other libraries: in this case, # we know (pedantically, we assume) the library does not # need to be listed more than once, so we keep only the # last copy. This is not always right, but it is rare # enough that we require users that really mean to play # such unportable linking tricks to link the library # using -Wl,-lname, so that libtool does not consider it # for duplicate removal. case " $specialdeplibs " in *" $deplib "*) new_libs="$deplib $new_libs" ;; *) case " $new_libs " in *" $deplib "*) ;; *) new_libs="$deplib $new_libs" ;; esac ;; esac ;; esac done tmp_libs= for deplib in $new_libs; do case $deplib in -L*) case " $tmp_libs " in *" $deplib "*) ;; *) tmp_libs="$tmp_libs $deplib" ;; esac ;; *) tmp_libs="$tmp_libs $deplib" ;; esac done eval $var=\"$tmp_libs\" done # for var fi # Last step: remove runtime libs from dependency_libs # (they stay in deplibs) tmp_libs= for i in $dependency_libs ; do case " $predeps $postdeps $compiler_lib_search_path " in *" $i "*) i="" ;; esac if test -n "$i" ; then tmp_libs="$tmp_libs $i" fi done dependency_libs=$tmp_libs done # for pass if test "$linkmode" = prog; then dlfiles="$newdlfiles" dlprefiles="$newdlprefiles" fi case $linkmode in oldlib) if test -n "$deplibs"; then $echo "$modename: warning: \`-l' and \`-L' are ignored for archives" 1>&2 fi if test -n "$dlfiles$dlprefiles" || test "$dlself" != no; then $echo "$modename: warning: \`-dlopen' is ignored for archives" 1>&2 fi if test -n "$rpath"; then $echo "$modename: warning: \`-rpath' is ignored for archives" 1>&2 fi if test -n "$xrpath"; then $echo "$modename: warning: \`-R' is ignored for archives" 1>&2 fi if test -n "$vinfo"; then $echo "$modename: warning: \`-version-info/-version-number' is ignored for archives" 1>&2 fi if test -n "$release"; then $echo "$modename: warning: \`-release' is ignored for archives" 1>&2 fi if test -n "$export_symbols" || test -n "$export_symbols_regex"; then $echo "$modename: warning: \`-export-symbols' is ignored for archives" 1>&2 fi # Now set the variables for building old libraries. build_libtool_libs=no oldlibs="$output" objs="$objs$old_deplibs" ;; lib) # Make sure we only generate libraries of the form `libNAME.la'. case $outputname in lib*) name=`$echo "X$outputname" | $Xsed -e 's/\.la$//' -e 's/^lib//'` eval shared_ext=\"$shrext_cmds\" eval libname=\"$libname_spec\" ;; *) if test "$module" = no; then $echo "$modename: libtool library \`$output' must begin with \`lib'" 1>&2 $echo "$help" 1>&2 exit $EXIT_FAILURE fi if test "$need_lib_prefix" != no; then # Add the "lib" prefix for modules if required name=`$echo "X$outputname" | $Xsed -e 's/\.la$//'` eval shared_ext=\"$shrext_cmds\" eval libname=\"$libname_spec\" else libname=`$echo "X$outputname" | $Xsed -e 's/\.la$//'` fi ;; esac if test -n "$objs"; then if test "$deplibs_check_method" != pass_all; then $echo "$modename: cannot build libtool library \`$output' from non-libtool objects on this host:$objs" 2>&1 exit $EXIT_FAILURE else $echo $echo "*** Warning: Linking the shared library $output against the non-libtool" $echo "*** objects $objs is not portable!" libobjs="$libobjs $objs" fi fi if test "$dlself" != no; then $echo "$modename: warning: \`-dlopen self' is ignored for libtool libraries" 1>&2 fi set dummy $rpath if test "$#" -gt 2; then $echo "$modename: warning: ignoring multiple \`-rpath's for a libtool library" 1>&2 fi install_libdir="$2" oldlibs= if test -z "$rpath"; then if test "$build_libtool_libs" = yes; then # Building a libtool convenience library. # Some compilers have problems with a `.al' extension so # convenience libraries should have the same extension an # archive normally would. oldlibs="$output_objdir/$libname.$libext $oldlibs" build_libtool_libs=convenience build_old_libs=yes fi if test -n "$vinfo"; then $echo "$modename: warning: \`-version-info/-version-number' is ignored for convenience libraries" 1>&2 fi if test -n "$release"; then $echo "$modename: warning: \`-release' is ignored for convenience libraries" 1>&2 fi else # Parse the version information argument. save_ifs="$IFS"; IFS=':' set dummy $vinfo 0 0 0 IFS="$save_ifs" if test -n "$8"; then $echo "$modename: too many parameters to \`-version-info'" 1>&2 $echo "$help" 1>&2 exit $EXIT_FAILURE fi # convert absolute version numbers to libtool ages # this retains compatibility with .la files and attempts # to make the code below a bit more comprehensible case $vinfo_number in yes) number_major="$2" number_minor="$3" number_revision="$4" # # There are really only two kinds -- those that # use the current revision as the major version # and those that subtract age and use age as # a minor version. But, then there is irix # which has an extra 1 added just for fun # case $version_type in darwin|linux|osf|windows) current=`expr $number_major + $number_minor` age="$number_minor" revision="$number_revision" ;; freebsd-aout|freebsd-elf|sunos) current="$number_major" revision="$number_minor" age="0" ;; irix|nonstopux) current=`expr $number_major + $number_minor - 1` age="$number_minor" revision="$number_minor" ;; esac ;; no) current="$2" revision="$3" age="$4" ;; esac # Check that each of the things are valid numbers. case $current in 0 | [1-9] | [1-9][0-9] | [1-9][0-9][0-9]) ;; *) $echo "$modename: CURRENT \`$current' is not a nonnegative integer" 1>&2 $echo "$modename: \`$vinfo' is not valid version information" 1>&2 exit $EXIT_FAILURE ;; esac case $revision in 0 | [1-9] | [1-9][0-9] | [1-9][0-9][0-9]) ;; *) $echo "$modename: REVISION \`$revision' is not a nonnegative integer" 1>&2 $echo "$modename: \`$vinfo' is not valid version information" 1>&2 exit $EXIT_FAILURE ;; esac case $age in 0 | [1-9] | [1-9][0-9] | [1-9][0-9][0-9]) ;; *) $echo "$modename: AGE \`$age' is not a nonnegative integer" 1>&2 $echo "$modename: \`$vinfo' is not valid version information" 1>&2 exit $EXIT_FAILURE ;; esac if test "$age" -gt "$current"; then $echo "$modename: AGE \`$age' is greater than the current interface number \`$current'" 1>&2 $echo "$modename: \`$vinfo' is not valid version information" 1>&2 exit $EXIT_FAILURE fi # Calculate the version variables. major= versuffix= verstring= case $version_type in none) ;; darwin) # Like Linux, but with the current version available in # verstring for coding it into the library header major=.`expr $current - $age` versuffix="$major.$age.$revision" # Darwin ld doesn't like 0 for these options... minor_current=`expr $current + 1` verstring="${wl}-compatibility_version ${wl}$minor_current ${wl}-current_version ${wl}$minor_current.$revision" ;; freebsd-aout) major=".$current" versuffix=".$current.$revision"; ;; freebsd-elf) major=".$current" versuffix=".$current"; ;; irix | nonstopux) major=`expr $current - $age + 1` case $version_type in nonstopux) verstring_prefix=nonstopux ;; *) verstring_prefix=sgi ;; esac verstring="$verstring_prefix$major.$revision" # Add in all the interfaces that we are compatible with. loop=$revision while test "$loop" -ne 0; do iface=`expr $revision - $loop` loop=`expr $loop - 1` verstring="$verstring_prefix$major.$iface:$verstring" done # Before this point, $major must not contain `.'. major=.$major versuffix="$major.$revision" ;; linux) major=.`expr $current - $age` versuffix="$major.$age.$revision" ;; osf) major=.`expr $current - $age` versuffix=".$current.$age.$revision" verstring="$current.$age.$revision" # Add in all the interfaces that we are compatible with. loop=$age while test "$loop" -ne 0; do iface=`expr $current - $loop` loop=`expr $loop - 1` verstring="$verstring:${iface}.0" done # Make executables depend on our current version. verstring="$verstring:${current}.0" ;; sunos) major=".$current" versuffix=".$current.$revision" ;; windows) # Use '-' rather than '.', since we only want one # extension on DOS 8.3 filesystems. major=`expr $current - $age` versuffix="-$major" ;; *) $echo "$modename: unknown library version type \`$version_type'" 1>&2 $echo "Fatal configuration error. See the $PACKAGE docs for more information." 1>&2 exit $EXIT_FAILURE ;; esac # Clear the version info if we defaulted, and they specified a release. if test -z "$vinfo" && test -n "$release"; then major= case $version_type in darwin) # we can't check for "0.0" in archive_cmds due to quoting # problems, so we reset it completely verstring= ;; *) verstring="0.0" ;; esac if test "$need_version" = no; then versuffix= else versuffix=".0.0" fi fi # Remove version info from name if versioning should be avoided if test "$avoid_version" = yes && test "$need_version" = no; then major= versuffix= verstring="" fi # Check to see if the archive will have undefined symbols. if test "$allow_undefined" = yes; then if test "$allow_undefined_flag" = unsupported; then $echo "$modename: warning: undefined symbols not allowed in $host shared libraries" 1>&2 build_libtool_libs=no build_old_libs=yes fi else # Don't allow undefined symbols. allow_undefined_flag="$no_undefined_flag" fi fi if test "$mode" != relink; then # Remove our outputs, but don't remove object files since they # may have been created when compiling PIC objects. removelist= tempremovelist=`$echo "$output_objdir/*"` for p in $tempremovelist; do case $p in *.$objext) ;; $output_objdir/$outputname | $output_objdir/$libname.* | $output_objdir/${libname}${release}.*) if test "X$precious_files_regex" != "X"; then if echo $p | $EGREP -e "$precious_files_regex" >/dev/null 2>&1 then continue fi fi removelist="$removelist $p" ;; *) ;; esac done if test -n "$removelist"; then $show "${rm}r $removelist" $run ${rm}r $removelist fi fi # Now set the variables for building old libraries. if test "$build_old_libs" = yes && test "$build_libtool_libs" != convenience ; then oldlibs="$oldlibs $output_objdir/$libname.$libext" # Transform .lo files to .o files. oldobjs="$objs "`$echo "X$libobjs" | $SP2NL | $Xsed -e '/\.'${libext}'$/d' -e "$lo2o" | $NL2SP` fi # Eliminate all temporary directories. for path in $notinst_path; do lib_search_path=`$echo "$lib_search_path " | ${SED} -e 's% $path % %g'` deplibs=`$echo "$deplibs " | ${SED} -e 's% -L$path % %g'` dependency_libs=`$echo "$dependency_libs " | ${SED} -e 's% -L$path % %g'` done if test -n "$xrpath"; then # If the user specified any rpath flags, then add them. temp_xrpath= for libdir in $xrpath; do temp_xrpath="$temp_xrpath -R$libdir" case "$finalize_rpath " in *" $libdir "*) ;; *) finalize_rpath="$finalize_rpath $libdir" ;; esac done if test "$hardcode_into_libs" != yes || test "$build_old_libs" = yes; then dependency_libs="$temp_xrpath $dependency_libs" fi fi # Make sure dlfiles contains only unique files that won't be dlpreopened old_dlfiles="$dlfiles" dlfiles= for lib in $old_dlfiles; do case " $dlprefiles $dlfiles " in *" $lib "*) ;; *) dlfiles="$dlfiles $lib" ;; esac done # Make sure dlprefiles contains only unique files old_dlprefiles="$dlprefiles" dlprefiles= for lib in $old_dlprefiles; do case "$dlprefiles " in *" $lib "*) ;; *) dlprefiles="$dlprefiles $lib" ;; esac done if test "$build_libtool_libs" = yes; then if test -n "$rpath"; then case $host in *-*-cygwin* | *-*-mingw* | *-*-pw32* | *-*-os2* | *-*-beos*) # these systems don't actually have a c library (as such)! ;; *-*-rhapsody* | *-*-darwin1.[012]) # Rhapsody C library is in the System framework deplibs="$deplibs -framework System" ;; *-*-netbsd*) # Don't link with libc until the a.out ld.so is fixed. ;; *-*-openbsd* | *-*-freebsd*) # Do not include libc due to us having libc/libc_r. test "X$arg" = "X-lc" && continue ;; *) # Add libc to deplibs on all other systems if necessary. if test "$build_libtool_need_lc" = "yes"; then deplibs="$deplibs -lc" fi ;; esac fi # Transform deplibs into only deplibs that can be linked in shared. name_save=$name libname_save=$libname release_save=$release versuffix_save=$versuffix major_save=$major # I'm not sure if I'm treating the release correctly. I think # release should show up in the -l (ie -lgmp5) so we don't want to # add it in twice. Is that correct? release="" versuffix="" major="" newdeplibs= droppeddeps=no case $deplibs_check_method in pass_all) # Don't check for shared/static. Everything works. # This might be a little naive. We might want to check # whether the library exists or not. But this is on # osf3 & osf4 and I'm not really sure... Just # implementing what was already the behavior. newdeplibs=$deplibs ;; test_compile) # This code stresses the "libraries are programs" paradigm to its # limits. Maybe even breaks it. We compile a program, linking it # against the deplibs as a proxy for the library. Then we can check # whether they linked in statically or dynamically with ldd. $rm conftest.c cat > conftest.c </dev/null` for potent_lib in $potential_libs; do # Follow soft links. if ls -lLd "$potent_lib" 2>/dev/null \ | grep " -> " >/dev/null; then continue fi # The statement above tries to avoid entering an # endless loop below, in case of cyclic links. # We might still enter an endless loop, since a link # loop can be closed while we follow links, # but so what? potlib="$potent_lib" while test -h "$potlib" 2>/dev/null; do potliblink=`ls -ld $potlib | ${SED} 's/.* -> //'` case $potliblink in [\\/]* | [A-Za-z]:[\\/]*) potlib="$potliblink";; *) potlib=`$echo "X$potlib" | $Xsed -e 's,[^/]*$,,'`"$potliblink";; esac done if eval $file_magic_cmd \"\$potlib\" 2>/dev/null \ | ${SED} 10q \ | $EGREP "$file_magic_regex" > /dev/null; then newdeplibs="$newdeplibs $a_deplib" a_deplib="" break 2 fi done done fi if test -n "$a_deplib" ; then droppeddeps=yes $echo $echo "*** Warning: linker path does not have real file for library $a_deplib." $echo "*** I have the capability to make that library automatically link in when" $echo "*** you link to this library. But I can only do this if you have a" $echo "*** shared version of the library, which you do not appear to have" $echo "*** because I did check the linker path looking for a file starting" if test -z "$potlib" ; then $echo "*** with $libname but no candidates were found. (...for file magic test)" else $echo "*** with $libname and none of the candidates passed a file format test" $echo "*** using a file magic. Last file checked: $potlib" fi fi else # Add a -L argument. newdeplibs="$newdeplibs $a_deplib" fi done # Gone through all deplibs. ;; match_pattern*) set dummy $deplibs_check_method match_pattern_regex=`expr "$deplibs_check_method" : "$2 \(.*\)"` for a_deplib in $deplibs; do name="`expr $a_deplib : '-l\(.*\)'`" # If $name is empty we are operating on a -L argument. if test -n "$name" && test "$name" != "0"; then if test "X$allow_libtool_libs_with_static_runtimes" = "Xyes" ; then case " $predeps $postdeps " in *" $a_deplib "*) newdeplibs="$newdeplibs $a_deplib" a_deplib="" ;; esac fi if test -n "$a_deplib" ; then libname=`eval \\$echo \"$libname_spec\"` for i in $lib_search_path $sys_lib_search_path $shlib_search_path; do potential_libs=`ls $i/$libname[.-]* 2>/dev/null` for potent_lib in $potential_libs; do potlib="$potent_lib" # see symlink-check above in file_magic test if eval $echo \"$potent_lib\" 2>/dev/null \ | ${SED} 10q \ | $EGREP "$match_pattern_regex" > /dev/null; then newdeplibs="$newdeplibs $a_deplib" a_deplib="" break 2 fi done done fi if test -n "$a_deplib" ; then droppeddeps=yes $echo $echo "*** Warning: linker path does not have real file for library $a_deplib." $echo "*** I have the capability to make that library automatically link in when" $echo "*** you link to this library. But I can only do this if you have a" $echo "*** shared version of the library, which you do not appear to have" $echo "*** because I did check the linker path looking for a file starting" if test -z "$potlib" ; then $echo "*** with $libname but no candidates were found. (...for regex pattern test)" else $echo "*** with $libname and none of the candidates passed a file format test" $echo "*** using a regex pattern. Last file checked: $potlib" fi fi else # Add a -L argument. newdeplibs="$newdeplibs $a_deplib" fi done # Gone through all deplibs. ;; none | unknown | *) newdeplibs="" tmp_deplibs=`$echo "X $deplibs" | $Xsed -e 's/ -lc$//' \ -e 's/ -[LR][^ ]*//g'` if test "X$allow_libtool_libs_with_static_runtimes" = "Xyes" ; then for i in $predeps $postdeps ; do # can't use Xsed below, because $i might contain '/' tmp_deplibs=`$echo "X $tmp_deplibs" | ${SED} -e "1s,^X,," -e "s,$i,,"` done fi if $echo "X $tmp_deplibs" | $Xsed -e 's/[ ]//g' \ | grep . >/dev/null; then $echo if test "X$deplibs_check_method" = "Xnone"; then $echo "*** Warning: inter-library dependencies are not supported in this platform." else $echo "*** Warning: inter-library dependencies are not known to be supported." fi $echo "*** All declared inter-library dependencies are being dropped." droppeddeps=yes fi ;; esac versuffix=$versuffix_save major=$major_save release=$release_save libname=$libname_save name=$name_save case $host in *-*-rhapsody* | *-*-darwin1.[012]) # On Rhapsody replace the C library is the System framework newdeplibs=`$echo "X $newdeplibs" | $Xsed -e 's/ -lc / -framework System /'` ;; esac if test "$droppeddeps" = yes; then if test "$module" = yes; then $echo $echo "*** Warning: libtool could not satisfy all declared inter-library" $echo "*** dependencies of module $libname. Therefore, libtool will create" $echo "*** a static module, that should work as long as the dlopening" $echo "*** application is linked with the -dlopen flag." if test -z "$global_symbol_pipe"; then $echo $echo "*** However, this would only work if libtool was able to extract symbol" $echo "*** lists from a program, using \`nm' or equivalent, but libtool could" $echo "*** not find such a program. So, this module is probably useless." $echo "*** \`nm' from GNU binutils and a full rebuild may help." fi if test "$build_old_libs" = no; then oldlibs="$output_objdir/$libname.$libext" build_libtool_libs=module build_old_libs=yes else build_libtool_libs=no fi else $echo "*** The inter-library dependencies that have been dropped here will be" $echo "*** automatically added whenever a program is linked with this library" $echo "*** or is declared to -dlopen it." if test "$allow_undefined" = no; then $echo $echo "*** Since this library must not contain undefined symbols," $echo "*** because either the platform does not support them or" $echo "*** it was explicitly requested with -no-undefined," $echo "*** libtool will only create a static version of it." if test "$build_old_libs" = no; then oldlibs="$output_objdir/$libname.$libext" build_libtool_libs=module build_old_libs=yes else build_libtool_libs=no fi fi fi fi # Done checking deplibs! deplibs=$newdeplibs fi # All the library-specific variables (install_libdir is set above). library_names= old_library= dlname= # Test again, we may have decided not to build it any more if test "$build_libtool_libs" = yes; then if test "$hardcode_into_libs" = yes; then # Hardcode the library paths hardcode_libdirs= dep_rpath= rpath="$finalize_rpath" test "$mode" != relink && rpath="$compile_rpath$rpath" for libdir in $rpath; do if test -n "$hardcode_libdir_flag_spec"; then if test -n "$hardcode_libdir_separator"; then if test -z "$hardcode_libdirs"; then hardcode_libdirs="$libdir" else # Just accumulate the unique libdirs. case $hardcode_libdir_separator$hardcode_libdirs$hardcode_libdir_separator in *"$hardcode_libdir_separator$libdir$hardcode_libdir_separator"*) ;; *) hardcode_libdirs="$hardcode_libdirs$hardcode_libdir_separator$libdir" ;; esac fi else eval flag=\"$hardcode_libdir_flag_spec\" dep_rpath="$dep_rpath $flag" fi elif test -n "$runpath_var"; then case "$perm_rpath " in *" $libdir "*) ;; *) perm_rpath="$perm_rpath $libdir" ;; esac fi done # Substitute the hardcoded libdirs into the rpath. if test -n "$hardcode_libdir_separator" && test -n "$hardcode_libdirs"; then libdir="$hardcode_libdirs" if test -n "$hardcode_libdir_flag_spec_ld"; then eval dep_rpath=\"$hardcode_libdir_flag_spec_ld\" else eval dep_rpath=\"$hardcode_libdir_flag_spec\" fi fi if test -n "$runpath_var" && test -n "$perm_rpath"; then # We should set the runpath_var. rpath= for dir in $perm_rpath; do rpath="$rpath$dir:" done eval "$runpath_var='$rpath\$$runpath_var'; export $runpath_var" fi test -n "$dep_rpath" && deplibs="$dep_rpath $deplibs" fi shlibpath="$finalize_shlibpath" test "$mode" != relink && shlibpath="$compile_shlibpath$shlibpath" if test -n "$shlibpath"; then eval "$shlibpath_var='$shlibpath\$$shlibpath_var'; export $shlibpath_var" fi # Get the real and link names of the library. eval shared_ext=\"$shrext_cmds\" eval library_names=\"$library_names_spec\" set dummy $library_names realname="$2" shift; shift if test -n "$soname_spec"; then eval soname=\"$soname_spec\" else soname="$realname" fi if test -z "$dlname"; then dlname=$soname fi lib="$output_objdir/$realname" for link do linknames="$linknames $link" done # Use standard objects if they are pic test -z "$pic_flag" && libobjs=`$echo "X$libobjs" | $SP2NL | $Xsed -e "$lo2o" | $NL2SP` # Prepare the list of exported symbols if test -z "$export_symbols"; then if test "$always_export_symbols" = yes || test -n "$export_symbols_regex"; then $show "generating symbol list for \`$libname.la'" export_symbols="$output_objdir/$libname.exp" $run $rm $export_symbols cmds=$export_symbols_cmds save_ifs="$IFS"; IFS='~' for cmd in $cmds; do IFS="$save_ifs" eval cmd=\"$cmd\" if len=`expr "X$cmd" : ".*"` && test "$len" -le "$max_cmd_len" || test "$max_cmd_len" -le -1; then $show "$cmd" $run eval "$cmd" || exit $? skipped_export=false else # The command line is too long to execute in one step. $show "using reloadable object file for export list..." skipped_export=: fi done IFS="$save_ifs" if test -n "$export_symbols_regex"; then $show "$EGREP -e \"$export_symbols_regex\" \"$export_symbols\" > \"${export_symbols}T\"" $run eval '$EGREP -e "$export_symbols_regex" "$export_symbols" > "${export_symbols}T"' $show "$mv \"${export_symbols}T\" \"$export_symbols\"" $run eval '$mv "${export_symbols}T" "$export_symbols"' fi fi fi if test -n "$export_symbols" && test -n "$include_expsyms"; then $run eval '$echo "X$include_expsyms" | $SP2NL >> "$export_symbols"' fi tmp_deplibs= for test_deplib in $deplibs; do case " $convenience " in *" $test_deplib "*) ;; *) tmp_deplibs="$tmp_deplibs $test_deplib" ;; esac done deplibs="$tmp_deplibs" if test -n "$convenience"; then if test -n "$whole_archive_flag_spec"; then save_libobjs=$libobjs eval libobjs=\"\$libobjs $whole_archive_flag_spec\" else gentop="$output_objdir/${outputname}x" generated="$generated $gentop" func_extract_archives $gentop $convenience libobjs="$libobjs $func_extract_archives_result" fi fi if test "$thread_safe" = yes && test -n "$thread_safe_flag_spec"; then eval flag=\"$thread_safe_flag_spec\" linker_flags="$linker_flags $flag" fi # Make a backup of the uninstalled library when relinking if test "$mode" = relink; then $run eval '(cd $output_objdir && $rm ${realname}U && $mv $realname ${realname}U)' || exit $? fi # Do each of the archive commands. if test "$module" = yes && test -n "$module_cmds" ; then if test -n "$export_symbols" && test -n "$module_expsym_cmds"; then eval test_cmds=\"$module_expsym_cmds\" cmds=$module_expsym_cmds else eval test_cmds=\"$module_cmds\" cmds=$module_cmds fi else if test -n "$export_symbols" && test -n "$archive_expsym_cmds"; then eval test_cmds=\"$archive_expsym_cmds\" cmds=$archive_expsym_cmds else eval test_cmds=\"$archive_cmds\" cmds=$archive_cmds fi fi if test "X$skipped_export" != "X:" && len=`expr "X$test_cmds" : ".*"` && test "$len" -le "$max_cmd_len" || test "$max_cmd_len" -le -1; then : else # The command line is too long to link in one step, link piecewise. $echo "creating reloadable object files..." # Save the value of $output and $libobjs because we want to # use them later. If we have whole_archive_flag_spec, we # want to use save_libobjs as it was before # whole_archive_flag_spec was expanded, because we can't # assume the linker understands whole_archive_flag_spec. # This may have to be revisited, in case too many # convenience libraries get linked in and end up exceeding # the spec. if test -z "$convenience" || test -z "$whole_archive_flag_spec"; then save_libobjs=$libobjs fi save_output=$output # Clear the reloadable object creation command queue and # initialize k to one. test_cmds= concat_cmds= objlist= delfiles= last_robj= k=1 output=$output_objdir/$save_output-${k}.$objext # Loop over the list of objects to be linked. for obj in $save_libobjs do eval test_cmds=\"$reload_cmds $objlist $last_robj\" if test "X$objlist" = X || { len=`expr "X$test_cmds" : ".*"` && test "$len" -le "$max_cmd_len"; }; then objlist="$objlist $obj" else # The command $test_cmds is almost too long, add a # command to the queue. if test "$k" -eq 1 ; then # The first file doesn't have a previous command to add. eval concat_cmds=\"$reload_cmds $objlist $last_robj\" else # All subsequent reloadable object files will link in # the last one created. eval concat_cmds=\"\$concat_cmds~$reload_cmds $objlist $last_robj\" fi last_robj=$output_objdir/$save_output-${k}.$objext k=`expr $k + 1` output=$output_objdir/$save_output-${k}.$objext objlist=$obj len=1 fi done # Handle the remaining objects by creating one last # reloadable object file. All subsequent reloadable object # files will link in the last one created. test -z "$concat_cmds" || concat_cmds=$concat_cmds~ eval concat_cmds=\"\${concat_cmds}$reload_cmds $objlist $last_robj\" if ${skipped_export-false}; then $show "generating symbol list for \`$libname.la'" export_symbols="$output_objdir/$libname.exp" $run $rm $export_symbols libobjs=$output # Append the command to create the export file. eval concat_cmds=\"\$concat_cmds~$export_symbols_cmds\" fi # Set up a command to remove the reloadale object files # after they are used. i=0 while test "$i" -lt "$k" do i=`expr $i + 1` delfiles="$delfiles $output_objdir/$save_output-${i}.$objext" done $echo "creating a temporary reloadable object file: $output" # Loop through the commands generated above and execute them. save_ifs="$IFS"; IFS='~' for cmd in $concat_cmds; do IFS="$save_ifs" $show "$cmd" $run eval "$cmd" || exit $? done IFS="$save_ifs" libobjs=$output # Restore the value of output. output=$save_output if test -n "$convenience" && test -n "$whole_archive_flag_spec"; then eval libobjs=\"\$libobjs $whole_archive_flag_spec\" fi # Expand the library linking commands again to reset the # value of $libobjs for piecewise linking. # Do each of the archive commands. if test "$module" = yes && test -n "$module_cmds" ; then if test -n "$export_symbols" && test -n "$module_expsym_cmds"; then cmds=$module_expsym_cmds else cmds=$module_cmds fi else if test -n "$export_symbols" && test -n "$archive_expsym_cmds"; then cmds=$archive_expsym_cmds else cmds=$archive_cmds fi fi # Append the command to remove the reloadable object files # to the just-reset $cmds. eval cmds=\"\$cmds~\$rm $delfiles\" fi save_ifs="$IFS"; IFS='~' for cmd in $cmds; do IFS="$save_ifs" eval cmd=\"$cmd\" $show "$cmd" $run eval "$cmd" || exit $? done IFS="$save_ifs" # Restore the uninstalled library and exit if test "$mode" = relink; then $run eval '(cd $output_objdir && $rm ${realname}T && $mv $realname ${realname}T && $mv "$realname"U $realname)' || exit $? exit $EXIT_SUCCESS fi # Create links to the real library. for linkname in $linknames; do if test "$realname" != "$linkname"; then $show "(cd $output_objdir && $rm $linkname && $LN_S $realname $linkname)" $run eval '(cd $output_objdir && $rm $linkname && $LN_S $realname $linkname)' || exit $? fi done # If -module or -export-dynamic was specified, set the dlname. if test "$module" = yes || test "$export_dynamic" = yes; then # On all known operating systems, these are identical. dlname="$soname" fi fi ;; obj) if test -n "$deplibs"; then $echo "$modename: warning: \`-l' and \`-L' are ignored for objects" 1>&2 fi if test -n "$dlfiles$dlprefiles" || test "$dlself" != no; then $echo "$modename: warning: \`-dlopen' is ignored for objects" 1>&2 fi if test -n "$rpath"; then $echo "$modename: warning: \`-rpath' is ignored for objects" 1>&2 fi if test -n "$xrpath"; then $echo "$modename: warning: \`-R' is ignored for objects" 1>&2 fi if test -n "$vinfo"; then $echo "$modename: warning: \`-version-info' is ignored for objects" 1>&2 fi if test -n "$release"; then $echo "$modename: warning: \`-release' is ignored for objects" 1>&2 fi case $output in *.lo) if test -n "$objs$old_deplibs"; then $echo "$modename: cannot build library object \`$output' from non-libtool objects" 1>&2 exit $EXIT_FAILURE fi libobj="$output" obj=`$echo "X$output" | $Xsed -e "$lo2o"` ;; *) libobj= obj="$output" ;; esac # Delete the old objects. $run $rm $obj $libobj # Objects from convenience libraries. This assumes # single-version convenience libraries. Whenever we create # different ones for PIC/non-PIC, this we'll have to duplicate # the extraction. reload_conv_objs= gentop= # reload_cmds runs $LD directly, so let us get rid of # -Wl from whole_archive_flag_spec wl= if test -n "$convenience"; then if test -n "$whole_archive_flag_spec"; then eval reload_conv_objs=\"\$reload_objs $whole_archive_flag_spec\" else gentop="$output_objdir/${obj}x" generated="$generated $gentop" func_extract_archives $gentop $convenience reload_conv_objs="$reload_objs $func_extract_archives_result" fi fi # Create the old-style object. reload_objs="$objs$old_deplibs "`$echo "X$libobjs" | $SP2NL | $Xsed -e '/\.'${libext}$'/d' -e '/\.lib$/d' -e "$lo2o" | $NL2SP`" $reload_conv_objs" ### testsuite: skip nested quoting test output="$obj" cmds=$reload_cmds save_ifs="$IFS"; IFS='~' for cmd in $cmds; do IFS="$save_ifs" eval cmd=\"$cmd\" $show "$cmd" $run eval "$cmd" || exit $? done IFS="$save_ifs" # Exit if we aren't doing a library object file. if test -z "$libobj"; then if test -n "$gentop"; then $show "${rm}r $gentop" $run ${rm}r $gentop fi exit $EXIT_SUCCESS fi if test "$build_libtool_libs" != yes; then if test -n "$gentop"; then $show "${rm}r $gentop" $run ${rm}r $gentop fi # Create an invalid libtool object if no PIC, so that we don't # accidentally link it into a program. # $show "echo timestamp > $libobj" # $run eval "echo timestamp > $libobj" || exit $? exit $EXIT_SUCCESS fi if test -n "$pic_flag" || test "$pic_mode" != default; then # Only do commands if we really have different PIC objects. reload_objs="$libobjs $reload_conv_objs" output="$libobj" cmds=$reload_cmds save_ifs="$IFS"; IFS='~' for cmd in $cmds; do IFS="$save_ifs" eval cmd=\"$cmd\" $show "$cmd" $run eval "$cmd" || exit $? done IFS="$save_ifs" fi if test -n "$gentop"; then $show "${rm}r $gentop" $run ${rm}r $gentop fi exit $EXIT_SUCCESS ;; prog) case $host in *cygwin*) output=`$echo $output | ${SED} -e 's,.exe$,,;s,$,.exe,'` ;; esac if test -n "$vinfo"; then $echo "$modename: warning: \`-version-info' is ignored for programs" 1>&2 fi if test -n "$release"; then $echo "$modename: warning: \`-release' is ignored for programs" 1>&2 fi if test "$preload" = yes; then if test "$dlopen_support" = unknown && test "$dlopen_self" = unknown && test "$dlopen_self_static" = unknown; then $echo "$modename: warning: \`AC_LIBTOOL_DLOPEN' not used. Assuming no dlopen support." fi fi case $host in *-*-rhapsody* | *-*-darwin1.[012]) # On Rhapsody replace the C library is the System framework compile_deplibs=`$echo "X $compile_deplibs" | $Xsed -e 's/ -lc / -framework System /'` finalize_deplibs=`$echo "X $finalize_deplibs" | $Xsed -e 's/ -lc / -framework System /'` ;; esac case $host in *darwin*) # Don't allow lazy linking, it breaks C++ global constructors if test "$tagname" = CXX ; then compile_command="$compile_command ${wl}-bind_at_load" finalize_command="$finalize_command ${wl}-bind_at_load" fi ;; esac compile_command="$compile_command $compile_deplibs" finalize_command="$finalize_command $finalize_deplibs" if test -n "$rpath$xrpath"; then # If the user specified any rpath flags, then add them. for libdir in $rpath $xrpath; do # This is the magic to use -rpath. case "$finalize_rpath " in *" $libdir "*) ;; *) finalize_rpath="$finalize_rpath $libdir" ;; esac done fi # Now hardcode the library paths rpath= hardcode_libdirs= for libdir in $compile_rpath $finalize_rpath; do if test -n "$hardcode_libdir_flag_spec"; then if test -n "$hardcode_libdir_separator"; then if test -z "$hardcode_libdirs"; then hardcode_libdirs="$libdir" else # Just accumulate the unique libdirs. case $hardcode_libdir_separator$hardcode_libdirs$hardcode_libdir_separator in *"$hardcode_libdir_separator$libdir$hardcode_libdir_separator"*) ;; *) hardcode_libdirs="$hardcode_libdirs$hardcode_libdir_separator$libdir" ;; esac fi else eval flag=\"$hardcode_libdir_flag_spec\" rpath="$rpath $flag" fi elif test -n "$runpath_var"; then case "$perm_rpath " in *" $libdir "*) ;; *) perm_rpath="$perm_rpath $libdir" ;; esac fi case $host in *-*-cygwin* | *-*-mingw* | *-*-pw32* | *-*-os2*) case :$dllsearchpath: in *":$libdir:"*) ;; *) dllsearchpath="$dllsearchpath:$libdir";; esac ;; esac done # Substitute the hardcoded libdirs into the rpath. if test -n "$hardcode_libdir_separator" && test -n "$hardcode_libdirs"; then libdir="$hardcode_libdirs" eval rpath=\" $hardcode_libdir_flag_spec\" fi compile_rpath="$rpath" rpath= hardcode_libdirs= for libdir in $finalize_rpath; do if test -n "$hardcode_libdir_flag_spec"; then if test -n "$hardcode_libdir_separator"; then if test -z "$hardcode_libdirs"; then hardcode_libdirs="$libdir" else # Just accumulate the unique libdirs. case $hardcode_libdir_separator$hardcode_libdirs$hardcode_libdir_separator in *"$hardcode_libdir_separator$libdir$hardcode_libdir_separator"*) ;; *) hardcode_libdirs="$hardcode_libdirs$hardcode_libdir_separator$libdir" ;; esac fi else eval flag=\"$hardcode_libdir_flag_spec\" rpath="$rpath $flag" fi elif test -n "$runpath_var"; then case "$finalize_perm_rpath " in *" $libdir "*) ;; *) finalize_perm_rpath="$finalize_perm_rpath $libdir" ;; esac fi done # Substitute the hardcoded libdirs into the rpath. if test -n "$hardcode_libdir_separator" && test -n "$hardcode_libdirs"; then libdir="$hardcode_libdirs" eval rpath=\" $hardcode_libdir_flag_spec\" fi finalize_rpath="$rpath" if test -n "$libobjs" && test "$build_old_libs" = yes; then # Transform all the library objects into standard objects. compile_command=`$echo "X$compile_command" | $SP2NL | $Xsed -e "$lo2o" | $NL2SP` finalize_command=`$echo "X$finalize_command" | $SP2NL | $Xsed -e "$lo2o" | $NL2SP` fi dlsyms= if test -n "$dlfiles$dlprefiles" || test "$dlself" != no; then if test -n "$NM" && test -n "$global_symbol_pipe"; then dlsyms="${outputname}S.c" else $echo "$modename: not configured to extract global symbols from dlpreopened files" 1>&2 fi fi if test -n "$dlsyms"; then case $dlsyms in "") ;; *.c) # Discover the nlist of each of the dlfiles. nlist="$output_objdir/${outputname}.nm" $show "$rm $nlist ${nlist}S ${nlist}T" $run $rm "$nlist" "${nlist}S" "${nlist}T" # Parse the name list into a source file. $show "creating $output_objdir/$dlsyms" test -z "$run" && $echo > "$output_objdir/$dlsyms" "\ /* $dlsyms - symbol resolution table for \`$outputname' dlsym emulation. */ /* Generated by $PROGRAM - GNU $PACKAGE $VERSION$TIMESTAMP */ #ifdef __cplusplus extern \"C\" { #endif /* Prevent the only kind of declaration conflicts we can make. */ #define lt_preloaded_symbols some_other_symbol /* External symbol declarations for the compiler. */\ " if test "$dlself" = yes; then $show "generating symbol list for \`$output'" test -z "$run" && $echo ': @PROGRAM@ ' > "$nlist" # Add our own program objects to the symbol list. progfiles=`$echo "X$objs$old_deplibs" | $SP2NL | $Xsed -e "$lo2o" | $NL2SP` for arg in $progfiles; do $show "extracting global C symbols from \`$arg'" $run eval "$NM $arg | $global_symbol_pipe >> '$nlist'" done if test -n "$exclude_expsyms"; then $run eval '$EGREP -v " ($exclude_expsyms)$" "$nlist" > "$nlist"T' $run eval '$mv "$nlist"T "$nlist"' fi if test -n "$export_symbols_regex"; then $run eval '$EGREP -e "$export_symbols_regex" "$nlist" > "$nlist"T' $run eval '$mv "$nlist"T "$nlist"' fi # Prepare the list of exported symbols if test -z "$export_symbols"; then export_symbols="$output_objdir/$output.exp" $run $rm $export_symbols $run eval "${SED} -n -e '/^: @PROGRAM@$/d' -e 's/^.* \(.*\)$/\1/p' "'< "$nlist" > "$export_symbols"' else $run eval "${SED} -e 's/\([][.*^$]\)/\\\1/g' -e 's/^/ /' -e 's/$/$/'"' < "$export_symbols" > "$output_objdir/$output.exp"' $run eval 'grep -f "$output_objdir/$output.exp" < "$nlist" > "$nlist"T' $run eval 'mv "$nlist"T "$nlist"' fi fi for arg in $dlprefiles; do $show "extracting global C symbols from \`$arg'" name=`$echo "$arg" | ${SED} -e 's%^.*/%%'` $run eval '$echo ": $name " >> "$nlist"' $run eval "$NM $arg | $global_symbol_pipe >> '$nlist'" done if test -z "$run"; then # Make sure we have at least an empty file. test -f "$nlist" || : > "$nlist" if test -n "$exclude_expsyms"; then $EGREP -v " ($exclude_expsyms)$" "$nlist" > "$nlist"T $mv "$nlist"T "$nlist" fi # Try sorting and uniquifying the output. if grep -v "^: " < "$nlist" | if sort -k 3 /dev/null 2>&1; then sort -k 3 else sort +2 fi | uniq > "$nlist"S; then : else grep -v "^: " < "$nlist" > "$nlist"S fi if test -f "$nlist"S; then eval "$global_symbol_to_cdecl"' < "$nlist"S >> "$output_objdir/$dlsyms"' else $echo '/* NONE */' >> "$output_objdir/$dlsyms" fi $echo >> "$output_objdir/$dlsyms" "\ #undef lt_preloaded_symbols #if defined (__STDC__) && __STDC__ # define lt_ptr void * #else # define lt_ptr char * # define const #endif /* The mapping between symbol names and symbols. */ const struct { const char *name; lt_ptr address; } lt_preloaded_symbols[] = {\ " eval "$global_symbol_to_c_name_address" < "$nlist" >> "$output_objdir/$dlsyms" $echo >> "$output_objdir/$dlsyms" "\ {0, (lt_ptr) 0} }; /* This works around a problem in FreeBSD linker */ #ifdef FREEBSD_WORKAROUND static const void *lt_preloaded_setup() { return lt_preloaded_symbols; } #endif #ifdef __cplusplus } #endif\ " fi pic_flag_for_symtable= case $host in # compiling the symbol table file with pic_flag works around # a FreeBSD bug that causes programs to crash when -lm is # linked before any other PIC object. But we must not use # pic_flag when linking with -static. The problem exists in # FreeBSD 2.2.6 and is fixed in FreeBSD 3.1. *-*-freebsd2*|*-*-freebsd3.0*|*-*-freebsdelf3.0*) case "$compile_command " in *" -static "*) ;; *) pic_flag_for_symtable=" $pic_flag -DFREEBSD_WORKAROUND";; esac;; *-*-hpux*) case "$compile_command " in *" -static "*) ;; *) pic_flag_for_symtable=" $pic_flag";; esac esac # Now compile the dynamic symbol file. $show "(cd $output_objdir && $LTCC -c$no_builtin_flag$pic_flag_for_symtable \"$dlsyms\")" $run eval '(cd $output_objdir && $LTCC -c$no_builtin_flag$pic_flag_for_symtable "$dlsyms")' || exit $? # Clean up the generated files. $show "$rm $output_objdir/$dlsyms $nlist ${nlist}S ${nlist}T" $run $rm "$output_objdir/$dlsyms" "$nlist" "${nlist}S" "${nlist}T" # Transform the symbol file into the correct name. compile_command=`$echo "X$compile_command" | $Xsed -e "s%@SYMFILE@%$output_objdir/${outputname}S.${objext}%"` finalize_command=`$echo "X$finalize_command" | $Xsed -e "s%@SYMFILE@%$output_objdir/${outputname}S.${objext}%"` ;; *-*-freebsd*) # FreeBSD doesn't need this... ;; *) $echo "$modename: unknown suffix for \`$dlsyms'" 1>&2 exit $EXIT_FAILURE ;; esac else # We keep going just in case the user didn't refer to # lt_preloaded_symbols. The linker will fail if global_symbol_pipe # really was required. # Nullify the symbol file. compile_command=`$echo "X$compile_command" | $Xsed -e "s% @SYMFILE@%%"` finalize_command=`$echo "X$finalize_command" | $Xsed -e "s% @SYMFILE@%%"` fi if test "$need_relink" = no || test "$build_libtool_libs" != yes; then # Replace the output file specification. compile_command=`$echo "X$compile_command" | $Xsed -e 's%@OUTPUT@%'"$output"'%g'` link_command="$compile_command$compile_rpath" # We have no uninstalled library dependencies, so finalize right now. $show "$link_command" $run eval "$link_command" status=$? # Delete the generated files. if test -n "$dlsyms"; then $show "$rm $output_objdir/${outputname}S.${objext}" $run $rm "$output_objdir/${outputname}S.${objext}" fi exit $status fi if test -n "$shlibpath_var"; then # We should set the shlibpath_var rpath= for dir in $temp_rpath; do case $dir in [\\/]* | [A-Za-z]:[\\/]*) # Absolute path. rpath="$rpath$dir:" ;; *) # Relative path: add a thisdir entry. rpath="$rpath\$thisdir/$dir:" ;; esac done temp_rpath="$rpath" fi if test -n "$compile_shlibpath$finalize_shlibpath"; then compile_command="$shlibpath_var=\"$compile_shlibpath$finalize_shlibpath\$$shlibpath_var\" $compile_command" fi if test -n "$finalize_shlibpath"; then finalize_command="$shlibpath_var=\"$finalize_shlibpath\$$shlibpath_var\" $finalize_command" fi compile_var= finalize_var= if test -n "$runpath_var"; then if test -n "$perm_rpath"; then # We should set the runpath_var. rpath= for dir in $perm_rpath; do rpath="$rpath$dir:" done compile_var="$runpath_var=\"$rpath\$$runpath_var\" " fi if test -n "$finalize_perm_rpath"; then # We should set the runpath_var. rpath= for dir in $finalize_perm_rpath; do rpath="$rpath$dir:" done finalize_var="$runpath_var=\"$rpath\$$runpath_var\" " fi fi if test "$no_install" = yes; then # We don't need to create a wrapper script. link_command="$compile_var$compile_command$compile_rpath" # Replace the output file specification. link_command=`$echo "X$link_command" | $Xsed -e 's%@OUTPUT@%'"$output"'%g'` # Delete the old output file. $run $rm $output # Link the executable and exit $show "$link_command" $run eval "$link_command" || exit $? exit $EXIT_SUCCESS fi if test "$hardcode_action" = relink; then # Fast installation is not supported link_command="$compile_var$compile_command$compile_rpath" relink_command="$finalize_var$finalize_command$finalize_rpath" $echo "$modename: warning: this platform does not like uninstalled shared libraries" 1>&2 $echo "$modename: \`$output' will be relinked during installation" 1>&2 else if test "$fast_install" != no; then link_command="$finalize_var$compile_command$finalize_rpath" if test "$fast_install" = yes; then relink_command=`$echo "X$compile_var$compile_command$compile_rpath" | $Xsed -e 's%@OUTPUT@%\$progdir/\$file%g'` else # fast_install is set to needless relink_command= fi else link_command="$compile_var$compile_command$compile_rpath" relink_command="$finalize_var$finalize_command$finalize_rpath" fi fi # Replace the output file specification. link_command=`$echo "X$link_command" | $Xsed -e 's%@OUTPUT@%'"$output_objdir/$outputname"'%g'` # Delete the old output files. $run $rm $output $output_objdir/$outputname $output_objdir/lt-$outputname $show "$link_command" $run eval "$link_command" || exit $? # Now create the wrapper script. $show "creating $output" # Quote the relink command for shipping. if test -n "$relink_command"; then # Preserve any variables that may affect compiler behavior for var in $variables_saved_for_relink; do if eval test -z \"\${$var+set}\"; then relink_command="{ test -z \"\${$var+set}\" || unset $var || { $var=; export $var; }; }; $relink_command" elif eval var_value=\$$var; test -z "$var_value"; then relink_command="$var=; export $var; $relink_command" else var_value=`$echo "X$var_value" | $Xsed -e "$sed_quote_subst"` relink_command="$var=\"$var_value\"; export $var; $relink_command" fi done relink_command="(cd `pwd`; $relink_command)" relink_command=`$echo "X$relink_command" | $Xsed -e "$sed_quote_subst"` fi # Quote $echo for shipping. if test "X$echo" = "X$SHELL $progpath --fallback-echo"; then case $progpath in [\\/]* | [A-Za-z]:[\\/]*) qecho="$SHELL $progpath --fallback-echo";; *) qecho="$SHELL `pwd`/$progpath --fallback-echo";; esac qecho=`$echo "X$qecho" | $Xsed -e "$sed_quote_subst"` else qecho=`$echo "X$echo" | $Xsed -e "$sed_quote_subst"` fi # Only actually do things if our run command is non-null. if test -z "$run"; then # win32 will think the script is a binary if it has # a .exe suffix, so we strip it off here. case $output in *.exe) output=`$echo $output|${SED} 's,.exe$,,'` ;; esac # test for cygwin because mv fails w/o .exe extensions case $host in *cygwin*) exeext=.exe outputname=`$echo $outputname|${SED} 's,.exe$,,'` ;; *) exeext= ;; esac case $host in *cygwin* | *mingw* ) cwrappersource=`$echo ${objdir}/lt-${output}.c` cwrapper=`$echo ${output}.exe` $rm $cwrappersource $cwrapper trap "$rm $cwrappersource $cwrapper; exit $EXIT_FAILURE" 1 2 15 cat > $cwrappersource <> $cwrappersource<<"EOF" #include #include #include #include #include #include #if defined(PATH_MAX) # define LT_PATHMAX PATH_MAX #elif defined(MAXPATHLEN) # define LT_PATHMAX MAXPATHLEN #else # define LT_PATHMAX 1024 #endif #ifndef DIR_SEPARATOR #define DIR_SEPARATOR '/' #endif #if defined (_WIN32) || defined (__MSDOS__) || defined (__DJGPP__) || \ defined (__OS2__) #define HAVE_DOS_BASED_FILE_SYSTEM #ifndef DIR_SEPARATOR_2 #define DIR_SEPARATOR_2 '\\' #endif #endif #ifndef DIR_SEPARATOR_2 # define IS_DIR_SEPARATOR(ch) ((ch) == DIR_SEPARATOR) #else /* DIR_SEPARATOR_2 */ # define IS_DIR_SEPARATOR(ch) \ (((ch) == DIR_SEPARATOR) || ((ch) == DIR_SEPARATOR_2)) #endif /* DIR_SEPARATOR_2 */ #define XMALLOC(type, num) ((type *) xmalloc ((num) * sizeof(type))) #define XFREE(stale) do { \ if (stale) { free ((void *) stale); stale = 0; } \ } while (0) const char *program_name = NULL; void * xmalloc (size_t num); char * xstrdup (const char *string); char * basename (const char *name); char * fnqualify(const char *path); char * strendzap(char *str, const char *pat); void lt_fatal (const char *message, ...); int main (int argc, char *argv[]) { char **newargz; int i; program_name = (char *) xstrdup ((char *) basename (argv[0])); newargz = XMALLOC(char *, argc+2); EOF cat >> $cwrappersource <> $cwrappersource <<"EOF" newargz[1] = fnqualify(argv[0]); /* we know the script has the same name, without the .exe */ /* so make sure newargz[1] doesn't end in .exe */ strendzap(newargz[1],".exe"); for (i = 1; i < argc; i++) newargz[i+1] = xstrdup(argv[i]); newargz[argc+1] = NULL; EOF cat >> $cwrappersource <> $cwrappersource <<"EOF" } void * xmalloc (size_t num) { void * p = (void *) malloc (num); if (!p) lt_fatal ("Memory exhausted"); return p; } char * xstrdup (const char *string) { return string ? strcpy ((char *) xmalloc (strlen (string) + 1), string) : NULL ; } char * basename (const char *name) { const char *base; #if defined (HAVE_DOS_BASED_FILE_SYSTEM) /* Skip over the disk name in MSDOS pathnames. */ if (isalpha (name[0]) && name[1] == ':') name += 2; #endif for (base = name; *name; name++) if (IS_DIR_SEPARATOR (*name)) base = name + 1; return (char *) base; } char * fnqualify(const char *path) { size_t size; char *p; char tmp[LT_PATHMAX + 1]; assert(path != NULL); /* Is it qualified already? */ #if defined (HAVE_DOS_BASED_FILE_SYSTEM) if (isalpha (path[0]) && path[1] == ':') return xstrdup (path); #endif if (IS_DIR_SEPARATOR (path[0])) return xstrdup (path); /* prepend the current directory */ /* doesn't handle '~' */ if (getcwd (tmp, LT_PATHMAX) == NULL) lt_fatal ("getcwd failed"); size = strlen(tmp) + 1 + strlen(path) + 1; /* +2 for '/' and '\0' */ p = XMALLOC(char, size); sprintf(p, "%s%c%s", tmp, DIR_SEPARATOR, path); return p; } char * strendzap(char *str, const char *pat) { size_t len, patlen; assert(str != NULL); assert(pat != NULL); len = strlen(str); patlen = strlen(pat); if (patlen <= len) { str += len - patlen; if (strcmp(str, pat) == 0) *str = '\0'; } return str; } static void lt_error_core (int exit_status, const char * mode, const char * message, va_list ap) { fprintf (stderr, "%s: %s: ", program_name, mode); vfprintf (stderr, message, ap); fprintf (stderr, ".\n"); if (exit_status >= 0) exit (exit_status); } void lt_fatal (const char *message, ...) { va_list ap; va_start (ap, message); lt_error_core (EXIT_FAILURE, "FATAL", message, ap); va_end (ap); } EOF # we should really use a build-platform specific compiler # here, but OTOH, the wrappers (shell script and this C one) # are only useful if you want to execute the "real" binary. # Since the "real" binary is built for $host, then this # wrapper might as well be built for $host, too. $run $LTCC -s -o $cwrapper $cwrappersource ;; esac $rm $output trap "$rm $output; exit $EXIT_FAILURE" 1 2 15 $echo > $output "\ #! $SHELL # $output - temporary wrapper script for $objdir/$outputname # Generated by $PROGRAM - GNU $PACKAGE $VERSION$TIMESTAMP # # The $output program cannot be directly executed until all the libtool # libraries that it depends on are installed. # # This wrapper script should never be moved out of the build directory. # If it is, it will not operate correctly. # Sed substitution that helps us do robust quoting. It backslashifies # metacharacters that are still active within double-quoted strings. Xsed='${SED} -e 1s/^X//' sed_quote_subst='$sed_quote_subst' # The HP-UX ksh and POSIX shell print the target directory to stdout # if CDPATH is set. (unset CDPATH) >/dev/null 2>&1 && unset CDPATH relink_command=\"$relink_command\" # This environment variable determines our operation mode. if test \"\$libtool_install_magic\" = \"$magic\"; then # install mode needs the following variable: notinst_deplibs='$notinst_deplibs' else # When we are sourced in execute mode, \$file and \$echo are already set. if test \"\$libtool_execute_magic\" != \"$magic\"; then echo=\"$qecho\" file=\"\$0\" # Make sure echo works. if test \"X\$1\" = X--no-reexec; then # Discard the --no-reexec flag, and continue. shift elif test \"X\`(\$echo '\t') 2>/dev/null\`\" = 'X\t'; then # Yippee, \$echo works! : else # Restart under the correct shell, and then maybe \$echo will work. exec $SHELL \"\$0\" --no-reexec \${1+\"\$@\"} fi fi\ " $echo >> $output "\ # Find the directory that this script lives in. thisdir=\`\$echo \"X\$file\" | \$Xsed -e 's%/[^/]*$%%'\` test \"x\$thisdir\" = \"x\$file\" && thisdir=. # Follow symbolic links until we get to the real thisdir. file=\`ls -ld \"\$file\" | ${SED} -n 's/.*-> //p'\` while test -n \"\$file\"; do destdir=\`\$echo \"X\$file\" | \$Xsed -e 's%/[^/]*\$%%'\` # If there was a directory component, then change thisdir. if test \"x\$destdir\" != \"x\$file\"; then case \"\$destdir\" in [\\\\/]* | [A-Za-z]:[\\\\/]*) thisdir=\"\$destdir\" ;; *) thisdir=\"\$thisdir/\$destdir\" ;; esac fi file=\`\$echo \"X\$file\" | \$Xsed -e 's%^.*/%%'\` file=\`ls -ld \"\$thisdir/\$file\" | ${SED} -n 's/.*-> //p'\` done # Try to get the absolute directory name. absdir=\`cd \"\$thisdir\" && pwd\` test -n \"\$absdir\" && thisdir=\"\$absdir\" " if test "$fast_install" = yes; then $echo >> $output "\ program=lt-'$outputname'$exeext progdir=\"\$thisdir/$objdir\" if test ! -f \"\$progdir/\$program\" || \\ { file=\`ls -1dt \"\$progdir/\$program\" \"\$progdir/../\$program\" 2>/dev/null | ${SED} 1q\`; \\ test \"X\$file\" != \"X\$progdir/\$program\"; }; then file=\"\$\$-\$program\" if test ! -d \"\$progdir\"; then $mkdir \"\$progdir\" else $rm \"\$progdir/\$file\" fi" $echo >> $output "\ # relink executable if necessary if test -n \"\$relink_command\"; then if relink_command_output=\`eval \$relink_command 2>&1\`; then : else $echo \"\$relink_command_output\" >&2 $rm \"\$progdir/\$file\" exit $EXIT_FAILURE fi fi $mv \"\$progdir/\$file\" \"\$progdir/\$program\" 2>/dev/null || { $rm \"\$progdir/\$program\"; $mv \"\$progdir/\$file\" \"\$progdir/\$program\"; } $rm \"\$progdir/\$file\" fi" else $echo >> $output "\ program='$outputname' progdir=\"\$thisdir/$objdir\" " fi $echo >> $output "\ if test -f \"\$progdir/\$program\"; then" # Export our shlibpath_var if we have one. if test "$shlibpath_overrides_runpath" = yes && test -n "$shlibpath_var" && test -n "$temp_rpath"; then $echo >> $output "\ # Add our own library path to $shlibpath_var $shlibpath_var=\"$temp_rpath\$$shlibpath_var\" # Some systems cannot cope with colon-terminated $shlibpath_var # The second colon is a workaround for a bug in BeOS R4 sed $shlibpath_var=\`\$echo \"X\$$shlibpath_var\" | \$Xsed -e 's/::*\$//'\` export $shlibpath_var " fi # fixup the dll searchpath if we need to. if test -n "$dllsearchpath"; then $echo >> $output "\ # Add the dll search path components to the executable PATH PATH=$dllsearchpath:\$PATH " fi $echo >> $output "\ if test \"\$libtool_execute_magic\" != \"$magic\"; then # Run the actual program with our arguments. " case $host in # Backslashes separate directories on plain windows *-*-mingw | *-*-os2*) $echo >> $output "\ exec \$progdir\\\\\$program \${1+\"\$@\"} " ;; *) $echo >> $output "\ exec \$progdir/\$program \${1+\"\$@\"} " ;; esac $echo >> $output "\ \$echo \"\$0: cannot exec \$program \${1+\"\$@\"}\" exit $EXIT_FAILURE fi else # The program doesn't exist. \$echo \"\$0: error: \$progdir/\$program does not exist\" 1>&2 \$echo \"This script is just a wrapper for \$program.\" 1>&2 $echo \"See the $PACKAGE documentation for more information.\" 1>&2 exit $EXIT_FAILURE fi fi\ " chmod +x $output fi exit $EXIT_SUCCESS ;; esac # See if we need to build an old-fashioned archive. for oldlib in $oldlibs; do if test "$build_libtool_libs" = convenience; then oldobjs="$libobjs_save" addlibs="$convenience" build_libtool_libs=no else if test "$build_libtool_libs" = module; then oldobjs="$libobjs_save" build_libtool_libs=no else oldobjs="$old_deplibs $non_pic_objects" fi addlibs="$old_convenience" fi if test -n "$addlibs"; then gentop="$output_objdir/${outputname}x" generated="$generated $gentop" func_extract_archives $gentop $addlibs oldobjs="$oldobjs $func_extract_archives_result" fi # Do each command in the archive commands. if test -n "$old_archive_from_new_cmds" && test "$build_libtool_libs" = yes; then cmds=$old_archive_from_new_cmds else eval cmds=\"$old_archive_cmds\" if len=`expr "X$cmds" : ".*"` && test "$len" -le "$max_cmd_len" || test "$max_cmd_len" -le -1; then cmds=$old_archive_cmds else # the command line is too long to link in one step, link in parts $echo "using piecewise archive linking..." save_RANLIB=$RANLIB RANLIB=: objlist= concat_cmds= save_oldobjs=$oldobjs # GNU ar 2.10+ was changed to match POSIX; thus no paths are # encoded into archives. This makes 'ar r' malfunction in # this piecewise linking case whenever conflicting object # names appear in distinct ar calls; check, warn and compensate. if (for obj in $save_oldobjs do $echo "X$obj" | $Xsed -e 's%^.*/%%' done | sort | sort -uc >/dev/null 2>&1); then : else $echo "$modename: warning: object name conflicts; overriding AR_FLAGS to 'cq'" 1>&2 $echo "$modename: warning: to ensure that POSIX-compatible ar will work" 1>&2 AR_FLAGS=cq fi # Is there a better way of finding the last object in the list? for obj in $save_oldobjs do last_oldobj=$obj done for obj in $save_oldobjs do oldobjs="$objlist $obj" objlist="$objlist $obj" eval test_cmds=\"$old_archive_cmds\" if len=`expr "X$test_cmds" : ".*"` && test "$len" -le "$max_cmd_len"; then : else # the above command should be used before it gets too long oldobjs=$objlist if test "$obj" = "$last_oldobj" ; then RANLIB=$save_RANLIB fi test -z "$concat_cmds" || concat_cmds=$concat_cmds~ eval concat_cmds=\"\${concat_cmds}$old_archive_cmds\" objlist= fi done RANLIB=$save_RANLIB oldobjs=$objlist if test "X$oldobjs" = "X" ; then eval cmds=\"\$concat_cmds\" else eval cmds=\"\$concat_cmds~\$old_archive_cmds\" fi fi fi save_ifs="$IFS"; IFS='~' for cmd in $cmds; do eval cmd=\"$cmd\" IFS="$save_ifs" $show "$cmd" $run eval "$cmd" || exit $? done IFS="$save_ifs" done if test -n "$generated"; then $show "${rm}r$generated" $run ${rm}r$generated fi # Now create the libtool archive. case $output in *.la) old_library= test "$build_old_libs" = yes && old_library="$libname.$libext" $show "creating $output" # Preserve any variables that may affect compiler behavior for var in $variables_saved_for_relink; do if eval test -z \"\${$var+set}\"; then relink_command="{ test -z \"\${$var+set}\" || unset $var || { $var=; export $var; }; }; $relink_command" elif eval var_value=\$$var; test -z "$var_value"; then relink_command="$var=; export $var; $relink_command" else var_value=`$echo "X$var_value" | $Xsed -e "$sed_quote_subst"` relink_command="$var=\"$var_value\"; export $var; $relink_command" fi done # Quote the link command for shipping. relink_command="(cd `pwd`; $SHELL $progpath $preserve_args --mode=relink $libtool_args @inst_prefix_dir@)" relink_command=`$echo "X$relink_command" | $Xsed -e "$sed_quote_subst"` if test "$hardcode_automatic" = yes ; then relink_command= fi # Only create the output if not a dry run. if test -z "$run"; then for installed in no yes; do if test "$installed" = yes; then if test -z "$install_libdir"; then break fi output="$output_objdir/$outputname"i # Replace all uninstalled libtool libraries with the installed ones newdependency_libs= for deplib in $dependency_libs; do case $deplib in *.la) name=`$echo "X$deplib" | $Xsed -e 's%^.*/%%'` eval libdir=`${SED} -n -e 's/^libdir=\(.*\)$/\1/p' $deplib` if test -z "$libdir"; then $echo "$modename: \`$deplib' is not a valid libtool archive" 1>&2 exit $EXIT_FAILURE fi newdependency_libs="$newdependency_libs $libdir/$name" ;; *) newdependency_libs="$newdependency_libs $deplib" ;; esac done dependency_libs="$newdependency_libs" newdlfiles= for lib in $dlfiles; do name=`$echo "X$lib" | $Xsed -e 's%^.*/%%'` eval libdir=`${SED} -n -e 's/^libdir=\(.*\)$/\1/p' $lib` if test -z "$libdir"; then $echo "$modename: \`$lib' is not a valid libtool archive" 1>&2 exit $EXIT_FAILURE fi newdlfiles="$newdlfiles $libdir/$name" done dlfiles="$newdlfiles" newdlprefiles= for lib in $dlprefiles; do name=`$echo "X$lib" | $Xsed -e 's%^.*/%%'` eval libdir=`${SED} -n -e 's/^libdir=\(.*\)$/\1/p' $lib` if test -z "$libdir"; then $echo "$modename: \`$lib' is not a valid libtool archive" 1>&2 exit $EXIT_FAILURE fi newdlprefiles="$newdlprefiles $libdir/$name" done dlprefiles="$newdlprefiles" else newdlfiles= for lib in $dlfiles; do case $lib in [\\/]* | [A-Za-z]:[\\/]*) abs="$lib" ;; *) abs=`pwd`"/$lib" ;; esac newdlfiles="$newdlfiles $abs" done dlfiles="$newdlfiles" newdlprefiles= for lib in $dlprefiles; do case $lib in [\\/]* | [A-Za-z]:[\\/]*) abs="$lib" ;; *) abs=`pwd`"/$lib" ;; esac newdlprefiles="$newdlprefiles $abs" done dlprefiles="$newdlprefiles" fi $rm $output # place dlname in correct position for cygwin tdlname=$dlname case $host,$output,$installed,$module,$dlname in *cygwin*,*lai,yes,no,*.dll | *mingw*,*lai,yes,no,*.dll) tdlname=../bin/$dlname ;; esac $echo > $output "\ # $outputname - a libtool library file # Generated by $PROGRAM - GNU $PACKAGE $VERSION$TIMESTAMP # # Please DO NOT delete this file! # It is necessary for linking the library. # The name that we can dlopen(3). dlname='$tdlname' # Names of this library. library_names='$library_names' # The name of the static archive. old_library='$old_library' # Libraries that this one depends upon. dependency_libs='$dependency_libs' # Version information for $libname. current=$current age=$age revision=$revision # Is this an already installed library? installed=$installed # Should we warn about portability when linking against -modules? shouldnotlink=$module # Files to dlopen/dlpreopen dlopen='$dlfiles' dlpreopen='$dlprefiles' # Directory that this library needs to be installed in: libdir='$install_libdir'" if test "$installed" = no && test "$need_relink" = yes; then $echo >> $output "\ relink_command=\"$relink_command\"" fi done fi # Do a symbolic link so that the libtool archive can be found in # LD_LIBRARY_PATH before the program is installed. $show "(cd $output_objdir && $rm $outputname && $LN_S ../$outputname $outputname)" $run eval '(cd $output_objdir && $rm $outputname && $LN_S ../$outputname $outputname)' || exit $? ;; esac exit $EXIT_SUCCESS ;; # libtool install mode install) modename="$modename: install" # There may be an optional sh(1) argument at the beginning of # install_prog (especially on Windows NT). if test "$nonopt" = "$SHELL" || test "$nonopt" = /bin/sh || # Allow the use of GNU shtool's install command. $echo "X$nonopt" | $Xsed | grep shtool > /dev/null; then # Aesthetically quote it. arg=`$echo "X$nonopt" | $Xsed -e "$sed_quote_subst"` case $arg in *[\[\~\#\^\&\*\(\)\{\}\|\;\<\>\?\'\ \ ]*|*]*) arg="\"$arg\"" ;; esac install_prog="$arg " arg="$1" shift else install_prog= arg="$nonopt" fi # The real first argument should be the name of the installation program. # Aesthetically quote it. arg=`$echo "X$arg" | $Xsed -e "$sed_quote_subst"` case $arg in *[\[\~\#\^\&\*\(\)\{\}\|\;\<\>\?\'\ \ ]*|*]*) arg="\"$arg\"" ;; esac install_prog="$install_prog$arg" # We need to accept at least all the BSD install flags. dest= files= opts= prev= install_type= isdir=no stripme= for arg do if test -n "$dest"; then files="$files $dest" dest="$arg" continue fi case $arg in -d) isdir=yes ;; -f) prev="-f" ;; -g) prev="-g" ;; -m) prev="-m" ;; -o) prev="-o" ;; -s) stripme=" -s" continue ;; -*) ;; *) # If the previous option needed an argument, then skip it. if test -n "$prev"; then prev= else dest="$arg" continue fi ;; esac # Aesthetically quote the argument. arg=`$echo "X$arg" | $Xsed -e "$sed_quote_subst"` case $arg in *[\[\~\#\^\&\*\(\)\{\}\|\;\<\>\?\'\ \ ]*|*]*) arg="\"$arg\"" ;; esac install_prog="$install_prog $arg" done if test -z "$install_prog"; then $echo "$modename: you must specify an install program" 1>&2 $echo "$help" 1>&2 exit $EXIT_FAILURE fi if test -n "$prev"; then $echo "$modename: the \`$prev' option requires an argument" 1>&2 $echo "$help" 1>&2 exit $EXIT_FAILURE fi if test -z "$files"; then if test -z "$dest"; then $echo "$modename: no file or destination specified" 1>&2 else $echo "$modename: you must specify a destination" 1>&2 fi $echo "$help" 1>&2 exit $EXIT_FAILURE fi # Strip any trailing slash from the destination. dest=`$echo "X$dest" | $Xsed -e 's%/$%%'` # Check to see that the destination is a directory. test -d "$dest" && isdir=yes if test "$isdir" = yes; then destdir="$dest" destname= else destdir=`$echo "X$dest" | $Xsed -e 's%/[^/]*$%%'` test "X$destdir" = "X$dest" && destdir=. destname=`$echo "X$dest" | $Xsed -e 's%^.*/%%'` # Not a directory, so check to see that there is only one file specified. set dummy $files if test "$#" -gt 2; then $echo "$modename: \`$dest' is not a directory" 1>&2 $echo "$help" 1>&2 exit $EXIT_FAILURE fi fi case $destdir in [\\/]* | [A-Za-z]:[\\/]*) ;; *) for file in $files; do case $file in *.lo) ;; *) $echo "$modename: \`$destdir' must be an absolute directory name" 1>&2 $echo "$help" 1>&2 exit $EXIT_FAILURE ;; esac done ;; esac # This variable tells wrapper scripts just to set variables rather # than running their programs. libtool_install_magic="$magic" staticlibs= future_libdirs= current_libdirs= for file in $files; do # Do each installation. case $file in *.$libext) # Do the static libraries later. staticlibs="$staticlibs $file" ;; *.la) # Check to see that this really is a libtool archive. if (${SED} -e '2q' $file | grep "^# Generated by .*$PACKAGE") >/dev/null 2>&1; then : else $echo "$modename: \`$file' is not a valid libtool archive" 1>&2 $echo "$help" 1>&2 exit $EXIT_FAILURE fi library_names= old_library= relink_command= # If there is no directory component, then add one. case $file in */* | *\\*) . $file ;; *) . ./$file ;; esac # Add the libdir to current_libdirs if it is the destination. if test "X$destdir" = "X$libdir"; then case "$current_libdirs " in *" $libdir "*) ;; *) current_libdirs="$current_libdirs $libdir" ;; esac else # Note the libdir as a future libdir. case "$future_libdirs " in *" $libdir "*) ;; *) future_libdirs="$future_libdirs $libdir" ;; esac fi dir=`$echo "X$file" | $Xsed -e 's%/[^/]*$%%'`/ test "X$dir" = "X$file/" && dir= dir="$dir$objdir" if test -n "$relink_command"; then # Determine the prefix the user has applied to our future dir. inst_prefix_dir=`$echo "$destdir" | $SED "s%$libdir\$%%"` # Don't allow the user to place us outside of our expected # location b/c this prevents finding dependent libraries that # are installed to the same prefix. # At present, this check doesn't affect windows .dll's that # are installed into $libdir/../bin (currently, that works fine) # but it's something to keep an eye on. if test "$inst_prefix_dir" = "$destdir"; then $echo "$modename: error: cannot install \`$file' to a directory not ending in $libdir" 1>&2 exit $EXIT_FAILURE fi if test -n "$inst_prefix_dir"; then # Stick the inst_prefix_dir data into the link command. relink_command=`$echo "$relink_command" | $SED "s%@inst_prefix_dir@%-inst-prefix-dir $inst_prefix_dir%"` else relink_command=`$echo "$relink_command" | $SED "s%@inst_prefix_dir@%%"` fi $echo "$modename: warning: relinking \`$file'" 1>&2 $show "$relink_command" if $run eval "$relink_command"; then : else $echo "$modename: error: relink \`$file' with the above command before installing it" 1>&2 exit $EXIT_FAILURE fi fi # See the names of the shared library. set dummy $library_names if test -n "$2"; then realname="$2" shift shift srcname="$realname" test -n "$relink_command" && srcname="$realname"T # Install the shared library and build the symlinks. $show "$install_prog $dir/$srcname $destdir/$realname" $run eval "$install_prog $dir/$srcname $destdir/$realname" || exit $? if test -n "$stripme" && test -n "$striplib"; then $show "$striplib $destdir/$realname" $run eval "$striplib $destdir/$realname" || exit $? fi if test "$#" -gt 0; then # Delete the old symlinks, and create new ones. for linkname do if test "$linkname" != "$realname"; then $show "(cd $destdir && $rm $linkname && $LN_S $realname $linkname)" $run eval "(cd $destdir && $rm $linkname && $LN_S $realname $linkname)" fi done fi # Do each command in the postinstall commands. lib="$destdir/$realname" cmds=$postinstall_cmds save_ifs="$IFS"; IFS='~' for cmd in $cmds; do IFS="$save_ifs" eval cmd=\"$cmd\" $show "$cmd" $run eval "$cmd" || exit $? done IFS="$save_ifs" fi # Install the pseudo-library for information purposes. case $host in *-*-freebsd*) # Do not install the useless pseudo-library ;; *) name=`$echo "X$file" | $Xsed -e 's%^.*/%%'` instname="$dir/$name"i $show "$install_prog $instname $destdir/$name" $run eval "$install_prog $instname $destdir/$name" || exit $? ;; esac # Maybe install the static library, too. test -n "$old_library" && staticlibs="$staticlibs $dir/$old_library" ;; *.lo) # Install (i.e. copy) a libtool object. # Figure out destination file name, if it wasn't already specified. if test -n "$destname"; then destfile="$destdir/$destname" else destfile=`$echo "X$file" | $Xsed -e 's%^.*/%%'` destfile="$destdir/$destfile" fi # Deduce the name of the destination old-style object file. case $destfile in *.lo) staticdest=`$echo "X$destfile" | $Xsed -e "$lo2o"` ;; *.$objext) staticdest="$destfile" destfile= ;; *) $echo "$modename: cannot copy a libtool object to \`$destfile'" 1>&2 $echo "$help" 1>&2 exit $EXIT_FAILURE ;; esac # Install the libtool object if requested. if test -n "$destfile"; then $show "$install_prog $file $destfile" $run eval "$install_prog $file $destfile" || exit $? fi # Install the old object if enabled. if test "$build_old_libs" = yes; then # Deduce the name of the old-style object file. staticobj=`$echo "X$file" | $Xsed -e "$lo2o"` $show "$install_prog $staticobj $staticdest" $run eval "$install_prog \$staticobj \$staticdest" || exit $? fi exit $EXIT_SUCCESS ;; *) # Figure out destination file name, if it wasn't already specified. if test -n "$destname"; then destfile="$destdir/$destname" else destfile=`$echo "X$file" | $Xsed -e 's%^.*/%%'` destfile="$destdir/$destfile" fi # If the file is missing, and there is a .exe on the end, strip it # because it is most likely a libtool script we actually want to # install stripped_ext="" case $file in *.exe) if test ! -f "$file"; then file=`$echo $file|${SED} 's,.exe$,,'` stripped_ext=".exe" fi ;; esac # Do a test to see if this is really a libtool program. case $host in *cygwin*|*mingw*) wrapper=`$echo $file | ${SED} -e 's,.exe$,,'` ;; *) wrapper=$file ;; esac if (${SED} -e '4q' $wrapper | grep "^# Generated by .*$PACKAGE")>/dev/null 2>&1; then notinst_deplibs= relink_command= # To insure that "foo" is sourced, and not "foo.exe", # finese the cygwin/MSYS system by explicitly sourcing "foo." # which disallows the automatic-append-.exe behavior. case $build in *cygwin* | *mingw*) wrapperdot=${wrapper}. ;; *) wrapperdot=${wrapper} ;; esac # If there is no directory component, then add one. case $file in */* | *\\*) . ${wrapperdot} ;; *) . ./${wrapperdot} ;; esac # Check the variables that should have been set. if test -z "$notinst_deplibs"; then $echo "$modename: invalid libtool wrapper script \`$wrapper'" 1>&2 exit $EXIT_FAILURE fi finalize=yes for lib in $notinst_deplibs; do # Check to see that each library is installed. libdir= if test -f "$lib"; then # If there is no directory component, then add one. case $lib in */* | *\\*) . $lib ;; *) . ./$lib ;; esac fi libfile="$libdir/"`$echo "X$lib" | $Xsed -e 's%^.*/%%g'` ### testsuite: skip nested quoting test if test -n "$libdir" && test ! -f "$libfile"; then $echo "$modename: warning: \`$lib' has not been installed in \`$libdir'" 1>&2 finalize=no fi done relink_command= # To insure that "foo" is sourced, and not "foo.exe", # finese the cygwin/MSYS system by explicitly sourcing "foo." # which disallows the automatic-append-.exe behavior. case $build in *cygwin* | *mingw*) wrapperdot=${wrapper}. ;; *) wrapperdot=${wrapper} ;; esac # If there is no directory component, then add one. case $file in */* | *\\*) . ${wrapperdot} ;; *) . ./${wrapperdot} ;; esac outputname= if test "$fast_install" = no && test -n "$relink_command"; then if test "$finalize" = yes && test -z "$run"; then tmpdir="/tmp" test -n "$TMPDIR" && tmpdir="$TMPDIR" tmpdir="$tmpdir/libtool-$$" save_umask=`umask` umask 0077 if $mkdir "$tmpdir"; then umask $save_umask else umask $save_umask $echo "$modename: error: cannot create temporary directory \`$tmpdir'" 1>&2 continue fi file=`$echo "X$file$stripped_ext" | $Xsed -e 's%^.*/%%'` outputname="$tmpdir/$file" # Replace the output file specification. relink_command=`$echo "X$relink_command" | $Xsed -e 's%@OUTPUT@%'"$outputname"'%g'` $show "$relink_command" if $run eval "$relink_command"; then : else $echo "$modename: error: relink \`$file' with the above command before installing it" 1>&2 ${rm}r "$tmpdir" continue fi file="$outputname" else $echo "$modename: warning: cannot relink \`$file'" 1>&2 fi else # Install the binary that we compiled earlier. file=`$echo "X$file$stripped_ext" | $Xsed -e "s%\([^/]*\)$%$objdir/\1%"` fi fi # remove .exe since cygwin /usr/bin/install will append another # one anyways case $install_prog,$host in */usr/bin/install*,*cygwin*) case $file:$destfile in *.exe:*.exe) # this is ok ;; *.exe:*) destfile=$destfile.exe ;; *:*.exe) destfile=`$echo $destfile | ${SED} -e 's,.exe$,,'` ;; esac ;; esac $show "$install_prog$stripme $file $destfile" $run eval "$install_prog\$stripme \$file \$destfile" || exit $? test -n "$outputname" && ${rm}r "$tmpdir" ;; esac done for file in $staticlibs; do name=`$echo "X$file" | $Xsed -e 's%^.*/%%'` # Set up the ranlib parameters. oldlib="$destdir/$name" $show "$install_prog $file $oldlib" $run eval "$install_prog \$file \$oldlib" || exit $? if test -n "$stripme" && test -n "$old_striplib"; then $show "$old_striplib $oldlib" $run eval "$old_striplib $oldlib" || exit $? fi # Do each command in the postinstall commands. cmds=$old_postinstall_cmds save_ifs="$IFS"; IFS='~' for cmd in $cmds; do IFS="$save_ifs" eval cmd=\"$cmd\" $show "$cmd" $run eval "$cmd" || exit $? done IFS="$save_ifs" done if test -n "$future_libdirs"; then $echo "$modename: warning: remember to run \`$progname --finish$future_libdirs'" 1>&2 fi if test -n "$current_libdirs"; then # Maybe just do a dry run. test -n "$run" && current_libdirs=" -n$current_libdirs" exec_cmd='$SHELL $progpath $preserve_args --finish$current_libdirs' else exit $EXIT_SUCCESS fi ;; # libtool finish mode finish) modename="$modename: finish" libdirs="$nonopt" admincmds= if test -n "$finish_cmds$finish_eval" && test -n "$libdirs"; then for dir do libdirs="$libdirs $dir" done for libdir in $libdirs; do if test -n "$finish_cmds"; then # Do each command in the finish commands. cmds=$finish_cmds save_ifs="$IFS"; IFS='~' for cmd in $cmds; do IFS="$save_ifs" eval cmd=\"$cmd\" $show "$cmd" $run eval "$cmd" || admincmds="$admincmds $cmd" done IFS="$save_ifs" fi if test -n "$finish_eval"; then # Do the single finish_eval. eval cmds=\"$finish_eval\" $run eval "$cmds" || admincmds="$admincmds $cmds" fi done fi # Exit here if they wanted silent mode. test "$show" = : && exit $EXIT_SUCCESS $echo "----------------------------------------------------------------------" $echo "Libraries have been installed in:" for libdir in $libdirs; do $echo " $libdir" done $echo $echo "If you ever happen to want to link against installed libraries" $echo "in a given directory, LIBDIR, you must either use libtool, and" $echo "specify the full pathname of the library, or use the \`-LLIBDIR'" $echo "flag during linking and do at least one of the following:" if test -n "$shlibpath_var"; then $echo " - add LIBDIR to the \`$shlibpath_var' environment variable" $echo " during execution" fi if test -n "$runpath_var"; then $echo " - add LIBDIR to the \`$runpath_var' environment variable" $echo " during linking" fi if test -n "$hardcode_libdir_flag_spec"; then libdir=LIBDIR eval flag=\"$hardcode_libdir_flag_spec\" $echo " - use the \`$flag' linker flag" fi if test -n "$admincmds"; then $echo " - have your system administrator run these commands:$admincmds" fi if test -f /etc/ld.so.conf; then $echo " - have your system administrator add LIBDIR to \`/etc/ld.so.conf'" fi $echo $echo "See any operating system documentation about shared libraries for" $echo "more information, such as the ld(1) and ld.so(8) manual pages." $echo "----------------------------------------------------------------------" exit $EXIT_SUCCESS ;; # libtool execute mode execute) modename="$modename: execute" # The first argument is the command name. cmd="$nonopt" if test -z "$cmd"; then $echo "$modename: you must specify a COMMAND" 1>&2 $echo "$help" exit $EXIT_FAILURE fi # Handle -dlopen flags immediately. for file in $execute_dlfiles; do if test ! -f "$file"; then $echo "$modename: \`$file' is not a file" 1>&2 $echo "$help" 1>&2 exit $EXIT_FAILURE fi dir= case $file in *.la) # Check to see that this really is a libtool archive. if (${SED} -e '2q' $file | grep "^# Generated by .*$PACKAGE") >/dev/null 2>&1; then : else $echo "$modename: \`$lib' is not a valid libtool archive" 1>&2 $echo "$help" 1>&2 exit $EXIT_FAILURE fi # Read the libtool library. dlname= library_names= # If there is no directory component, then add one. case $file in */* | *\\*) . $file ;; *) . ./$file ;; esac # Skip this library if it cannot be dlopened. if test -z "$dlname"; then # Warn if it was a shared library. test -n "$library_names" && $echo "$modename: warning: \`$file' was not linked with \`-export-dynamic'" continue fi dir=`$echo "X$file" | $Xsed -e 's%/[^/]*$%%'` test "X$dir" = "X$file" && dir=. if test -f "$dir/$objdir/$dlname"; then dir="$dir/$objdir" else $echo "$modename: cannot find \`$dlname' in \`$dir' or \`$dir/$objdir'" 1>&2 exit $EXIT_FAILURE fi ;; *.lo) # Just add the directory containing the .lo file. dir=`$echo "X$file" | $Xsed -e 's%/[^/]*$%%'` test "X$dir" = "X$file" && dir=. ;; *) $echo "$modename: warning \`-dlopen' is ignored for non-libtool libraries and objects" 1>&2 continue ;; esac # Get the absolute pathname. absdir=`cd "$dir" && pwd` test -n "$absdir" && dir="$absdir" # Now add the directory to shlibpath_var. if eval "test -z \"\$$shlibpath_var\""; then eval "$shlibpath_var=\"\$dir\"" else eval "$shlibpath_var=\"\$dir:\$$shlibpath_var\"" fi done # This variable tells wrapper scripts just to set shlibpath_var # rather than running their programs. libtool_execute_magic="$magic" # Check if any of the arguments is a wrapper script. args= for file do case $file in -*) ;; *) # Do a test to see if this is really a libtool program. if (${SED} -e '4q' $file | grep "^# Generated by .*$PACKAGE") >/dev/null 2>&1; then # If there is no directory component, then add one. case $file in */* | *\\*) . $file ;; *) . ./$file ;; esac # Transform arg to wrapped name. file="$progdir/$program" fi ;; esac # Quote arguments (to preserve shell metacharacters). file=`$echo "X$file" | $Xsed -e "$sed_quote_subst"` args="$args \"$file\"" done if test -z "$run"; then if test -n "$shlibpath_var"; then # Export the shlibpath_var. eval "export $shlibpath_var" fi # Restore saved environment variables if test "${save_LC_ALL+set}" = set; then LC_ALL="$save_LC_ALL"; export LC_ALL fi if test "${save_LANG+set}" = set; then LANG="$save_LANG"; export LANG fi # Now prepare to actually exec the command. exec_cmd="\$cmd$args" else # Display what would be done. if test -n "$shlibpath_var"; then eval "\$echo \"\$shlibpath_var=\$$shlibpath_var\"" $echo "export $shlibpath_var" fi $echo "$cmd$args" exit $EXIT_SUCCESS fi ;; # libtool clean and uninstall mode clean | uninstall) modename="$modename: $mode" rm="$nonopt" files= rmforce= exit_status=0 # This variable tells wrapper scripts just to set variables rather # than running their programs. libtool_install_magic="$magic" for arg do case $arg in -f) rm="$rm $arg"; rmforce=yes ;; -*) rm="$rm $arg" ;; *) files="$files $arg" ;; esac done if test -z "$rm"; then $echo "$modename: you must specify an RM program" 1>&2 $echo "$help" 1>&2 exit $EXIT_FAILURE fi rmdirs= origobjdir="$objdir" for file in $files; do dir=`$echo "X$file" | $Xsed -e 's%/[^/]*$%%'` if test "X$dir" = "X$file"; then dir=. objdir="$origobjdir" else objdir="$dir/$origobjdir" fi name=`$echo "X$file" | $Xsed -e 's%^.*/%%'` test "$mode" = uninstall && objdir="$dir" # Remember objdir for removal later, being careful to avoid duplicates if test "$mode" = clean; then case " $rmdirs " in *" $objdir "*) ;; *) rmdirs="$rmdirs $objdir" ;; esac fi # Don't error if the file doesn't exist and rm -f was used. if (test -L "$file") >/dev/null 2>&1 \ || (test -h "$file") >/dev/null 2>&1 \ || test -f "$file"; then : elif test -d "$file"; then exit_status=1 continue elif test "$rmforce" = yes; then continue fi rmfiles="$file" case $name in *.la) # Possibly a libtool archive, so verify it. if (${SED} -e '2q' $file | grep "^# Generated by .*$PACKAGE") >/dev/null 2>&1; then . $dir/$name # Delete the libtool libraries and symlinks. for n in $library_names; do rmfiles="$rmfiles $objdir/$n" done test -n "$old_library" && rmfiles="$rmfiles $objdir/$old_library" test "$mode" = clean && rmfiles="$rmfiles $objdir/$name $objdir/${name}i" if test "$mode" = uninstall; then if test -n "$library_names"; then # Do each command in the postuninstall commands. cmds=$postuninstall_cmds save_ifs="$IFS"; IFS='~' for cmd in $cmds; do IFS="$save_ifs" eval cmd=\"$cmd\" $show "$cmd" $run eval "$cmd" if test "$?" -ne 0 && test "$rmforce" != yes; then exit_status=1 fi done IFS="$save_ifs" fi if test -n "$old_library"; then # Do each command in the old_postuninstall commands. cmds=$old_postuninstall_cmds save_ifs="$IFS"; IFS='~' for cmd in $cmds; do IFS="$save_ifs" eval cmd=\"$cmd\" $show "$cmd" $run eval "$cmd" if test "$?" -ne 0 && test "$rmforce" != yes; then exit_status=1 fi done IFS="$save_ifs" fi # FIXME: should reinstall the best remaining shared library. fi fi ;; *.lo) # Possibly a libtool object, so verify it. if (${SED} -e '2q' $file | grep "^# Generated by .*$PACKAGE") >/dev/null 2>&1; then # Read the .lo file . $dir/$name # Add PIC object to the list of files to remove. if test -n "$pic_object" \ && test "$pic_object" != none; then rmfiles="$rmfiles $dir/$pic_object" fi # Add non-PIC object to the list of files to remove. if test -n "$non_pic_object" \ && test "$non_pic_object" != none; then rmfiles="$rmfiles $dir/$non_pic_object" fi fi ;; *) if test "$mode" = clean ; then noexename=$name case $file in *.exe) file=`$echo $file|${SED} 's,.exe$,,'` noexename=`$echo $name|${SED} 's,.exe$,,'` # $file with .exe has already been added to rmfiles, # add $file without .exe rmfiles="$rmfiles $file" ;; esac # Do a test to see if this is a libtool program. if (${SED} -e '4q' $file | grep "^# Generated by .*$PACKAGE") >/dev/null 2>&1; then relink_command= . $dir/$noexename # note $name still contains .exe if it was in $file originally # as does the version of $file that was added into $rmfiles rmfiles="$rmfiles $objdir/$name $objdir/${name}S.${objext}" if test "$fast_install" = yes && test -n "$relink_command"; then rmfiles="$rmfiles $objdir/lt-$name" fi if test "X$noexename" != "X$name" ; then rmfiles="$rmfiles $objdir/lt-${noexename}.c" fi fi fi ;; esac $show "$rm $rmfiles" $run $rm $rmfiles || exit_status=1 done objdir="$origobjdir" # Try to remove the ${objdir}s in the directories where we deleted files for dir in $rmdirs; do if test -d "$dir"; then $show "rmdir $dir" $run rmdir $dir >/dev/null 2>&1 fi done exit $exit_status ;; "") $echo "$modename: you must specify a MODE" 1>&2 $echo "$generic_help" 1>&2 exit $EXIT_FAILURE ;; esac if test -z "$exec_cmd"; then $echo "$modename: invalid operation mode \`$mode'" 1>&2 $echo "$generic_help" 1>&2 exit $EXIT_FAILURE fi fi # test -z "$show_help" if test -n "$exec_cmd"; then eval exec $exec_cmd exit $EXIT_FAILURE fi # We need to display help for each of the modes. case $mode in "") $echo \ "Usage: $modename [OPTION]... [MODE-ARG]... Provide generalized library-building support services. --config show all configuration variables --debug enable verbose shell tracing -n, --dry-run display commands without modifying any files --features display basic configuration information and exit --finish same as \`--mode=finish' --help display this help message and exit --mode=MODE use operation mode MODE [default=inferred from MODE-ARGS] --quiet same as \`--silent' --silent don't print informational messages --tag=TAG use configuration variables from tag TAG --version print version information MODE must be one of the following: clean remove files from the build directory compile compile a source file into a libtool object execute automatically set library path, then run a program finish complete the installation of libtool libraries install install libraries or executables link create a library or an executable uninstall remove libraries from an installed directory MODE-ARGS vary depending on the MODE. Try \`$modename --help --mode=MODE' for a more detailed description of MODE. Report bugs to ." exit $EXIT_SUCCESS ;; clean) $echo \ "Usage: $modename [OPTION]... --mode=clean RM [RM-OPTION]... FILE... Remove files from the build directory. RM is the name of the program to use to delete files associated with each FILE (typically \`/bin/rm'). RM-OPTIONS are options (such as \`-f') to be passed to RM. If FILE is a libtool library, object or program, all the files associated with it are deleted. Otherwise, only FILE itself is deleted using RM." ;; compile) $echo \ "Usage: $modename [OPTION]... --mode=compile COMPILE-COMMAND... SOURCEFILE Compile a source file into a libtool library object. This mode accepts the following additional options: -o OUTPUT-FILE set the output file name to OUTPUT-FILE -prefer-pic try to building PIC objects only -prefer-non-pic try to building non-PIC objects only -static always build a \`.o' file suitable for static linking COMPILE-COMMAND is a command to be used in creating a \`standard' object file from the given SOURCEFILE. The output file name is determined by removing the directory component from SOURCEFILE, then substituting the C source code suffix \`.c' with the library object suffix, \`.lo'." ;; execute) $echo \ "Usage: $modename [OPTION]... --mode=execute COMMAND [ARGS]... Automatically set library path, then run a program. This mode accepts the following additional options: -dlopen FILE add the directory containing FILE to the library path This mode sets the library path environment variable according to \`-dlopen' flags. If any of the ARGS are libtool executable wrappers, then they are translated into their corresponding uninstalled binary, and any of their required library directories are added to the library path. Then, COMMAND is executed, with ARGS as arguments." ;; finish) $echo \ "Usage: $modename [OPTION]... --mode=finish [LIBDIR]... Complete the installation of libtool libraries. Each LIBDIR is a directory that contains libtool libraries. The commands that this mode executes may require superuser privileges. Use the \`--dry-run' option if you just want to see what would be executed." ;; install) $echo \ "Usage: $modename [OPTION]... --mode=install INSTALL-COMMAND... Install executables or libraries. INSTALL-COMMAND is the installation command. The first component should be either the \`install' or \`cp' program. The rest of the components are interpreted as arguments to that command (only BSD-compatible install options are recognized)." ;; link) $echo \ "Usage: $modename [OPTION]... --mode=link LINK-COMMAND... Link object files or libraries together to form another library, or to create an executable program. LINK-COMMAND is a command using the C compiler that you would use to create a program from several object files. The following components of LINK-COMMAND are treated specially: -all-static do not do any dynamic linking at all -avoid-version do not add a version suffix if possible -dlopen FILE \`-dlpreopen' FILE if it cannot be dlopened at runtime -dlpreopen FILE link in FILE and add its symbols to lt_preloaded_symbols -export-dynamic allow symbols from OUTPUT-FILE to be resolved with dlsym(3) -export-symbols SYMFILE try to export only the symbols listed in SYMFILE -export-symbols-regex REGEX try to export only the symbols matching REGEX -LLIBDIR search LIBDIR for required installed libraries -lNAME OUTPUT-FILE requires the installed library libNAME -module build a library that can dlopened -no-fast-install disable the fast-install mode -no-install link a not-installable executable -no-undefined declare that a library does not refer to external symbols -o OUTPUT-FILE create OUTPUT-FILE from the specified objects -objectlist FILE Use a list of object files found in FILE to specify objects -precious-files-regex REGEX don't remove output files matching REGEX -release RELEASE specify package release information -rpath LIBDIR the created library will eventually be installed in LIBDIR -R[ ]LIBDIR add LIBDIR to the runtime path of programs and libraries -static do not do any dynamic linking of libtool libraries -version-info CURRENT[:REVISION[:AGE]] specify library version info [each variable defaults to 0] All other options (arguments beginning with \`-') are ignored. Every other argument is treated as a filename. Files ending in \`.la' are treated as uninstalled libtool libraries, other files are standard or library object files. If the OUTPUT-FILE ends in \`.la', then a libtool library is created, only library objects (\`.lo' files) may be specified, and \`-rpath' is required, except when creating a convenience library. If OUTPUT-FILE ends in \`.a' or \`.lib', then a standard library is created using \`ar' and \`ranlib', or on Windows using \`lib'. If OUTPUT-FILE ends in \`.lo' or \`.${objext}', then a reloadable object file is created, otherwise an executable program is created." ;; uninstall) $echo \ "Usage: $modename [OPTION]... --mode=uninstall RM [RM-OPTION]... FILE... Remove libraries from an installation directory. RM is the name of the program to use to delete files associated with each FILE (typically \`/bin/rm'). RM-OPTIONS are options (such as \`-f') to be passed to RM. If FILE is a libtool library, all the files associated with it are deleted. Otherwise, only FILE itself is deleted using RM." ;; *) $echo "$modename: invalid operation mode \`$mode'" 1>&2 $echo "$help" 1>&2 exit $EXIT_FAILURE ;; esac $echo $echo "Try \`$modename --help' for more information about other modes." exit $EXIT_SUCCESS # The TAGs below are defined such that we never get into a situation # in which we disable both kinds of libraries. Given conflicting # choices, we go for a static library, that is the most portable, # since we can't tell whether shared libraries were disabled because # the user asked for that or because the platform doesn't support # them. This is particularly important on AIX, because we don't # support having both static and shared libraries enabled at the same # time on that platform, so we default to a shared-only configuration. # If a disable-shared tag is given, we'll fallback to a static-only # configuration. But we'll never go from static-only to shared-only. # ### BEGIN LIBTOOL TAG CONFIG: disable-shared build_libtool_libs=no build_old_libs=yes # ### END LIBTOOL TAG CONFIG: disable-shared # ### BEGIN LIBTOOL TAG CONFIG: disable-static build_old_libs=`case $build_libtool_libs in yes) $echo no;; *) $echo yes;; esac` # ### END LIBTOOL TAG CONFIG: disable-static # Local Variables: # mode:shell-script # sh-indentation:2 # End: libtranslate-0.99/missing000755 001750 001750 00000021231 10161371573 017277 0ustar00jylefortjylefort000000 000000 #! /bin/sh # Common stub for a few missing GNU programs while installing. # Copyright 1996, 1997, 1999, 2000 Free Software Foundation, Inc. # Originally by Fran,cois Pinard , 1996. # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2, or (at your option) # any later version. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA # 02111-1307, USA. # As a special exception to the GNU General Public License, if you # distribute this file as part of a program that contains a # configuration script generated by Autoconf, you may include it under # the same distribution terms that you use for the rest of that program. if test $# -eq 0; then echo 1>&2 "Try \`$0 --help' for more information" exit 1 fi run=: # In the cases where this matters, `missing' is being run in the # srcdir already. if test -f configure.ac; then configure_ac=configure.ac else configure_ac=configure.in fi case "$1" in --run) # Try to run requested program, and just exit if it succeeds. run= shift "$@" && exit 0 ;; esac # If it does not exist, or fails to run (possibly an outdated version), # try to emulate it. case "$1" in -h|--h|--he|--hel|--help) echo "\ $0 [OPTION]... PROGRAM [ARGUMENT]... Handle \`PROGRAM [ARGUMENT]...' for when PROGRAM is missing, or return an error status if there is no known handling for PROGRAM. Options: -h, --help display this help and exit -v, --version output version information and exit --run try to run the given command, and emulate it if it fails Supported PROGRAM values: aclocal touch file \`aclocal.m4' autoconf touch file \`configure' autoheader touch file \`config.h.in' automake touch all \`Makefile.in' files bison create \`y.tab.[ch]', if possible, from existing .[ch] flex create \`lex.yy.c', if possible, from existing .c help2man touch the output file lex create \`lex.yy.c', if possible, from existing .c makeinfo touch the output file tar try tar, gnutar, gtar, then tar without non-portable flags yacc create \`y.tab.[ch]', if possible, from existing .[ch]" ;; -v|--v|--ve|--ver|--vers|--versi|--versio|--version) echo "missing 0.3 - GNU automake" ;; -*) echo 1>&2 "$0: Unknown \`$1' option" echo 1>&2 "Try \`$0 --help' for more information" exit 1 ;; aclocal) echo 1>&2 "\ WARNING: \`$1' is missing on your system. You should only need it if you modified \`acinclude.m4' or \`${configure_ac}'. You might want to install the \`Automake' and \`Perl' packages. Grab them from any GNU archive site." touch aclocal.m4 ;; autoconf) echo 1>&2 "\ WARNING: \`$1' is missing on your system. You should only need it if you modified \`${configure_ac}'. You might want to install the \`Autoconf' and \`GNU m4' packages. Grab them from any GNU archive site." touch configure ;; autoheader) echo 1>&2 "\ WARNING: \`$1' is missing on your system. You should only need it if you modified \`acconfig.h' or \`${configure_ac}'. You might want to install the \`Autoconf' and \`GNU m4' packages. Grab them from any GNU archive site." files=`sed -n 's/^[ ]*A[CM]_CONFIG_HEADER(\([^)]*\)).*/\1/p' ${configure_ac}` test -z "$files" && files="config.h" touch_files= for f in $files; do case "$f" in *:*) touch_files="$touch_files "`echo "$f" | sed -e 's/^[^:]*://' -e 's/:.*//'`;; *) touch_files="$touch_files $f.in";; esac done touch $touch_files ;; automake) echo 1>&2 "\ WARNING: \`$1' is missing on your system. You should only need it if you modified \`Makefile.am', \`acinclude.m4' or \`${configure_ac}'. You might want to install the \`Automake' and \`Perl' packages. Grab them from any GNU archive site." find . -type f -name Makefile.am -print | sed 's/\.am$/.in/' | while read f; do touch "$f"; done ;; bison|yacc) echo 1>&2 "\ WARNING: \`$1' is missing on your system. You should only need it if you modified a \`.y' file. You may need the \`Bison' package in order for those modifications to take effect. You can get \`Bison' from any GNU archive site." rm -f y.tab.c y.tab.h if [ $# -ne 1 ]; then eval LASTARG="\${$#}" case "$LASTARG" in *.y) SRCFILE=`echo "$LASTARG" | sed 's/y$/c/'` if [ -f "$SRCFILE" ]; then cp "$SRCFILE" y.tab.c fi SRCFILE=`echo "$LASTARG" | sed 's/y$/h/'` if [ -f "$SRCFILE" ]; then cp "$SRCFILE" y.tab.h fi ;; esac fi if [ ! -f y.tab.h ]; then echo >y.tab.h fi if [ ! -f y.tab.c ]; then echo 'main() { return 0; }' >y.tab.c fi ;; lex|flex) echo 1>&2 "\ WARNING: \`$1' is missing on your system. You should only need it if you modified a \`.l' file. You may need the \`Flex' package in order for those modifications to take effect. You can get \`Flex' from any GNU archive site." rm -f lex.yy.c if [ $# -ne 1 ]; then eval LASTARG="\${$#}" case "$LASTARG" in *.l) SRCFILE=`echo "$LASTARG" | sed 's/l$/c/'` if [ -f "$SRCFILE" ]; then cp "$SRCFILE" lex.yy.c fi ;; esac fi if [ ! -f lex.yy.c ]; then echo 'main() { return 0; }' >lex.yy.c fi ;; help2man) echo 1>&2 "\ WARNING: \`$1' is missing on your system. You should only need it if you modified a dependency of a manual page. You may need the \`Help2man' package in order for those modifications to take effect. You can get \`Help2man' from any GNU archive site." file=`echo "$*" | sed -n 's/.*-o \([^ ]*\).*/\1/p'` if test -z "$file"; then file=`echo "$*" | sed -n 's/.*--output=\([^ ]*\).*/\1/p'` fi if [ -f "$file" ]; then touch $file else test -z "$file" || exec >$file echo ".ab help2man is required to generate this page" exit 1 fi ;; makeinfo) if test -z "$run" && (makeinfo --version) > /dev/null 2>&1; then # We have makeinfo, but it failed. exit 1 fi echo 1>&2 "\ WARNING: \`$1' is missing on your system. You should only need it if you modified a \`.texi' or \`.texinfo' file, or any other file indirectly affecting the aspect of the manual. The spurious call might also be the consequence of using a buggy \`make' (AIX, DU, IRIX). You might want to install the \`Texinfo' package or the \`GNU make' package. Grab either from any GNU archive site." file=`echo "$*" | sed -n 's/.*-o \([^ ]*\).*/\1/p'` if test -z "$file"; then file=`echo "$*" | sed 's/.* \([^ ]*\) *$/\1/'` file=`sed -n '/^@setfilename/ { s/.* \([^ ]*\) *$/\1/; p; q; }' $file` fi touch $file ;; tar) shift if test -n "$run"; then echo 1>&2 "ERROR: \`tar' requires --run" exit 1 fi # We have already tried tar in the generic part. # Look for gnutar/gtar before invocation to avoid ugly error # messages. if (gnutar --version > /dev/null 2>&1); then gnutar ${1+"$@"} && exit 0 fi if (gtar --version > /dev/null 2>&1); then gtar ${1+"$@"} && exit 0 fi firstarg="$1" if shift; then case "$firstarg" in *o*) firstarg=`echo "$firstarg" | sed s/o//` tar "$firstarg" ${1+"$@"} && exit 0 ;; esac case "$firstarg" in *h*) firstarg=`echo "$firstarg" | sed s/h//` tar "$firstarg" ${1+"$@"} && exit 0 ;; esac fi echo 1>&2 "\ WARNING: I can't seem to be able to run \`tar' with the given arguments. You may want to install GNU tar or Free paxutils, or check the command line arguments." exit 1 ;; *) echo 1>&2 "\ WARNING: \`$1' is needed, and you do not seem to have it handy on your system. You might have modified some files without having the proper tools for further handling them. Check the \`README' file, it often tells you about the needed prerequirements for installing this package. You may also peek at any GNU archive site, in case some other package would contain this missing \`$1' program." exit 1 ;; esac exit 0 libtranslate-0.99/mkinstalldirs000755 001750 001750 00000001332 10161371573 020506 0ustar00jylefortjylefort000000 000000 #! /bin/sh # mkinstalldirs --- make directory hierarchy # Author: Noah Friedman # Created: 1993-05-16 # Public domain # $Id: mkinstalldirs,v 1.1.1.1 2004/12/19 21:32:43 jylefort Exp $ errstatus=0 for file do set fnord `echo ":$file" | sed -ne 's/^:\//#/;s/^://;s/\// /g;s/^#/\//;p'` shift pathcomp= for d do pathcomp="$pathcomp$d" case "$pathcomp" in -* ) pathcomp=./$pathcomp ;; esac if test ! -d "$pathcomp"; then echo "mkdir $pathcomp" mkdir "$pathcomp" || lasterr=$? if test ! -d "$pathcomp"; then errstatus=$lasterr fi fi pathcomp="$pathcomp/" done done exit $errstatus # mkinstalldirs ends here libtranslate-0.99/autogen.sh000755 001750 001750 00000000302 10161371573 017675 0ustar00jylefortjylefort000000 000000 #!/bin/sh run() { echo "Running $1..." $1 || exit } . autotools.conf run "$LIBTOOLIZE" run "$ACLOCAL" run "$AUTOHEADER" run "$AUTOCONF" run "$AUTOMAKE" echo "Finished successfully." libtranslate-0.99/src000777 001750 001750 00000000000 10176431054 016412 5ustar00jylefortjylefort000000 000000 libtranslate-0.99/src/translate-common.h000644 001750 001750 00000004200 10172765603 022123 0ustar00jylefortjylefort000000 000000 /* * Copyright (C) 2004, 2005 Jean-Yves Lefort * All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in the * documentation and/or other materials provided with the distribution. * 3. Neither the name of Jean-Yves Lefort nor the names of its contributors * may be used to endorse or promote products derived from this software * without specific prior written permission. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND * CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, * INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF * MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE * DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS * BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, * EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED * TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON * ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, * OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY * OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE * POSSIBILITY OF SUCH DAMAGE. */ #ifndef _TRANSLATE_COMMON_H #define _TRANSLATE_COMMON_H #include G_BEGIN_DECLS /** * TranslateProgressFunc: * @progress: the task progress from 0.0 to 1.0 inclusive, or -1 if * the progress is not known. * @user_data: data associated with the function. * * Specifies the type of function which is called when a task has just * progressed. * * Return value: the function should return %FALSE if the task must be * cancelled. **/ typedef gboolean (*TranslateProgressFunc) (double progress, gpointer user_data); G_END_DECLS #endif /* _TRANSLATE_COMMON_H */ libtranslate-0.99/src/translate-pair.h000644 001750 001750 00000007120 10172765630 021572 0ustar00jylefortjylefort000000 000000 /* * Copyright (C) 2004, 2005 Jean-Yves Lefort * All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in the * documentation and/or other materials provided with the distribution. * 3. Neither the name of Jean-Yves Lefort nor the names of its contributors * may be used to endorse or promote products derived from this software * without specific prior written permission. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND * CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, * INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF * MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE * DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS * BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, * EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED * TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON * ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, * OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY * OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE * POSSIBILITY OF SUCH DAMAGE. */ #ifndef _TRANSLATE_PAIR_H #define _TRANSLATE_PAIR_H #include G_BEGIN_DECLS #define TRANSLATE_TYPE_PAIR (translate_pair_get_type()) #define TRANSLATE_PAIR(obj) (G_TYPE_CHECK_INSTANCE_CAST((obj), TRANSLATE_TYPE_PAIR, TranslatePair)) #define TRANSLATE_PAIR_CLASS(klass) (G_TYPE_CHECK_CLASS_CAST((klass), TRANSLATE_TYPE_PAIR, TranslatePairClass)) #define TRANSLATE_IS_PAIR(obj) (G_TYPE_CHECK_INSTANCE_TYPE((obj), TRANSLATE_TYPE_PAIR)) #define TRANSLATE_IS_PAIR_CLASS(klass) (G_TYPE_CHECK_CLASS_TYPE((klass), TRANSLATE_TYPE_PAIR)) #define TRANSLATE_PAIR_GET_CLASS(obj) (G_TYPE_INSTANCE_GET_CLASS((obj), TRANSLATE_TYPE_PAIR, TranslatePairClass)) #define TRANSLATE_TYPE_PAIR_FLAGS (translate_pair_flags_get_type()) typedef struct _TranslatePair TranslatePair; typedef struct _TranslatePairClass TranslatePairClass; typedef struct _TranslatePairPrivate TranslatePairPrivate; struct _TranslatePair { GObject parent; TranslatePairPrivate *priv; }; struct _TranslatePairClass { GObjectClass parent; void (*reserved1) (void); void (*reserved2) (void); void (*reserved3) (void); void (*reserved4) (void); void (*reserved5) (void); void (*reserved6) (void); void (*reserved7) (void); void (*reserved8) (void); }; typedef enum { TRANSLATE_PAIR_TEXT = 1 << 0, TRANSLATE_PAIR_WEB_PAGE = 1 << 1 } TranslatePairFlags; GType translate_pair_get_type (void); GType translate_pair_flags_get_type (void); TranslatePair *translate_pair_new (TranslatePairFlags flags, const char *from, const char *to); TranslatePairFlags translate_pair_get_flags (TranslatePair *pair); const char *translate_pair_get_from (TranslatePair *pair); const char *translate_pair_get_to (TranslatePair *pair); GSList *translate_pairs_sort_by_tag (GSList *pairs); GSList *translate_pairs_sort_by_name (GSList *pairs); TranslatePair *translate_pairs_find (const GSList *pairs, const char *from, const char *to); G_END_DECLS #endif /* _TRANSLATE_PAIR_H */ libtranslate-0.99/src/translate-service.h000644 001750 001750 00000007570 10172765651 022313 0ustar00jylefortjylefort000000 000000 /* * Copyright (C) 2004, 2005 Jean-Yves Lefort * All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in the * documentation and/or other materials provided with the distribution. * 3. Neither the name of Jean-Yves Lefort nor the names of its contributors * may be used to endorse or promote products derived from this software * without specific prior written permission. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND * CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, * INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF * MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE * DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS * BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, * EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED * TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON * ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, * OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY * OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE * POSSIBILITY OF SUCH DAMAGE. */ #ifndef _TRANSLATE_SERVICE_H #define _TRANSLATE_SERVICE_H #include #include G_BEGIN_DECLS #define TRANSLATE_TYPE_SERVICE (translate_service_get_type()) #define TRANSLATE_SERVICE(obj) (G_TYPE_CHECK_INSTANCE_CAST((obj), TRANSLATE_TYPE_SERVICE, TranslateService)) #define TRANSLATE_SERVICE_CLASS(klass) (G_TYPE_CHECK_CLASS_CAST((klass), TRANSLATE_TYPE_SERVICE, TranslateServiceClass)) #define TRANSLATE_IS_SERVICE(obj) (G_TYPE_CHECK_INSTANCE_TYPE((obj), TRANSLATE_TYPE_SERVICE)) #define TRANSLATE_IS_SERVICE_CLASS(klass) (G_TYPE_CHECK_CLASS_TYPE((klass), TRANSLATE_TYPE_SERVICE)) #define TRANSLATE_SERVICE_GET_CLASS(obj) (G_TYPE_INSTANCE_GET_CLASS((obj), TRANSLATE_TYPE_SERVICE, TranslateServiceClass)) typedef struct _TranslateService TranslateService; typedef struct _TranslateServiceClass TranslateServiceClass; typedef struct _TranslateServicePrivate TranslateServicePrivate; struct _TranslateService { GObject parent; TranslateServicePrivate *priv; }; struct _TranslateServiceClass { GObjectClass parent; /*< public >*/ gboolean (*get_pairs) (TranslateService *service, GSList **pairs, TranslateProgressFunc progress_func, gpointer user_data, GError **err); char *(*translate_text) (TranslateService *service, const char *text, const char *from, const char *to, TranslateProgressFunc progress_func, gpointer user_data, GError **err); char *(*translate_web_page) (TranslateService *service, const char *url, const char *from, const char *to, TranslateProgressFunc progress_func, gpointer user_data, GError **err); /*< private >*/ void (*reserved1) (void); void (*reserved2) (void); void (*reserved3) (void); void (*reserved4) (void); void (*reserved5) (void); void (*reserved6) (void); void (*reserved7) (void); void (*reserved8) (void); }; GType translate_service_get_type (void); const char *translate_service_get_name (TranslateService *service); const char *translate_service_get_nick (TranslateService *service); unsigned int translate_service_get_max_chunk_len (TranslateService *service); const GSList *translate_service_get_pairs (TranslateService *service); G_END_DECLS #endif /* _TRANSLATE_SERVICE_H */ libtranslate-0.99/src/translate-session.h000644 001750 001750 00000010427 10172765664 022335 0ustar00jylefortjylefort000000 000000 /* * Copyright (C) 2004, 2005 Jean-Yves Lefort * All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in the * documentation and/or other materials provided with the distribution. * 3. Neither the name of Jean-Yves Lefort nor the names of its contributors * may be used to endorse or promote products derived from this software * without specific prior written permission. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND * CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, * INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF * MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE * DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS * BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, * EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED * TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON * ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, * OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY * OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE * POSSIBILITY OF SUCH DAMAGE. */ #ifndef _TRANSLATE_SESSION_H #define _TRANSLATE_SESSION_H #include #include G_BEGIN_DECLS #define TRANSLATE_TYPE_SESSION (translate_session_get_type()) #define TRANSLATE_SESSION(obj) (G_TYPE_CHECK_INSTANCE_CAST((obj), TRANSLATE_TYPE_SESSION, TranslateSession)) #define TRANSLATE_SESSION_CLASS(klass) (G_TYPE_CHECK_CLASS_CAST((klass), TRANSLATE_TYPE_SESSION, TranslateSessionClass)) #define TRANSLATE_IS_SESSION(obj) (G_TYPE_CHECK_INSTANCE_TYPE((obj), TRANSLATE_TYPE_SESSION)) #define TRANSLATE_IS_SESSION_CLASS(klass) (G_TYPE_CHECK_CLASS_TYPE((klass), TRANSLATE_TYPE_SESSION)) #define TRANSLATE_SESSION_GET_CLASS(obj) (G_TYPE_INSTANCE_GET_CLASS((obj), TRANSLATE_TYPE_SESSION, TranslateSessionClass)) #define TRANSLATE_SESSION_ERROR (translate_session_error_quark()) typedef struct _TranslateSession TranslateSession; typedef struct _TranslateSessionClass TranslateSessionClass; typedef struct _TranslateSessionPrivate TranslateSessionPrivate; struct _TranslateSession { GObject parent; TranslateSessionPrivate *priv; }; struct _TranslateSessionClass { GObjectClass parent; void (*reserved1) (void); void (*reserved2) (void); void (*reserved3) (void); void (*reserved4) (void); void (*reserved5) (void); void (*reserved6) (void); void (*reserved7) (void); void (*reserved8) (void); }; typedef enum { TRANSLATE_SESSION_ERROR_NO_SERVICE } TranslateSessionError; GType translate_session_get_type (void); GQuark translate_session_error_quark (void); TranslateSession *translate_session_new (const GSList *services); void translate_session_set_services (TranslateSession *session, const GSList *services); void translate_session_set_max_threads (TranslateSession *session, unsigned int max_threads); void translate_session_set_max_retries (TranslateSession *session, unsigned int max_retries); GSList *translate_session_get_services (TranslateSession *session); GSList *translate_session_get_pairs (TranslateSession *session); unsigned int translate_session_get_max_threads (TranslateSession *session); int translate_session_get_max_retries (TranslateSession *session); char *translate_session_translate_text (TranslateSession *session, const char *text, const char *from, const char *to, TranslateProgressFunc progress_func, gpointer user_data, GError **err); char *translate_session_translate_web_page (TranslateSession *session, const char *url, const char *from, const char *to, TranslateProgressFunc progress_func, gpointer user_data, GError **err); G_END_DECLS #endif /* _TRANSLATE_SESSION_H */ libtranslate-0.99/src/translate-util.h000644 001750 001750 00000005147 10172765676 021635 0ustar00jylefortjylefort000000 000000 /* * Copyright (C) 2004, 2005 Jean-Yves Lefort * All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in the * documentation and/or other materials provided with the distribution. * 3. Neither the name of Jean-Yves Lefort nor the names of its contributors * may be used to endorse or promote products derived from this software * without specific prior written permission. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND * CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, * INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF * MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE * DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS * BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, * EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED * TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON * ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, * OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY * OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE * POSSIBILITY OF SUCH DAMAGE. */ #ifndef _TRANSLATE_UTIL_H #define _TRANSLATE_UTIL_H #include #include G_BEGIN_DECLS gboolean translate_ascii_strcase_equal (gconstpointer s1, gconstpointer s2); unsigned int translate_ascii_strcase_hash (gconstpointer key); char *translate_ascii_strcasestr (const char *big, const char *little); char *translate_ascii_strcasestr_len (const char *big, unsigned int big_len, const char *little); int translate_ascii_strcasecoll (const char *s1, const char *s2); int translate_utf8_strcasecoll (const char *s1, const char *s2); int translate_utf8_strcmp (const char *s1, const char *s2); int translate_utf8_strcasecmp (const char *s1, const char *s2); char *translate_utf8_strpbrk (const char *p, gssize len, const char *charset); char *translate_utf8_strrpbrk (const char *p, gssize len, const char *charset); time_t translate_time (void); char *translate_sgml_ref_expand (const char *str); G_END_DECLS #endif /* _TRANSLATE_UTIL_H */ libtranslate-0.99/src/translate.h000644 001750 001750 00000006640 10172765707 020654 0ustar00jylefortjylefort000000 000000 /* * Copyright (C) 2004, 2005 Jean-Yves Lefort * All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in the * documentation and/or other materials provided with the distribution. * 3. Neither the name of Jean-Yves Lefort nor the names of its contributors * may be used to endorse or promote products derived from this software * without specific prior written permission. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND * CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, * INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF * MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE * DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS * BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, * EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED * TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON * ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, * OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY * OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE * POSSIBILITY OF SUCH DAMAGE. */ #ifndef _TRANSLATE_H #define _TRANSLATE_H #include #include #include #include #include G_BEGIN_DECLS #define TRANSLATE_MAJOR_VERSION 0 #define TRANSLATE_MINOR_VERSION 99 #define TRANSLATE_MICRO_VERSION 0 extern const unsigned int translate_major_version; extern const unsigned int translate_minor_version; extern const unsigned int translate_micro_version; #define TRANSLATE_ERROR (translate_error_quark()) #define TRANSLATE_INIT_ERROR (translate_init_error_quark()) typedef enum { TRANSLATE_ERROR_FAILED, TRANSLATE_ERROR_CANCELLED } TranslateError; typedef enum { TRANSLATE_INIT_ERROR_MULTI_THREADING_NOT_SUPPORTED } TranslateInitError; GQuark translate_error_quark (void); GQuark translate_init_error_quark (void); /** * TranslateModuleInitFunc: * @err: a location to report errors, or %NULL. * * Specifies the type of the module initialization function. * * A libtranslate module must contain a function named * translate_module_init(), which is called when the module is loaded. * * Return value: the function should return %FALSE if the module could * not be initialized. In such case it should also set @err, which is * printed by libtranslate. **/ typedef gboolean (*TranslateModuleInitFunc) (GError **err); extern gboolean translate_initialized; gboolean translate_init (GError **err); gboolean translate_add_service (TranslateService *service); TranslateService *translate_get_service (const char *name); GSList *translate_get_services (void); gboolean translate_add_language (const char *tag, const char *name); const char *translate_get_language_name (const char *tag); void translate_set_proxy (const char *uri); char *translate_get_proxy (void); G_END_DECLS #endif /* _TRANSLATE_H */ libtranslate-0.99/src/Makefile.am000644 001750 001750 00000004551 10172244303 020521 0ustar00jylefortjylefort000000 000000 include $(top_srcdir)/common.make SUBDIRS = modules public_headers = \ translate-common.h \ translate-pair.h \ translate-service.h \ translate-session.h \ translate-util.h \ translate.h BUILT_SOURCES = \ translate-rfc3066-private.h \ translate-sgml-entities-private.h lib_LTLIBRARIES = libtranslate.la libtranslate_la_SOURCES = \ $(public_headers) \ $(BUILT_SOURCES) \ translate-pair-private.h \ translate-pair.c \ translate-service-private.h \ translate-service.c \ translate-session.c \ translate-util.c \ translate.c # Before making a release, the version info (which is in the form # CURRENT:REVISION:AGE) should be modified as follows: # # If interfaces have been added, but binary compatibility has been # preserved, increment CURRENT and AGE, and set REVISION to 0. # # If binary compatibility has been broken, increment CURRENT, and set # REVISION and AGE to 0. # # If the interfaces are the same as the previous version, increment # REVISION. libtranslate_la_LDFLAGS = -version-info 0:0:0 \ $(GLIB_LIBS) $(GMODULE_LIBS) $(GTHREAD_LIBS) libtranslate_la_CPPFLAGS = $(WARN_CFLAGS) $(GLIB_CFLAGS) $(GMODULE_CFLAGS) $(GTHREAD_CFLAGS) \ -DG_LOG_DOMAIN="\"$(PACKAGE)\"" \ -DMODULESDIR="\"$(modulesdir)\"" pkginclude_HEADERS = $(public_headers) bin_PROGRAMS = translate translate_SOURCES = translate-cli.c translate_LDADD = libtranslate.la translate_CPPFLAGS = $(WARN_CFLAGS) $(GLIB_CFLAGS) \ -DG_LOG_DOMAIN="\"translate\"" entity_sets = \ xhtml-lat1.ent \ xhtml-special.ent \ xhtml-symbol.ent EXTRA_DIST = \ $(entity_sets) \ ent2h.sh \ lang2h.sh \ sample-text.input \ sample-text.expected \ test-translate.sh MAINTAINERCLEANFILES = $(BUILT_SOURCES) translate-sgml-entities-private.h: ent2h.sh $(entity_sets) ./ent2h.sh $(entity_sets) > $@ translate-rfc3066-private.h: $(top_srcdir)/data/iso639-2 $(top_srcdir)/data/rfc3066.sh lang2h.sh $(top_srcdir)/data/rfc3066.sh < $(top_srcdir)/data/iso639-2 | ./lang2h.sh > $@ if WITH_REGRESSION_TESTS tests = test-util.stamp noinst_PROGRAMS = test-util noinst_DATA = $(tests) test_util_SOURCES = test-util.c test_util_LDADD = libtranslate.la test_util_CPPFLAGS = $(WARN_CFLAGS) $(GLIB_CFLAGS) test-util.stamp: test-util ./test-util @touch test-util.stamp MOSTLYCLEANFILES = $(tests) endif # the translate test is slow, so we only run it on demand (make check) TESTS = test-translate.sh libtranslate-0.99/src/Makefile.in000644 001750 001750 00000114740 10176430641 020542 0ustar00jylefortjylefort000000 000000 # Makefile.in generated by automake 1.9.2 from Makefile.am. # @configure_input@ # Copyright (C) 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001, 2002, # 2003, 2004 Free Software Foundation, Inc. # This Makefile.in is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY, to the extent permitted by law; without # even the implied warranty of MERCHANTABILITY or FITNESS FOR A # PARTICULAR PURPOSE. @SET_MAKE@ SOURCES = $(libtranslate_la_SOURCES) $(test_util_SOURCES) $(translate_SOURCES) srcdir = @srcdir@ top_srcdir = @top_srcdir@ VPATH = @srcdir@ pkgdatadir = $(datadir)/@PACKAGE@ pkglibdir = $(libdir)/@PACKAGE@ pkgincludedir = $(includedir)/@PACKAGE@ top_builddir = .. am__cd = CDPATH="$${ZSH_VERSION+.}$(PATH_SEPARATOR)" && cd INSTALL = @INSTALL@ install_sh_DATA = $(install_sh) -c -m 644 install_sh_PROGRAM = $(install_sh) -c install_sh_SCRIPT = $(install_sh) -c INSTALL_HEADER = $(INSTALL_DATA) transform = $(program_transform_name) NORMAL_INSTALL = : PRE_INSTALL = : POST_INSTALL = : NORMAL_UNINSTALL = : PRE_UNINSTALL = : POST_UNINSTALL = : build_triplet = @build@ host_triplet = @host@ DIST_COMMON = $(pkginclude_HEADERS) $(srcdir)/Makefile.am \ $(srcdir)/Makefile.in $(top_srcdir)/common.make bin_PROGRAMS = translate$(EXEEXT) @WITH_REGRESSION_TESTS_TRUE@noinst_PROGRAMS = test-util$(EXEEXT) subdir = src ACLOCAL_M4 = $(top_srcdir)/aclocal.m4 am__aclocal_m4_deps = $(top_srcdir)/m4/talkfilters.m4 \ $(top_srcdir)/acinclude.m4 $(top_srcdir)/configure.ac am__configure_deps = $(am__aclocal_m4_deps) $(CONFIGURE_DEPENDENCIES) \ $(ACLOCAL_M4) mkinstalldirs = $(SHELL) $(top_srcdir)/mkinstalldirs CONFIG_HEADER = $(top_builddir)/config.h CONFIG_CLEAN_FILES = am__vpath_adj_setup = srcdirstrip=`echo "$(srcdir)" | sed 's|.|.|g'`; am__vpath_adj = case $$p in \ $(srcdir)/*) f=`echo "$$p" | sed "s|^$$srcdirstrip/||"`;; \ *) f=$$p;; \ esac; am__strip_dir = `echo $$p | sed -e 's|^.*/||'`; am__installdirs = "$(DESTDIR)$(libdir)" "$(DESTDIR)$(bindir)" \ "$(DESTDIR)$(pkgincludedir)" libLTLIBRARIES_INSTALL = $(INSTALL) LTLIBRARIES = $(lib_LTLIBRARIES) libtranslate_la_LIBADD = am__objects_1 = am_libtranslate_la_OBJECTS = $(am__objects_1) $(am__objects_1) \ libtranslate_la-translate-pair.lo \ libtranslate_la-translate-service.lo \ libtranslate_la-translate-session.lo \ libtranslate_la-translate-util.lo libtranslate_la-translate.lo libtranslate_la_OBJECTS = $(am_libtranslate_la_OBJECTS) binPROGRAMS_INSTALL = $(INSTALL_PROGRAM) PROGRAMS = $(bin_PROGRAMS) $(noinst_PROGRAMS) am__test_util_SOURCES_DIST = test-util.c @WITH_REGRESSION_TESTS_TRUE@am_test_util_OBJECTS = \ @WITH_REGRESSION_TESTS_TRUE@ test_util-test-util.$(OBJEXT) test_util_OBJECTS = $(am_test_util_OBJECTS) @WITH_REGRESSION_TESTS_TRUE@test_util_DEPENDENCIES = libtranslate.la am_translate_OBJECTS = translate-translate-cli.$(OBJEXT) translate_OBJECTS = $(am_translate_OBJECTS) translate_DEPENDENCIES = libtranslate.la DEFAULT_INCLUDES = -I. -I$(srcdir) -I$(top_builddir) depcomp = $(SHELL) $(top_srcdir)/depcomp am__depfiles_maybe = depfiles COMPILE = $(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(AM_CPPFLAGS) \ $(CPPFLAGS) $(AM_CFLAGS) $(CFLAGS) LTCOMPILE = $(LIBTOOL) --mode=compile --tag=CC $(CC) $(DEFS) \ $(DEFAULT_INCLUDES) $(INCLUDES) $(AM_CPPFLAGS) $(CPPFLAGS) \ $(AM_CFLAGS) $(CFLAGS) CCLD = $(CC) LINK = $(LIBTOOL) --mode=link --tag=CC $(CCLD) $(AM_CFLAGS) $(CFLAGS) \ $(AM_LDFLAGS) $(LDFLAGS) -o $@ SOURCES = $(libtranslate_la_SOURCES) $(test_util_SOURCES) \ $(translate_SOURCES) DIST_SOURCES = $(libtranslate_la_SOURCES) \ $(am__test_util_SOURCES_DIST) $(translate_SOURCES) RECURSIVE_TARGETS = all-recursive check-recursive dvi-recursive \ html-recursive info-recursive install-data-recursive \ install-exec-recursive install-info-recursive \ install-recursive installcheck-recursive installdirs-recursive \ pdf-recursive ps-recursive uninstall-info-recursive \ uninstall-recursive DATA = $(noinst_DATA) pkgincludeHEADERS_INSTALL = $(INSTALL_HEADER) HEADERS = $(pkginclude_HEADERS) ETAGS = etags CTAGS = ctags DIST_SUBDIRS = $(SUBDIRS) DISTFILES = $(DIST_COMMON) $(DIST_SOURCES) $(TEXINFOS) $(EXTRA_DIST) ACLOCAL = @ACLOCAL@ AMDEP_FALSE = @AMDEP_FALSE@ AMDEP_TRUE = @AMDEP_TRUE@ AMTAR = @AMTAR@ AR = @AR@ AUTOCONF = @AUTOCONF@ AUTOHEADER = @AUTOHEADER@ AUTOMAKE = @AUTOMAKE@ AWK = @AWK@ CATALOGS = @CATALOGS@ CATOBJEXT = @CATOBJEXT@ CC = @CC@ CCDEPMODE = @CCDEPMODE@ CFLAGS = @CFLAGS@ CPP = @CPP@ CPPFLAGS = @CPPFLAGS@ CXX = @CXX@ CXXCPP = @CXXCPP@ CXXDEPMODE = @CXXDEPMODE@ CXXFLAGS = @CXXFLAGS@ CYGPATH_W = @CYGPATH_W@ DATADIRNAME = @DATADIRNAME@ DEFS = @DEFS@ DEPDIR = @DEPDIR@ ECHO = @ECHO@ ECHO_C = @ECHO_C@ ECHO_N = @ECHO_N@ ECHO_T = @ECHO_T@ EGREP = @EGREP@ ENABLE_GTK_DOC_FALSE = @ENABLE_GTK_DOC_FALSE@ ENABLE_GTK_DOC_TRUE = @ENABLE_GTK_DOC_TRUE@ EXEEXT = @EXEEXT@ F77 = @F77@ FFLAGS = @FFLAGS@ GETTEXT_PACKAGE = @GETTEXT_PACKAGE@ GLIB_CFLAGS = @GLIB_CFLAGS@ GLIB_LIBS = @GLIB_LIBS@ GMOFILES = @GMOFILES@ GMSGFMT = @GMSGFMT@ GTK_DOC_USE_LIBTOOL_FALSE = @GTK_DOC_USE_LIBTOOL_FALSE@ GTK_DOC_USE_LIBTOOL_TRUE = @GTK_DOC_USE_LIBTOOL_TRUE@ HTML_DIR = @HTML_DIR@ ICONV = @ICONV@ INSTALL_DATA = @INSTALL_DATA@ INSTALL_PROGRAM = @INSTALL_PROGRAM@ INSTALL_SCRIPT = @INSTALL_SCRIPT@ INSTALL_STRIP_PROGRAM = @INSTALL_STRIP_PROGRAM@ INSTOBJEXT = @INSTOBJEXT@ INTLLIBS = @INTLLIBS@ INTLTOOL_CAVES_RULE = @INTLTOOL_CAVES_RULE@ INTLTOOL_DESKTOP_RULE = @INTLTOOL_DESKTOP_RULE@ INTLTOOL_DIRECTORY_RULE = @INTLTOOL_DIRECTORY_RULE@ INTLTOOL_EXTRACT = @INTLTOOL_EXTRACT@ INTLTOOL_KBD_RULE = @INTLTOOL_KBD_RULE@ INTLTOOL_KEYS_RULE = @INTLTOOL_KEYS_RULE@ INTLTOOL_MERGE = @INTLTOOL_MERGE@ INTLTOOL_OAF_RULE = @INTLTOOL_OAF_RULE@ INTLTOOL_PERL = @INTLTOOL_PERL@ INTLTOOL_PONG_RULE = @INTLTOOL_PONG_RULE@ INTLTOOL_PROP_RULE = @INTLTOOL_PROP_RULE@ INTLTOOL_SCHEMAS_RULE = @INTLTOOL_SCHEMAS_RULE@ INTLTOOL_SERVER_RULE = @INTLTOOL_SERVER_RULE@ INTLTOOL_SHEET_RULE = @INTLTOOL_SHEET_RULE@ INTLTOOL_SOUNDLIST_RULE = @INTLTOOL_SOUNDLIST_RULE@ INTLTOOL_THEME_RULE = @INTLTOOL_THEME_RULE@ INTLTOOL_UI_RULE = @INTLTOOL_UI_RULE@ INTLTOOL_UPDATE = @INTLTOOL_UPDATE@ INTLTOOL_XAM_RULE = @INTLTOOL_XAM_RULE@ INTLTOOL_XML_NOMERGE_RULE = @INTLTOOL_XML_NOMERGE_RULE@ INTLTOOL_XML_RULE = @INTLTOOL_XML_RULE@ LDFLAGS = @LDFLAGS@ LIBOBJS = @LIBOBJS@ LIBS = @LIBS@ LIBTOOL = @LIBTOOL@ LIBXML_CFLAGS = @LIBXML_CFLAGS@ LIBXML_LIBS = @LIBXML_LIBS@ LN_S = @LN_S@ LTLIBOBJS = @LTLIBOBJS@ MAINT = @MAINT@ MAINTAINER_MODE_FALSE = @MAINTAINER_MODE_FALSE@ MAINTAINER_MODE_TRUE = @MAINTAINER_MODE_TRUE@ MAKEINFO = @MAKEINFO@ MKINSTALLDIRS = @MKINSTALLDIRS@ MSGFMT = @MSGFMT@ MSGMERGE = @MSGMERGE@ OBJEXT = @OBJEXT@ PACKAGE = @PACKAGE@ PACKAGE_BUGREPORT = @PACKAGE_BUGREPORT@ PACKAGE_NAME = @PACKAGE_NAME@ PACKAGE_STRING = @PACKAGE_STRING@ PACKAGE_TARNAME = @PACKAGE_TARNAME@ PACKAGE_VERSION = @PACKAGE_VERSION@ PATH_SEPARATOR = @PATH_SEPARATOR@ PKG_CONFIG = @PKG_CONFIG@ POFILES = @POFILES@ POSUB = @POSUB@ PO_IN_DATADIR_FALSE = @PO_IN_DATADIR_FALSE@ PO_IN_DATADIR_TRUE = @PO_IN_DATADIR_TRUE@ RANLIB = @RANLIB@ SET_MAKE = @SET_MAKE@ SHELL = @SHELL@ SOUP_CFLAGS = @SOUP_CFLAGS@ SOUP_LIBS = @SOUP_LIBS@ STRIP = @STRIP@ TALKFILTERS_CFLAGS = @TALKFILTERS_CFLAGS@ TALKFILTERS_LIBS = @TALKFILTERS_LIBS@ USE_NLS = @USE_NLS@ VERSION = @VERSION@ WARN_CFLAGS = @WARN_CFLAGS@ WITH_GENERIC_FALSE = @WITH_GENERIC_FALSE@ WITH_GENERIC_TRUE = @WITH_GENERIC_TRUE@ WITH_REGRESSION_TESTS_FALSE = @WITH_REGRESSION_TESTS_FALSE@ WITH_REGRESSION_TESTS_TRUE = @WITH_REGRESSION_TESTS_TRUE@ WITH_TALKFILTERS_FALSE = @WITH_TALKFILTERS_FALSE@ WITH_TALKFILTERS_TRUE = @WITH_TALKFILTERS_TRUE@ XGETTEXT = @XGETTEXT@ ac_ct_AR = @ac_ct_AR@ ac_ct_CC = @ac_ct_CC@ ac_ct_CXX = @ac_ct_CXX@ ac_ct_F77 = @ac_ct_F77@ ac_ct_RANLIB = @ac_ct_RANLIB@ ac_ct_STRIP = @ac_ct_STRIP@ am__fastdepCC_FALSE = @am__fastdepCC_FALSE@ am__fastdepCC_TRUE = @am__fastdepCC_TRUE@ am__fastdepCXX_FALSE = @am__fastdepCXX_FALSE@ am__fastdepCXX_TRUE = @am__fastdepCXX_TRUE@ am__include = @am__include@ am__leading_dot = @am__leading_dot@ am__quote = @am__quote@ am__tar = @am__tar@ am__untar = @am__untar@ bindir = @bindir@ build = @build@ build_alias = @build_alias@ build_cpu = @build_cpu@ build_os = @build_os@ build_vendor = @build_vendor@ datadir = @datadir@ exec_prefix = @exec_prefix@ host = @host@ host_alias = @host_alias@ host_cpu = @host_cpu@ host_os = @host_os@ host_vendor = @host_vendor@ includedir = @includedir@ infodir = @infodir@ install_sh = @install_sh@ libdir = @libdir@ libexecdir = @libexecdir@ localstatedir = @localstatedir@ mandir = @mandir@ mkdir_p = @mkdir_p@ oldincludedir = @oldincludedir@ prefix = @prefix@ program_transform_name = @program_transform_name@ sbindir = @sbindir@ sharedstatedir = @sharedstatedir@ sysconfdir = @sysconfdir@ target_alias = @target_alias@ modulesdir = $(pkglibdir)/modules TRANSLATE_CFLAGS = $(GLIB_CFLAGS) -I$(top_srcdir)/src SUBDIRS = modules public_headers = \ translate-common.h \ translate-pair.h \ translate-service.h \ translate-session.h \ translate-util.h \ translate.h BUILT_SOURCES = \ translate-rfc3066-private.h \ translate-sgml-entities-private.h lib_LTLIBRARIES = libtranslate.la libtranslate_la_SOURCES = \ $(public_headers) \ $(BUILT_SOURCES) \ translate-pair-private.h \ translate-pair.c \ translate-service-private.h \ translate-service.c \ translate-session.c \ translate-util.c \ translate.c # Before making a release, the version info (which is in the form # CURRENT:REVISION:AGE) should be modified as follows: # # If interfaces have been added, but binary compatibility has been # preserved, increment CURRENT and AGE, and set REVISION to 0. # # If binary compatibility has been broken, increment CURRENT, and set # REVISION and AGE to 0. # # If the interfaces are the same as the previous version, increment # REVISION. libtranslate_la_LDFLAGS = -version-info 0:0:0 \ $(GLIB_LIBS) $(GMODULE_LIBS) $(GTHREAD_LIBS) libtranslate_la_CPPFLAGS = $(WARN_CFLAGS) $(GLIB_CFLAGS) $(GMODULE_CFLAGS) $(GTHREAD_CFLAGS) \ -DG_LOG_DOMAIN="\"$(PACKAGE)\"" \ -DMODULESDIR="\"$(modulesdir)\"" pkginclude_HEADERS = $(public_headers) translate_SOURCES = translate-cli.c translate_LDADD = libtranslate.la translate_CPPFLAGS = $(WARN_CFLAGS) $(GLIB_CFLAGS) \ -DG_LOG_DOMAIN="\"translate\"" entity_sets = \ xhtml-lat1.ent \ xhtml-special.ent \ xhtml-symbol.ent EXTRA_DIST = \ $(entity_sets) \ ent2h.sh \ lang2h.sh \ sample-text.input \ sample-text.expected \ test-translate.sh MAINTAINERCLEANFILES = $(BUILT_SOURCES) @WITH_REGRESSION_TESTS_TRUE@tests = test-util.stamp @WITH_REGRESSION_TESTS_TRUE@noinst_DATA = $(tests) @WITH_REGRESSION_TESTS_TRUE@test_util_SOURCES = test-util.c @WITH_REGRESSION_TESTS_TRUE@test_util_LDADD = libtranslate.la @WITH_REGRESSION_TESTS_TRUE@test_util_CPPFLAGS = $(WARN_CFLAGS) $(GLIB_CFLAGS) @WITH_REGRESSION_TESTS_TRUE@MOSTLYCLEANFILES = $(tests) # the translate test is slow, so we only run it on demand (make check) TESTS = test-translate.sh all: $(BUILT_SOURCES) $(MAKE) $(AM_MAKEFLAGS) all-recursive .SUFFIXES: .SUFFIXES: .c .lo .o .obj $(srcdir)/Makefile.in: @MAINTAINER_MODE_TRUE@ $(srcdir)/Makefile.am $(top_srcdir)/common.make $(am__configure_deps) @for dep in $?; do \ case '$(am__configure_deps)' in \ *$$dep*) \ cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh \ && exit 0; \ exit 1;; \ esac; \ done; \ echo ' cd $(top_srcdir) && $(AUTOMAKE) --foreign src/Makefile'; \ cd $(top_srcdir) && \ $(AUTOMAKE) --foreign src/Makefile .PRECIOUS: Makefile Makefile: $(srcdir)/Makefile.in $(top_builddir)/config.status @case '$?' in \ *config.status*) \ cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh;; \ *) \ echo ' cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe)'; \ cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe);; \ esac; $(top_builddir)/config.status: $(top_srcdir)/configure $(CONFIG_STATUS_DEPENDENCIES) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh $(top_srcdir)/configure: @MAINTAINER_MODE_TRUE@ $(am__configure_deps) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh $(ACLOCAL_M4): @MAINTAINER_MODE_TRUE@ $(am__aclocal_m4_deps) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh install-libLTLIBRARIES: $(lib_LTLIBRARIES) @$(NORMAL_INSTALL) test -z "$(libdir)" || $(mkdir_p) "$(DESTDIR)$(libdir)" @list='$(lib_LTLIBRARIES)'; for p in $$list; do \ if test -f $$p; then \ f=$(am__strip_dir) \ echo " $(LIBTOOL) --mode=install $(libLTLIBRARIES_INSTALL) $(INSTALL_STRIP_FLAG) '$$p' '$(DESTDIR)$(libdir)/$$f'"; \ $(LIBTOOL) --mode=install $(libLTLIBRARIES_INSTALL) $(INSTALL_STRIP_FLAG) "$$p" "$(DESTDIR)$(libdir)/$$f"; \ else :; fi; \ done uninstall-libLTLIBRARIES: @$(NORMAL_UNINSTALL) @set -x; list='$(lib_LTLIBRARIES)'; for p in $$list; do \ p=$(am__strip_dir) \ echo " $(LIBTOOL) --mode=uninstall rm -f '$(DESTDIR)$(libdir)/$$p'"; \ $(LIBTOOL) --mode=uninstall rm -f "$(DESTDIR)$(libdir)/$$p"; \ done clean-libLTLIBRARIES: -test -z "$(lib_LTLIBRARIES)" || rm -f $(lib_LTLIBRARIES) @list='$(lib_LTLIBRARIES)'; for p in $$list; do \ dir="`echo $$p | sed -e 's|/[^/]*$$||'`"; \ test "$$dir" != "$$p" || dir=.; \ echo "rm -f \"$${dir}/so_locations\""; \ rm -f "$${dir}/so_locations"; \ done libtranslate.la: $(libtranslate_la_OBJECTS) $(libtranslate_la_DEPENDENCIES) $(LINK) -rpath $(libdir) $(libtranslate_la_LDFLAGS) $(libtranslate_la_OBJECTS) $(libtranslate_la_LIBADD) $(LIBS) install-binPROGRAMS: $(bin_PROGRAMS) @$(NORMAL_INSTALL) test -z "$(bindir)" || $(mkdir_p) "$(DESTDIR)$(bindir)" @list='$(bin_PROGRAMS)'; for p in $$list; do \ p1=`echo $$p|sed 's/$(EXEEXT)$$//'`; \ if test -f $$p \ || test -f $$p1 \ ; then \ f=`echo "$$p1" | sed 's,^.*/,,;$(transform);s/$$/$(EXEEXT)/'`; \ echo " $(INSTALL_PROGRAM_ENV) $(LIBTOOL) --mode=install $(binPROGRAMS_INSTALL) '$$p' '$(DESTDIR)$(bindir)/$$f'"; \ $(INSTALL_PROGRAM_ENV) $(LIBTOOL) --mode=install $(binPROGRAMS_INSTALL) "$$p" "$(DESTDIR)$(bindir)/$$f" || exit 1; \ else :; fi; \ done uninstall-binPROGRAMS: @$(NORMAL_UNINSTALL) @list='$(bin_PROGRAMS)'; for p in $$list; do \ f=`echo "$$p" | sed 's,^.*/,,;s/$(EXEEXT)$$//;$(transform);s/$$/$(EXEEXT)/'`; \ echo " rm -f '$(DESTDIR)$(bindir)/$$f'"; \ rm -f "$(DESTDIR)$(bindir)/$$f"; \ done clean-binPROGRAMS: @list='$(bin_PROGRAMS)'; for p in $$list; do \ f=`echo $$p|sed 's/$(EXEEXT)$$//'`; \ echo " rm -f $$p $$f"; \ rm -f $$p $$f ; \ done clean-noinstPROGRAMS: @list='$(noinst_PROGRAMS)'; for p in $$list; do \ f=`echo $$p|sed 's/$(EXEEXT)$$//'`; \ echo " rm -f $$p $$f"; \ rm -f $$p $$f ; \ done test-util$(EXEEXT): $(test_util_OBJECTS) $(test_util_DEPENDENCIES) @rm -f test-util$(EXEEXT) $(LINK) $(test_util_LDFLAGS) $(test_util_OBJECTS) $(test_util_LDADD) $(LIBS) translate$(EXEEXT): $(translate_OBJECTS) $(translate_DEPENDENCIES) @rm -f translate$(EXEEXT) $(LINK) $(translate_LDFLAGS) $(translate_OBJECTS) $(translate_LDADD) $(LIBS) mostlyclean-compile: -rm -f *.$(OBJEXT) distclean-compile: -rm -f *.tab.c @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/libtranslate_la-translate-pair.Plo@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/libtranslate_la-translate-service.Plo@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/libtranslate_la-translate-session.Plo@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/libtranslate_la-translate-util.Plo@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/libtranslate_la-translate.Plo@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/test_util-test-util.Po@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/translate-translate-cli.Po@am__quote@ .c.o: @am__fastdepCC_TRUE@ if $(COMPILE) -MT $@ -MD -MP -MF "$(DEPDIR)/$*.Tpo" -c -o $@ $<; \ @am__fastdepCC_TRUE@ then mv -f "$(DEPDIR)/$*.Tpo" "$(DEPDIR)/$*.Po"; else rm -f "$(DEPDIR)/$*.Tpo"; exit 1; fi @AMDEP_TRUE@@am__fastdepCC_FALSE@ source='$<' object='$@' libtool=no @AMDEPBACKSLASH@ @AMDEP_TRUE@@am__fastdepCC_FALSE@ DEPDIR=$(DEPDIR) $(CCDEPMODE) $(depcomp) @AMDEPBACKSLASH@ @am__fastdepCC_FALSE@ $(COMPILE) -c $< .c.obj: @am__fastdepCC_TRUE@ if $(COMPILE) -MT $@ -MD -MP -MF "$(DEPDIR)/$*.Tpo" -c -o $@ `$(CYGPATH_W) '$<'`; \ @am__fastdepCC_TRUE@ then mv -f "$(DEPDIR)/$*.Tpo" "$(DEPDIR)/$*.Po"; else rm -f "$(DEPDIR)/$*.Tpo"; exit 1; fi @AMDEP_TRUE@@am__fastdepCC_FALSE@ source='$<' object='$@' libtool=no @AMDEPBACKSLASH@ @AMDEP_TRUE@@am__fastdepCC_FALSE@ DEPDIR=$(DEPDIR) $(CCDEPMODE) $(depcomp) @AMDEPBACKSLASH@ @am__fastdepCC_FALSE@ $(COMPILE) -c `$(CYGPATH_W) '$<'` .c.lo: @am__fastdepCC_TRUE@ if $(LTCOMPILE) -MT $@ -MD -MP -MF "$(DEPDIR)/$*.Tpo" -c -o $@ $<; \ @am__fastdepCC_TRUE@ then mv -f "$(DEPDIR)/$*.Tpo" "$(DEPDIR)/$*.Plo"; else rm -f "$(DEPDIR)/$*.Tpo"; exit 1; fi @AMDEP_TRUE@@am__fastdepCC_FALSE@ source='$<' object='$@' libtool=yes @AMDEPBACKSLASH@ @AMDEP_TRUE@@am__fastdepCC_FALSE@ DEPDIR=$(DEPDIR) $(CCDEPMODE) $(depcomp) @AMDEPBACKSLASH@ @am__fastdepCC_FALSE@ $(LTCOMPILE) -c -o $@ $< libtranslate_la-translate-pair.lo: translate-pair.c @am__fastdepCC_TRUE@ if $(LIBTOOL) --mode=compile --tag=CC $(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(libtranslate_la_CPPFLAGS) $(CPPFLAGS) $(AM_CFLAGS) $(CFLAGS) -MT libtranslate_la-translate-pair.lo -MD -MP -MF "$(DEPDIR)/libtranslate_la-translate-pair.Tpo" -c -o libtranslate_la-translate-pair.lo `test -f 'translate-pair.c' || echo '$(srcdir)/'`translate-pair.c; \ @am__fastdepCC_TRUE@ then mv -f "$(DEPDIR)/libtranslate_la-translate-pair.Tpo" "$(DEPDIR)/libtranslate_la-translate-pair.Plo"; else rm -f "$(DEPDIR)/libtranslate_la-translate-pair.Tpo"; exit 1; fi @AMDEP_TRUE@@am__fastdepCC_FALSE@ source='translate-pair.c' object='libtranslate_la-translate-pair.lo' libtool=yes @AMDEPBACKSLASH@ @AMDEP_TRUE@@am__fastdepCC_FALSE@ DEPDIR=$(DEPDIR) $(CCDEPMODE) $(depcomp) @AMDEPBACKSLASH@ @am__fastdepCC_FALSE@ $(LIBTOOL) --mode=compile --tag=CC $(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(libtranslate_la_CPPFLAGS) $(CPPFLAGS) $(AM_CFLAGS) $(CFLAGS) -c -o libtranslate_la-translate-pair.lo `test -f 'translate-pair.c' || echo '$(srcdir)/'`translate-pair.c libtranslate_la-translate-service.lo: translate-service.c @am__fastdepCC_TRUE@ if $(LIBTOOL) --mode=compile --tag=CC $(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(libtranslate_la_CPPFLAGS) $(CPPFLAGS) $(AM_CFLAGS) $(CFLAGS) -MT libtranslate_la-translate-service.lo -MD -MP -MF "$(DEPDIR)/libtranslate_la-translate-service.Tpo" -c -o libtranslate_la-translate-service.lo `test -f 'translate-service.c' || echo '$(srcdir)/'`translate-service.c; \ @am__fastdepCC_TRUE@ then mv -f "$(DEPDIR)/libtranslate_la-translate-service.Tpo" "$(DEPDIR)/libtranslate_la-translate-service.Plo"; else rm -f "$(DEPDIR)/libtranslate_la-translate-service.Tpo"; exit 1; fi @AMDEP_TRUE@@am__fastdepCC_FALSE@ source='translate-service.c' object='libtranslate_la-translate-service.lo' libtool=yes @AMDEPBACKSLASH@ @AMDEP_TRUE@@am__fastdepCC_FALSE@ DEPDIR=$(DEPDIR) $(CCDEPMODE) $(depcomp) @AMDEPBACKSLASH@ @am__fastdepCC_FALSE@ $(LIBTOOL) --mode=compile --tag=CC $(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(libtranslate_la_CPPFLAGS) $(CPPFLAGS) $(AM_CFLAGS) $(CFLAGS) -c -o libtranslate_la-translate-service.lo `test -f 'translate-service.c' || echo '$(srcdir)/'`translate-service.c libtranslate_la-translate-session.lo: translate-session.c @am__fastdepCC_TRUE@ if $(LIBTOOL) --mode=compile --tag=CC $(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(libtranslate_la_CPPFLAGS) $(CPPFLAGS) $(AM_CFLAGS) $(CFLAGS) -MT libtranslate_la-translate-session.lo -MD -MP -MF "$(DEPDIR)/libtranslate_la-translate-session.Tpo" -c -o libtranslate_la-translate-session.lo `test -f 'translate-session.c' || echo '$(srcdir)/'`translate-session.c; \ @am__fastdepCC_TRUE@ then mv -f "$(DEPDIR)/libtranslate_la-translate-session.Tpo" "$(DEPDIR)/libtranslate_la-translate-session.Plo"; else rm -f "$(DEPDIR)/libtranslate_la-translate-session.Tpo"; exit 1; fi @AMDEP_TRUE@@am__fastdepCC_FALSE@ source='translate-session.c' object='libtranslate_la-translate-session.lo' libtool=yes @AMDEPBACKSLASH@ @AMDEP_TRUE@@am__fastdepCC_FALSE@ DEPDIR=$(DEPDIR) $(CCDEPMODE) $(depcomp) @AMDEPBACKSLASH@ @am__fastdepCC_FALSE@ $(LIBTOOL) --mode=compile --tag=CC $(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(libtranslate_la_CPPFLAGS) $(CPPFLAGS) $(AM_CFLAGS) $(CFLAGS) -c -o libtranslate_la-translate-session.lo `test -f 'translate-session.c' || echo '$(srcdir)/'`translate-session.c libtranslate_la-translate-util.lo: translate-util.c @am__fastdepCC_TRUE@ if $(LIBTOOL) --mode=compile --tag=CC $(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(libtranslate_la_CPPFLAGS) $(CPPFLAGS) $(AM_CFLAGS) $(CFLAGS) -MT libtranslate_la-translate-util.lo -MD -MP -MF "$(DEPDIR)/libtranslate_la-translate-util.Tpo" -c -o libtranslate_la-translate-util.lo `test -f 'translate-util.c' || echo '$(srcdir)/'`translate-util.c; \ @am__fastdepCC_TRUE@ then mv -f "$(DEPDIR)/libtranslate_la-translate-util.Tpo" "$(DEPDIR)/libtranslate_la-translate-util.Plo"; else rm -f "$(DEPDIR)/libtranslate_la-translate-util.Tpo"; exit 1; fi @AMDEP_TRUE@@am__fastdepCC_FALSE@ source='translate-util.c' object='libtranslate_la-translate-util.lo' libtool=yes @AMDEPBACKSLASH@ @AMDEP_TRUE@@am__fastdepCC_FALSE@ DEPDIR=$(DEPDIR) $(CCDEPMODE) $(depcomp) @AMDEPBACKSLASH@ @am__fastdepCC_FALSE@ $(LIBTOOL) --mode=compile --tag=CC $(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(libtranslate_la_CPPFLAGS) $(CPPFLAGS) $(AM_CFLAGS) $(CFLAGS) -c -o libtranslate_la-translate-util.lo `test -f 'translate-util.c' || echo '$(srcdir)/'`translate-util.c libtranslate_la-translate.lo: translate.c @am__fastdepCC_TRUE@ if $(LIBTOOL) --mode=compile --tag=CC $(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(libtranslate_la_CPPFLAGS) $(CPPFLAGS) $(AM_CFLAGS) $(CFLAGS) -MT libtranslate_la-translate.lo -MD -MP -MF "$(DEPDIR)/libtranslate_la-translate.Tpo" -c -o libtranslate_la-translate.lo `test -f 'translate.c' || echo '$(srcdir)/'`translate.c; \ @am__fastdepCC_TRUE@ then mv -f "$(DEPDIR)/libtranslate_la-translate.Tpo" "$(DEPDIR)/libtranslate_la-translate.Plo"; else rm -f "$(DEPDIR)/libtranslate_la-translate.Tpo"; exit 1; fi @AMDEP_TRUE@@am__fastdepCC_FALSE@ source='translate.c' object='libtranslate_la-translate.lo' libtool=yes @AMDEPBACKSLASH@ @AMDEP_TRUE@@am__fastdepCC_FALSE@ DEPDIR=$(DEPDIR) $(CCDEPMODE) $(depcomp) @AMDEPBACKSLASH@ @am__fastdepCC_FALSE@ $(LIBTOOL) --mode=compile --tag=CC $(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(libtranslate_la_CPPFLAGS) $(CPPFLAGS) $(AM_CFLAGS) $(CFLAGS) -c -o libtranslate_la-translate.lo `test -f 'translate.c' || echo '$(srcdir)/'`translate.c test_util-test-util.o: test-util.c @am__fastdepCC_TRUE@ if $(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(test_util_CPPFLAGS) $(CPPFLAGS) $(AM_CFLAGS) $(CFLAGS) -MT test_util-test-util.o -MD -MP -MF "$(DEPDIR)/test_util-test-util.Tpo" -c -o test_util-test-util.o `test -f 'test-util.c' || echo '$(srcdir)/'`test-util.c; \ @am__fastdepCC_TRUE@ then mv -f "$(DEPDIR)/test_util-test-util.Tpo" "$(DEPDIR)/test_util-test-util.Po"; else rm -f "$(DEPDIR)/test_util-test-util.Tpo"; exit 1; fi @AMDEP_TRUE@@am__fastdepCC_FALSE@ source='test-util.c' object='test_util-test-util.o' libtool=no @AMDEPBACKSLASH@ @AMDEP_TRUE@@am__fastdepCC_FALSE@ DEPDIR=$(DEPDIR) $(CCDEPMODE) $(depcomp) @AMDEPBACKSLASH@ @am__fastdepCC_FALSE@ $(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(test_util_CPPFLAGS) $(CPPFLAGS) $(AM_CFLAGS) $(CFLAGS) -c -o test_util-test-util.o `test -f 'test-util.c' || echo '$(srcdir)/'`test-util.c test_util-test-util.obj: test-util.c @am__fastdepCC_TRUE@ if $(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(test_util_CPPFLAGS) $(CPPFLAGS) $(AM_CFLAGS) $(CFLAGS) -MT test_util-test-util.obj -MD -MP -MF "$(DEPDIR)/test_util-test-util.Tpo" -c -o test_util-test-util.obj `if test -f 'test-util.c'; then $(CYGPATH_W) 'test-util.c'; else $(CYGPATH_W) '$(srcdir)/test-util.c'; fi`; \ @am__fastdepCC_TRUE@ then mv -f "$(DEPDIR)/test_util-test-util.Tpo" "$(DEPDIR)/test_util-test-util.Po"; else rm -f "$(DEPDIR)/test_util-test-util.Tpo"; exit 1; fi @AMDEP_TRUE@@am__fastdepCC_FALSE@ source='test-util.c' object='test_util-test-util.obj' libtool=no @AMDEPBACKSLASH@ @AMDEP_TRUE@@am__fastdepCC_FALSE@ DEPDIR=$(DEPDIR) $(CCDEPMODE) $(depcomp) @AMDEPBACKSLASH@ @am__fastdepCC_FALSE@ $(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(test_util_CPPFLAGS) $(CPPFLAGS) $(AM_CFLAGS) $(CFLAGS) -c -o test_util-test-util.obj `if test -f 'test-util.c'; then $(CYGPATH_W) 'test-util.c'; else $(CYGPATH_W) '$(srcdir)/test-util.c'; fi` translate-translate-cli.o: translate-cli.c @am__fastdepCC_TRUE@ if $(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(translate_CPPFLAGS) $(CPPFLAGS) $(AM_CFLAGS) $(CFLAGS) -MT translate-translate-cli.o -MD -MP -MF "$(DEPDIR)/translate-translate-cli.Tpo" -c -o translate-translate-cli.o `test -f 'translate-cli.c' || echo '$(srcdir)/'`translate-cli.c; \ @am__fastdepCC_TRUE@ then mv -f "$(DEPDIR)/translate-translate-cli.Tpo" "$(DEPDIR)/translate-translate-cli.Po"; else rm -f "$(DEPDIR)/translate-translate-cli.Tpo"; exit 1; fi @AMDEP_TRUE@@am__fastdepCC_FALSE@ source='translate-cli.c' object='translate-translate-cli.o' libtool=no @AMDEPBACKSLASH@ @AMDEP_TRUE@@am__fastdepCC_FALSE@ DEPDIR=$(DEPDIR) $(CCDEPMODE) $(depcomp) @AMDEPBACKSLASH@ @am__fastdepCC_FALSE@ $(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(translate_CPPFLAGS) $(CPPFLAGS) $(AM_CFLAGS) $(CFLAGS) -c -o translate-translate-cli.o `test -f 'translate-cli.c' || echo '$(srcdir)/'`translate-cli.c translate-translate-cli.obj: translate-cli.c @am__fastdepCC_TRUE@ if $(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(translate_CPPFLAGS) $(CPPFLAGS) $(AM_CFLAGS) $(CFLAGS) -MT translate-translate-cli.obj -MD -MP -MF "$(DEPDIR)/translate-translate-cli.Tpo" -c -o translate-translate-cli.obj `if test -f 'translate-cli.c'; then $(CYGPATH_W) 'translate-cli.c'; else $(CYGPATH_W) '$(srcdir)/translate-cli.c'; fi`; \ @am__fastdepCC_TRUE@ then mv -f "$(DEPDIR)/translate-translate-cli.Tpo" "$(DEPDIR)/translate-translate-cli.Po"; else rm -f "$(DEPDIR)/translate-translate-cli.Tpo"; exit 1; fi @AMDEP_TRUE@@am__fastdepCC_FALSE@ source='translate-cli.c' object='translate-translate-cli.obj' libtool=no @AMDEPBACKSLASH@ @AMDEP_TRUE@@am__fastdepCC_FALSE@ DEPDIR=$(DEPDIR) $(CCDEPMODE) $(depcomp) @AMDEPBACKSLASH@ @am__fastdepCC_FALSE@ $(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(translate_CPPFLAGS) $(CPPFLAGS) $(AM_CFLAGS) $(CFLAGS) -c -o translate-translate-cli.obj `if test -f 'translate-cli.c'; then $(CYGPATH_W) 'translate-cli.c'; else $(CYGPATH_W) '$(srcdir)/translate-cli.c'; fi` mostlyclean-libtool: -rm -f *.lo clean-libtool: -rm -rf .libs _libs distclean-libtool: -rm -f libtool uninstall-info-am: install-pkgincludeHEADERS: $(pkginclude_HEADERS) @$(NORMAL_INSTALL) test -z "$(pkgincludedir)" || $(mkdir_p) "$(DESTDIR)$(pkgincludedir)" @list='$(pkginclude_HEADERS)'; for p in $$list; do \ if test -f "$$p"; then d=; else d="$(srcdir)/"; fi; \ f=$(am__strip_dir) \ echo " $(pkgincludeHEADERS_INSTALL) '$$d$$p' '$(DESTDIR)$(pkgincludedir)/$$f'"; \ $(pkgincludeHEADERS_INSTALL) "$$d$$p" "$(DESTDIR)$(pkgincludedir)/$$f"; \ done uninstall-pkgincludeHEADERS: @$(NORMAL_UNINSTALL) @list='$(pkginclude_HEADERS)'; for p in $$list; do \ f=$(am__strip_dir) \ echo " rm -f '$(DESTDIR)$(pkgincludedir)/$$f'"; \ rm -f "$(DESTDIR)$(pkgincludedir)/$$f"; \ done # This directory's subdirectories are mostly independent; you can cd # into them and run `make' without going through this Makefile. # To change the values of `make' variables: instead of editing Makefiles, # (1) if the variable is set in `config.status', edit `config.status' # (which will cause the Makefiles to be regenerated when you run `make'); # (2) otherwise, pass the desired values on the `make' command line. $(RECURSIVE_TARGETS): @set fnord $$MAKEFLAGS; amf=$$2; \ dot_seen=no; \ target=`echo $@ | sed s/-recursive//`; \ list='$(SUBDIRS)'; for subdir in $$list; do \ echo "Making $$target in $$subdir"; \ if test "$$subdir" = "."; then \ dot_seen=yes; \ local_target="$$target-am"; \ else \ local_target="$$target"; \ fi; \ (cd $$subdir && $(MAKE) $(AM_MAKEFLAGS) $$local_target) \ || case "$$amf" in *=*) exit 1;; *k*) fail=yes;; *) exit 1;; esac; \ done; \ if test "$$dot_seen" = "no"; then \ $(MAKE) $(AM_MAKEFLAGS) "$$target-am" || exit 1; \ fi; test -z "$$fail" mostlyclean-recursive clean-recursive distclean-recursive \ maintainer-clean-recursive: @set fnord $$MAKEFLAGS; amf=$$2; \ dot_seen=no; \ case "$@" in \ distclean-* | maintainer-clean-*) list='$(DIST_SUBDIRS)' ;; \ *) list='$(SUBDIRS)' ;; \ esac; \ rev=''; for subdir in $$list; do \ if test "$$subdir" = "."; then :; else \ rev="$$subdir $$rev"; \ fi; \ done; \ rev="$$rev ."; \ target=`echo $@ | sed s/-recursive//`; \ for subdir in $$rev; do \ echo "Making $$target in $$subdir"; \ if test "$$subdir" = "."; then \ local_target="$$target-am"; \ else \ local_target="$$target"; \ fi; \ (cd $$subdir && $(MAKE) $(AM_MAKEFLAGS) $$local_target) \ || case "$$amf" in *=*) exit 1;; *k*) fail=yes;; *) exit 1;; esac; \ done && test -z "$$fail" tags-recursive: list='$(SUBDIRS)'; for subdir in $$list; do \ test "$$subdir" = . || (cd $$subdir && $(MAKE) $(AM_MAKEFLAGS) tags); \ done ctags-recursive: list='$(SUBDIRS)'; for subdir in $$list; do \ test "$$subdir" = . || (cd $$subdir && $(MAKE) $(AM_MAKEFLAGS) ctags); \ done ID: $(HEADERS) $(SOURCES) $(LISP) $(TAGS_FILES) list='$(SOURCES) $(HEADERS) $(LISP) $(TAGS_FILES)'; \ unique=`for i in $$list; do \ if test -f "$$i"; then echo $$i; else echo $(srcdir)/$$i; fi; \ done | \ $(AWK) ' { files[$$0] = 1; } \ END { for (i in files) print i; }'`; \ mkid -fID $$unique tags: TAGS TAGS: tags-recursive $(HEADERS) $(SOURCES) $(TAGS_DEPENDENCIES) \ $(TAGS_FILES) $(LISP) tags=; \ here=`pwd`; \ if ($(ETAGS) --etags-include --version) >/dev/null 2>&1; then \ include_option=--etags-include; \ empty_fix=.; \ else \ include_option=--include; \ empty_fix=; \ fi; \ list='$(SUBDIRS)'; for subdir in $$list; do \ if test "$$subdir" = .; then :; else \ test ! -f $$subdir/TAGS || \ tags="$$tags $$include_option=$$here/$$subdir/TAGS"; \ fi; \ done; \ list='$(SOURCES) $(HEADERS) $(LISP) $(TAGS_FILES)'; \ unique=`for i in $$list; do \ if test -f "$$i"; then echo $$i; else echo $(srcdir)/$$i; fi; \ done | \ $(AWK) ' { files[$$0] = 1; } \ END { for (i in files) print i; }'`; \ if test -z "$(ETAGS_ARGS)$$tags$$unique"; then :; else \ test -n "$$unique" || unique=$$empty_fix; \ $(ETAGS) $(ETAGSFLAGS) $(AM_ETAGSFLAGS) $(ETAGS_ARGS) \ $$tags $$unique; \ fi ctags: CTAGS CTAGS: ctags-recursive $(HEADERS) $(SOURCES) $(TAGS_DEPENDENCIES) \ $(TAGS_FILES) $(LISP) tags=; \ here=`pwd`; \ list='$(SOURCES) $(HEADERS) $(LISP) $(TAGS_FILES)'; \ unique=`for i in $$list; do \ if test -f "$$i"; then echo $$i; else echo $(srcdir)/$$i; fi; \ done | \ $(AWK) ' { files[$$0] = 1; } \ END { for (i in files) print i; }'`; \ test -z "$(CTAGS_ARGS)$$tags$$unique" \ || $(CTAGS) $(CTAGSFLAGS) $(AM_CTAGSFLAGS) $(CTAGS_ARGS) \ $$tags $$unique GTAGS: here=`$(am__cd) $(top_builddir) && pwd` \ && cd $(top_srcdir) \ && gtags -i $(GTAGS_ARGS) $$here distclean-tags: -rm -f TAGS ID GTAGS GRTAGS GSYMS GPATH tags check-TESTS: $(TESTS) @failed=0; all=0; xfail=0; xpass=0; skip=0; \ srcdir=$(srcdir); export srcdir; \ list='$(TESTS)'; \ if test -n "$$list"; then \ for tst in $$list; do \ if test -f ./$$tst; then dir=./; \ elif test -f $$tst; then dir=; \ else dir="$(srcdir)/"; fi; \ if $(TESTS_ENVIRONMENT) $${dir}$$tst; then \ all=`expr $$all + 1`; \ case " $(XFAIL_TESTS) " in \ *" $$tst "*) \ xpass=`expr $$xpass + 1`; \ failed=`expr $$failed + 1`; \ echo "XPASS: $$tst"; \ ;; \ *) \ echo "PASS: $$tst"; \ ;; \ esac; \ elif test $$? -ne 77; then \ all=`expr $$all + 1`; \ case " $(XFAIL_TESTS) " in \ *" $$tst "*) \ xfail=`expr $$xfail + 1`; \ echo "XFAIL: $$tst"; \ ;; \ *) \ failed=`expr $$failed + 1`; \ echo "FAIL: $$tst"; \ ;; \ esac; \ else \ skip=`expr $$skip + 1`; \ echo "SKIP: $$tst"; \ fi; \ done; \ if test "$$failed" -eq 0; then \ if test "$$xfail" -eq 0; then \ banner="All $$all tests passed"; \ else \ banner="All $$all tests behaved as expected ($$xfail expected failures)"; \ fi; \ else \ if test "$$xpass" -eq 0; then \ banner="$$failed of $$all tests failed"; \ else \ banner="$$failed of $$all tests did not behave as expected ($$xpass unexpected passes)"; \ fi; \ fi; \ dashes="$$banner"; \ skipped=""; \ if test "$$skip" -ne 0; then \ skipped="($$skip tests were not run)"; \ test `echo "$$skipped" | wc -c` -le `echo "$$banner" | wc -c` || \ dashes="$$skipped"; \ fi; \ report=""; \ if test "$$failed" -ne 0 && test -n "$(PACKAGE_BUGREPORT)"; then \ report="Please report to $(PACKAGE_BUGREPORT)"; \ test `echo "$$report" | wc -c` -le `echo "$$banner" | wc -c` || \ dashes="$$report"; \ fi; \ dashes=`echo "$$dashes" | sed s/./=/g`; \ echo "$$dashes"; \ echo "$$banner"; \ test -z "$$skipped" || echo "$$skipped"; \ test -z "$$report" || echo "$$report"; \ echo "$$dashes"; \ test "$$failed" -eq 0; \ else :; fi distdir: $(DISTFILES) $(mkdir_p) $(distdir)/.. @srcdirstrip=`echo "$(srcdir)" | sed 's|.|.|g'`; \ topsrcdirstrip=`echo "$(top_srcdir)" | sed 's|.|.|g'`; \ list='$(DISTFILES)'; for file in $$list; do \ case $$file in \ $(srcdir)/*) file=`echo "$$file" | sed "s|^$$srcdirstrip/||"`;; \ $(top_srcdir)/*) file=`echo "$$file" | sed "s|^$$topsrcdirstrip/|$(top_builddir)/|"`;; \ esac; \ if test -f $$file || test -d $$file; then d=.; else d=$(srcdir); fi; \ dir=`echo "$$file" | sed -e 's,/[^/]*$$,,'`; \ if test "$$dir" != "$$file" && test "$$dir" != "."; then \ dir="/$$dir"; \ $(mkdir_p) "$(distdir)$$dir"; \ else \ dir=''; \ fi; \ if test -d $$d/$$file; then \ if test -d $(srcdir)/$$file && test $$d != $(srcdir); then \ cp -pR $(srcdir)/$$file $(distdir)$$dir || exit 1; \ fi; \ cp -pR $$d/$$file $(distdir)$$dir || exit 1; \ else \ test -f $(distdir)/$$file \ || cp -p $$d/$$file $(distdir)/$$file \ || exit 1; \ fi; \ done list='$(DIST_SUBDIRS)'; for subdir in $$list; do \ if test "$$subdir" = .; then :; else \ test -d "$(distdir)/$$subdir" \ || $(mkdir_p) "$(distdir)/$$subdir" \ || exit 1; \ distdir=`$(am__cd) $(distdir) && pwd`; \ top_distdir=`$(am__cd) $(top_distdir) && pwd`; \ (cd $$subdir && \ $(MAKE) $(AM_MAKEFLAGS) \ top_distdir="$$top_distdir" \ distdir="$$distdir/$$subdir" \ distdir) \ || exit 1; \ fi; \ done check-am: all-am $(MAKE) $(AM_MAKEFLAGS) check-TESTS check: $(BUILT_SOURCES) $(MAKE) $(AM_MAKEFLAGS) check-recursive all-am: Makefile $(LTLIBRARIES) $(PROGRAMS) $(DATA) $(HEADERS) install-binPROGRAMS: install-libLTLIBRARIES installdirs: installdirs-recursive installdirs-am: for dir in "$(DESTDIR)$(libdir)" "$(DESTDIR)$(bindir)" "$(DESTDIR)$(pkgincludedir)"; do \ test -z "$$dir" || $(mkdir_p) "$$dir"; \ done install: $(BUILT_SOURCES) $(MAKE) $(AM_MAKEFLAGS) install-recursive install-exec: install-exec-recursive install-data: install-data-recursive uninstall: uninstall-recursive install-am: all-am @$(MAKE) $(AM_MAKEFLAGS) install-exec-am install-data-am installcheck: installcheck-recursive install-strip: $(MAKE) $(AM_MAKEFLAGS) INSTALL_PROGRAM="$(INSTALL_STRIP_PROGRAM)" \ install_sh_PROGRAM="$(INSTALL_STRIP_PROGRAM)" INSTALL_STRIP_FLAG=-s \ `test -z '$(STRIP)' || \ echo "INSTALL_PROGRAM_ENV=STRIPPROG='$(STRIP)'"` install mostlyclean-generic: -test -z "$(MOSTLYCLEANFILES)" || rm -f $(MOSTLYCLEANFILES) clean-generic: distclean-generic: -test -z "$(CONFIG_CLEAN_FILES)" || rm -f $(CONFIG_CLEAN_FILES) maintainer-clean-generic: @echo "This command is intended for maintainers to use" @echo "it deletes files that may require special tools to rebuild." -test -z "$(BUILT_SOURCES)" || rm -f $(BUILT_SOURCES) -test -z "$(MAINTAINERCLEANFILES)" || rm -f $(MAINTAINERCLEANFILES) clean: clean-recursive clean-am: clean-binPROGRAMS clean-generic clean-libLTLIBRARIES \ clean-libtool clean-noinstPROGRAMS mostlyclean-am distclean: distclean-recursive -rm -rf ./$(DEPDIR) -rm -f Makefile distclean-am: clean-am distclean-compile distclean-generic \ distclean-libtool distclean-tags dvi: dvi-recursive dvi-am: html: html-recursive info: info-recursive info-am: install-data-am: install-pkgincludeHEADERS install-exec-am: install-binPROGRAMS install-libLTLIBRARIES install-info: install-info-recursive install-man: installcheck-am: maintainer-clean: maintainer-clean-recursive -rm -rf ./$(DEPDIR) -rm -f Makefile maintainer-clean-am: distclean-am maintainer-clean-generic mostlyclean: mostlyclean-recursive mostlyclean-am: mostlyclean-compile mostlyclean-generic \ mostlyclean-libtool pdf: pdf-recursive pdf-am: ps: ps-recursive ps-am: uninstall-am: uninstall-binPROGRAMS uninstall-info-am \ uninstall-libLTLIBRARIES uninstall-pkgincludeHEADERS uninstall-info: uninstall-info-recursive .PHONY: $(RECURSIVE_TARGETS) CTAGS GTAGS all all-am check check-TESTS \ check-am clean clean-binPROGRAMS clean-generic \ clean-libLTLIBRARIES clean-libtool clean-noinstPROGRAMS \ clean-recursive ctags ctags-recursive distclean \ distclean-compile distclean-generic distclean-libtool \ distclean-recursive distclean-tags distdir dvi dvi-am html \ html-am info info-am install install-am install-binPROGRAMS \ install-data install-data-am install-exec install-exec-am \ install-info install-info-am install-libLTLIBRARIES \ install-man install-pkgincludeHEADERS install-strip \ installcheck installcheck-am installdirs installdirs-am \ maintainer-clean maintainer-clean-generic \ maintainer-clean-recursive mostlyclean mostlyclean-compile \ mostlyclean-generic mostlyclean-libtool mostlyclean-recursive \ pdf pdf-am ps ps-am tags tags-recursive uninstall uninstall-am \ uninstall-binPROGRAMS uninstall-info-am \ uninstall-libLTLIBRARIES uninstall-pkgincludeHEADERS translate-sgml-entities-private.h: ent2h.sh $(entity_sets) ./ent2h.sh $(entity_sets) > $@ translate-rfc3066-private.h: $(top_srcdir)/data/iso639-2 $(top_srcdir)/data/rfc3066.sh lang2h.sh $(top_srcdir)/data/rfc3066.sh < $(top_srcdir)/data/iso639-2 | ./lang2h.sh > $@ @WITH_REGRESSION_TESTS_TRUE@test-util.stamp: test-util @WITH_REGRESSION_TESTS_TRUE@ ./test-util @WITH_REGRESSION_TESTS_TRUE@ @touch test-util.stamp # Tell versions [3.59,3.63) of GNU make to not export all variables. # Otherwise a system limit (for SysV at least) may be exceeded. .NOEXPORT: libtranslate-0.99/src/translate-rfc3066-private.h000644 001750 001750 00000062363 10176430754 023412 0ustar00jylefortjylefort000000 000000 /* * translate-rfc3066-private.h - RFC 3066 tag to name mappings * * Generated automatically by lang2h.sh. * Do not edit this file directly. */ #ifndef _TRANSLATE_RFC3066_PRIVATE_H #define _TRANSLATE_RFC3066_PRIVATE_H static void translate_rfc3066_init (GHashTable *table) { g_return_if_fail(table != NULL); g_hash_table_insert(table, "aa", _("Afar")); g_hash_table_insert(table, "ab", _("Abkhazian")); g_hash_table_insert(table, "ace", _("Achinese")); g_hash_table_insert(table, "ach", _("Acoli")); g_hash_table_insert(table, "ada", _("Adangme")); g_hash_table_insert(table, "ady", _("Adyghe; Adygei")); g_hash_table_insert(table, "afa", _("Afro-Asiatic (Other)")); g_hash_table_insert(table, "afh", _("Afrihili")); g_hash_table_insert(table, "af", _("Afrikaans")); g_hash_table_insert(table, "ak", _("Akan")); g_hash_table_insert(table, "akk", _("Akkadian")); g_hash_table_insert(table, "sq", _("Albanian")); g_hash_table_insert(table, "ale", _("Aleut")); g_hash_table_insert(table, "alg", _("Algonquian languages")); g_hash_table_insert(table, "am", _("Amharic")); g_hash_table_insert(table, "ang", _("English, Old (ca.450-1100)")); g_hash_table_insert(table, "apa", _("Apache languages")); g_hash_table_insert(table, "ar", _("Arabic")); g_hash_table_insert(table, "arc", _("Aramaic")); g_hash_table_insert(table, "an", _("Aragonese")); g_hash_table_insert(table, "hy", _("Armenian")); g_hash_table_insert(table, "arn", _("Araucanian")); g_hash_table_insert(table, "arp", _("Arapaho")); g_hash_table_insert(table, "art", _("Artificial (Other)")); g_hash_table_insert(table, "arw", _("Arawak")); g_hash_table_insert(table, "as", _("Assamese")); g_hash_table_insert(table, "ast", _("Asturian; Bable")); g_hash_table_insert(table, "ath", _("Athapascan languages")); g_hash_table_insert(table, "aus", _("Australian languages")); g_hash_table_insert(table, "av", _("Avaric")); g_hash_table_insert(table, "ae", _("Avestan")); g_hash_table_insert(table, "awa", _("Awadhi")); g_hash_table_insert(table, "ay", _("Aymara")); g_hash_table_insert(table, "az", _("Azerbaijani")); g_hash_table_insert(table, "bad", _("Banda")); g_hash_table_insert(table, "bai", _("Bamileke languages")); g_hash_table_insert(table, "ba", _("Bashkir")); g_hash_table_insert(table, "bal", _("Baluchi")); g_hash_table_insert(table, "bm", _("Bambara")); g_hash_table_insert(table, "ban", _("Balinese")); g_hash_table_insert(table, "eu", _("Basque")); g_hash_table_insert(table, "bas", _("Basa")); g_hash_table_insert(table, "bat", _("Baltic (Other)")); g_hash_table_insert(table, "bej", _("Beja")); g_hash_table_insert(table, "be", _("Belarusian")); g_hash_table_insert(table, "bem", _("Bemba")); g_hash_table_insert(table, "bn", _("Bengali")); g_hash_table_insert(table, "ber", _("Berber (Other)")); g_hash_table_insert(table, "bho", _("Bhojpuri")); g_hash_table_insert(table, "bh", _("Bihari")); g_hash_table_insert(table, "bik", _("Bikol")); g_hash_table_insert(table, "bin", _("Bini")); g_hash_table_insert(table, "bi", _("Bislama")); g_hash_table_insert(table, "bla", _("Siksika")); g_hash_table_insert(table, "bnt", _("Bantu (Other)")); g_hash_table_insert(table, "bs", _("Bosnian")); g_hash_table_insert(table, "bra", _("Braj")); g_hash_table_insert(table, "br", _("Breton")); g_hash_table_insert(table, "btk", _("Batak (Indonesia)")); g_hash_table_insert(table, "bua", _("Buriat")); g_hash_table_insert(table, "bug", _("Buginese")); g_hash_table_insert(table, "bg", _("Bulgarian")); g_hash_table_insert(table, "my", _("Burmese")); g_hash_table_insert(table, "byn", _("Blin; Bilin")); g_hash_table_insert(table, "cad", _("Caddo")); g_hash_table_insert(table, "cai", _("Central American Indian (Other)")); g_hash_table_insert(table, "car", _("Carib")); g_hash_table_insert(table, "ca", _("Catalan; Valencian")); g_hash_table_insert(table, "cau", _("Caucasian (Other)")); g_hash_table_insert(table, "ceb", _("Cebuano")); g_hash_table_insert(table, "cel", _("Celtic (Other)")); g_hash_table_insert(table, "ch", _("Chamorro")); g_hash_table_insert(table, "chb", _("Chibcha")); g_hash_table_insert(table, "ce", _("Chechen")); g_hash_table_insert(table, "chg", _("Chagatai")); g_hash_table_insert(table, "zh", _("Chinese")); g_hash_table_insert(table, "chk", _("Chuukese")); g_hash_table_insert(table, "chm", _("Mari")); g_hash_table_insert(table, "chn", _("Chinook jargon")); g_hash_table_insert(table, "cho", _("Choctaw")); g_hash_table_insert(table, "chp", _("Chipewyan")); g_hash_table_insert(table, "chr", _("Cherokee")); g_hash_table_insert(table, "cu", _("Church Slavic; Old Slavonic; Church Slavonic; Old Bulgarian; Old Church Slavonic")); g_hash_table_insert(table, "cv", _("Chuvash")); g_hash_table_insert(table, "chy", _("Cheyenne")); g_hash_table_insert(table, "cmc", _("Chamic languages")); g_hash_table_insert(table, "cop", _("Coptic")); g_hash_table_insert(table, "kw", _("Cornish")); g_hash_table_insert(table, "co", _("Corsican")); g_hash_table_insert(table, "cpe", _("Creoles and pidgins, English based (Other)")); g_hash_table_insert(table, "cpf", _("Creoles and pidgins, French-based (Other)")); g_hash_table_insert(table, "cpp", _("Creoles and pidgins, Portuguese-based (Other)")); g_hash_table_insert(table, "cr", _("Cree")); g_hash_table_insert(table, "crh", _("Crimean Tatar; Crimean Turkish")); g_hash_table_insert(table, "crp", _("Creoles and pidgins (Other)")); g_hash_table_insert(table, "csb", _("Kashubian")); g_hash_table_insert(table, "cus", _("Cushitic (Other)")); g_hash_table_insert(table, "cs", _("Czech")); g_hash_table_insert(table, "dak", _("Dakota")); g_hash_table_insert(table, "da", _("Danish")); g_hash_table_insert(table, "dar", _("Dargwa")); g_hash_table_insert(table, "day", _("Dayak")); g_hash_table_insert(table, "del", _("Delaware")); g_hash_table_insert(table, "den", _("Slave (Athapascan)")); g_hash_table_insert(table, "dgr", _("Dogrib")); g_hash_table_insert(table, "din", _("Dinka")); g_hash_table_insert(table, "dv", _("Divehi")); g_hash_table_insert(table, "doi", _("Dogri")); g_hash_table_insert(table, "dra", _("Dravidian (Other)")); g_hash_table_insert(table, "dsb", _("Lower Sorbian")); g_hash_table_insert(table, "dua", _("Duala")); g_hash_table_insert(table, "dum", _("Dutch, Middle (ca.1050-1350)")); g_hash_table_insert(table, "nl", _("Dutch; Flemish")); g_hash_table_insert(table, "dyu", _("Dyula")); g_hash_table_insert(table, "dz", _("Dzongkha")); g_hash_table_insert(table, "efi", _("Efik")); g_hash_table_insert(table, "egy", _("Egyptian (Ancient)")); g_hash_table_insert(table, "eka", _("Ekajuk")); g_hash_table_insert(table, "elx", _("Elamite")); g_hash_table_insert(table, "en", _("English")); g_hash_table_insert(table, "enm", _("English, Middle (1100-1500)")); g_hash_table_insert(table, "eo", _("Esperanto")); g_hash_table_insert(table, "et", _("Estonian")); g_hash_table_insert(table, "ee", _("Ewe")); g_hash_table_insert(table, "ewo", _("Ewondo")); g_hash_table_insert(table, "fan", _("Fang")); g_hash_table_insert(table, "fo", _("Faroese")); g_hash_table_insert(table, "fat", _("Fanti")); g_hash_table_insert(table, "fj", _("Fijian")); g_hash_table_insert(table, "fil", _("Filipino; Pilipino")); g_hash_table_insert(table, "fi", _("Finnish")); g_hash_table_insert(table, "fiu", _("Finno-Ugrian (Other)")); g_hash_table_insert(table, "fon", _("Fon")); g_hash_table_insert(table, "fr", _("French")); g_hash_table_insert(table, "frm", _("French, Middle (ca.1400-1800)")); g_hash_table_insert(table, "fro", _("French, Old (842-ca.1400)")); g_hash_table_insert(table, "fy", _("Frisian")); g_hash_table_insert(table, "ff", _("Fulah")); g_hash_table_insert(table, "fur", _("Friulian")); g_hash_table_insert(table, "gaa", _("Ga")); g_hash_table_insert(table, "gay", _("Gayo")); g_hash_table_insert(table, "gba", _("Gbaya")); g_hash_table_insert(table, "gem", _("Germanic (Other)")); g_hash_table_insert(table, "ka", _("Georgian")); g_hash_table_insert(table, "de", _("German")); g_hash_table_insert(table, "gez", _("Geez")); g_hash_table_insert(table, "gil", _("Gilbertese")); g_hash_table_insert(table, "gd", _("Gaelic; Scottish Gaelic")); g_hash_table_insert(table, "ga", _("Irish")); g_hash_table_insert(table, "gl", _("Gallegan")); g_hash_table_insert(table, "gv", _("Manx")); g_hash_table_insert(table, "gmh", _("German, Middle High (ca.1050-1500)")); g_hash_table_insert(table, "goh", _("German, Old High (ca.750-1050)")); g_hash_table_insert(table, "gon", _("Gondi")); g_hash_table_insert(table, "gor", _("Gorontalo")); g_hash_table_insert(table, "got", _("Gothic")); g_hash_table_insert(table, "grb", _("Grebo")); g_hash_table_insert(table, "grc", _("Greek, Ancient (to 1453)")); g_hash_table_insert(table, "el", _("Greek, Modern (1453-)")); g_hash_table_insert(table, "gn", _("Guarani")); g_hash_table_insert(table, "gu", _("Gujarati")); g_hash_table_insert(table, "gwi", _("Gwich´in")); g_hash_table_insert(table, "hai", _("Haida")); g_hash_table_insert(table, "ht", _("Haitian; Haitian Creole")); g_hash_table_insert(table, "ha", _("Hausa")); g_hash_table_insert(table, "haw", _("Hawaiian")); g_hash_table_insert(table, "he", _("Hebrew")); g_hash_table_insert(table, "hz", _("Herero")); g_hash_table_insert(table, "hil", _("Hiligaynon")); g_hash_table_insert(table, "him", _("Himachali")); g_hash_table_insert(table, "hi", _("Hindi")); g_hash_table_insert(table, "hit", _("Hittite")); g_hash_table_insert(table, "hmn", _("Hmong")); g_hash_table_insert(table, "ho", _("Hiri Motu")); g_hash_table_insert(table, "hsb", _("Upper Sorbian")); g_hash_table_insert(table, "hu", _("Hungarian")); g_hash_table_insert(table, "hup", _("Hupa")); g_hash_table_insert(table, "iba", _("Iban")); g_hash_table_insert(table, "ig", _("Igbo")); g_hash_table_insert(table, "is", _("Icelandic")); g_hash_table_insert(table, "io", _("Ido")); g_hash_table_insert(table, "ii", _("Sichuan Yi")); g_hash_table_insert(table, "ijo", _("Ijo")); g_hash_table_insert(table, "iu", _("Inuktitut")); g_hash_table_insert(table, "ie", _("Interlingue")); g_hash_table_insert(table, "ilo", _("Iloko")); g_hash_table_insert(table, "ia", _("Interlingua (International Auxiliary Language Association)")); g_hash_table_insert(table, "inc", _("Indic (Other)")); g_hash_table_insert(table, "id", _("Indonesian")); g_hash_table_insert(table, "ine", _("Indo-European (Other)")); g_hash_table_insert(table, "inh", _("Ingush")); g_hash_table_insert(table, "ik", _("Inupiaq")); g_hash_table_insert(table, "ira", _("Iranian (Other)")); g_hash_table_insert(table, "iro", _("Iroquoian languages")); g_hash_table_insert(table, "it", _("Italian")); g_hash_table_insert(table, "jv", _("Javanese")); g_hash_table_insert(table, "jbo", _("Lojban")); g_hash_table_insert(table, "ja", _("Japanese")); g_hash_table_insert(table, "jpr", _("Judeo-Persian")); g_hash_table_insert(table, "jrb", _("Judeo-Arabic")); g_hash_table_insert(table, "kaa", _("Kara-Kalpak")); g_hash_table_insert(table, "kab", _("Kabyle")); g_hash_table_insert(table, "kac", _("Kachin")); g_hash_table_insert(table, "kl", _("Kalaallisut; Greenlandic")); g_hash_table_insert(table, "kam", _("Kamba")); g_hash_table_insert(table, "kn", _("Kannada")); g_hash_table_insert(table, "kar", _("Karen")); g_hash_table_insert(table, "ks", _("Kashmiri")); g_hash_table_insert(table, "kr", _("Kanuri")); g_hash_table_insert(table, "kaw", _("Kawi")); g_hash_table_insert(table, "kk", _("Kazakh")); g_hash_table_insert(table, "kbd", _("Kabardian")); g_hash_table_insert(table, "kha", _("Khasi")); g_hash_table_insert(table, "khi", _("Khoisan (Other)")); g_hash_table_insert(table, "km", _("Khmer")); g_hash_table_insert(table, "kho", _("Khotanese")); g_hash_table_insert(table, "ki", _("Kikuyu; Gikuyu")); g_hash_table_insert(table, "rw", _("Kinyarwanda")); g_hash_table_insert(table, "ky", _("Kirghiz")); g_hash_table_insert(table, "kmb", _("Kimbundu")); g_hash_table_insert(table, "kok", _("Konkani")); g_hash_table_insert(table, "kv", _("Komi")); g_hash_table_insert(table, "kg", _("Kongo")); g_hash_table_insert(table, "ko", _("Korean")); g_hash_table_insert(table, "kos", _("Kosraean")); g_hash_table_insert(table, "kpe", _("Kpelle")); g_hash_table_insert(table, "krc", _("Karachay-Balkar")); g_hash_table_insert(table, "kro", _("Kru")); g_hash_table_insert(table, "kru", _("Kurukh")); g_hash_table_insert(table, "kj", _("Kuanyama; Kwanyama")); g_hash_table_insert(table, "kum", _("Kumyk")); g_hash_table_insert(table, "ku", _("Kurdish")); g_hash_table_insert(table, "kut", _("Kutenai")); g_hash_table_insert(table, "lad", _("Ladino")); g_hash_table_insert(table, "lah", _("Lahnda")); g_hash_table_insert(table, "lam", _("Lamba")); g_hash_table_insert(table, "lo", _("Lao")); g_hash_table_insert(table, "la", _("Latin")); g_hash_table_insert(table, "lv", _("Latvian")); g_hash_table_insert(table, "lez", _("Lezghian")); g_hash_table_insert(table, "li", _("Limburgan; Limburger; Limburgish")); g_hash_table_insert(table, "ln", _("Lingala")); g_hash_table_insert(table, "lt", _("Lithuanian")); g_hash_table_insert(table, "lol", _("Mongo")); g_hash_table_insert(table, "loz", _("Lozi")); g_hash_table_insert(table, "lb", _("Luxembourgish; Letzeburgesch")); g_hash_table_insert(table, "lua", _("Luba-Lulua")); g_hash_table_insert(table, "lu", _("Luba-Katanga")); g_hash_table_insert(table, "lg", _("Ganda")); g_hash_table_insert(table, "lui", _("Luiseno")); g_hash_table_insert(table, "lun", _("Lunda")); g_hash_table_insert(table, "luo", _("Luo (Kenya and Tanzania)")); g_hash_table_insert(table, "lus", _("lushai")); g_hash_table_insert(table, "mk", _("Macedonian")); g_hash_table_insert(table, "mad", _("Madurese")); g_hash_table_insert(table, "mag", _("Magahi")); g_hash_table_insert(table, "mh", _("Marshallese")); g_hash_table_insert(table, "mai", _("Maithili")); g_hash_table_insert(table, "mak", _("Makasar")); g_hash_table_insert(table, "ml", _("Malayalam")); g_hash_table_insert(table, "man", _("Mandingo")); g_hash_table_insert(table, "mi", _("Maori")); g_hash_table_insert(table, "map", _("Austronesian (Other)")); g_hash_table_insert(table, "mr", _("Marathi")); g_hash_table_insert(table, "mas", _("Masai")); g_hash_table_insert(table, "ms", _("Malay")); g_hash_table_insert(table, "mdf", _("Moksha")); g_hash_table_insert(table, "mdr", _("Mandar")); g_hash_table_insert(table, "men", _("Mende")); g_hash_table_insert(table, "mga", _("Irish, Middle (900-1200)")); g_hash_table_insert(table, "mic", _("Mi'kmaq; Micmac")); g_hash_table_insert(table, "min", _("Minangkabau")); g_hash_table_insert(table, "mis", _("Miscellaneous languages")); g_hash_table_insert(table, "mkh", _("Mon-Khmer (Other)")); g_hash_table_insert(table, "mg", _("Malagasy")); g_hash_table_insert(table, "mt", _("Maltese")); g_hash_table_insert(table, "mnc", _("Manchu")); g_hash_table_insert(table, "mni", _("Manipuri")); g_hash_table_insert(table, "mno", _("Manobo languages")); g_hash_table_insert(table, "moh", _("Mohawk")); g_hash_table_insert(table, "mo", _("Moldavian")); g_hash_table_insert(table, "mn", _("Mongolian")); g_hash_table_insert(table, "mos", _("Mossi")); g_hash_table_insert(table, "mul", _("Multiple languages")); g_hash_table_insert(table, "mun", _("Munda languages")); g_hash_table_insert(table, "mus", _("Creek")); g_hash_table_insert(table, "mwl", _("Mirandese")); g_hash_table_insert(table, "mwr", _("Marwari")); g_hash_table_insert(table, "myn", _("Mayan languages")); g_hash_table_insert(table, "myv", _("Erzya")); g_hash_table_insert(table, "nah", _("Nahuatl")); g_hash_table_insert(table, "nai", _("North American Indian")); g_hash_table_insert(table, "nap", _("Neapolitan")); g_hash_table_insert(table, "na", _("Nauru")); g_hash_table_insert(table, "nv", _("Navajo; Navaho")); g_hash_table_insert(table, "nr", _("Ndebele, South; South Ndebele")); g_hash_table_insert(table, "nd", _("Ndebele, North; North Ndebele")); g_hash_table_insert(table, "ng", _("Ndonga")); g_hash_table_insert(table, "nds", _("Low German; Low Saxon; German, Low; Saxon, Low")); g_hash_table_insert(table, "ne", _("Nepali")); g_hash_table_insert(table, "new", _("Nepal Bhasa; Newari")); g_hash_table_insert(table, "nia", _("Nias")); g_hash_table_insert(table, "nic", _("Niger-Kordofanian (Other)")); g_hash_table_insert(table, "niu", _("Niuean")); g_hash_table_insert(table, "nn", _("Norwegian Nynorsk")); g_hash_table_insert(table, "nb", _("Norwegian Bokmål")); g_hash_table_insert(table, "nog", _("Nogai")); g_hash_table_insert(table, "non", _("Norse, Old")); g_hash_table_insert(table, "no", _("Norwegian")); g_hash_table_insert(table, "nso", _("Northern Sotho; Pedi; Sepedi")); g_hash_table_insert(table, "nub", _("Nubian languages")); g_hash_table_insert(table, "nwc", _("Classical Newari; Old Newari; Classical Nepal Bhasa")); g_hash_table_insert(table, "ny", _("Chichewa; Chewa; Nyanja")); g_hash_table_insert(table, "nym", _("Nyamwezi")); g_hash_table_insert(table, "nyn", _("Nyankole")); g_hash_table_insert(table, "nyo", _("Nyoro")); g_hash_table_insert(table, "nzi", _("Nzima")); g_hash_table_insert(table, "oc", _("Occitan (post 1500); Provençal")); g_hash_table_insert(table, "oj", _("Ojibwa")); g_hash_table_insert(table, "or", _("Oriya")); g_hash_table_insert(table, "om", _("Oromo")); g_hash_table_insert(table, "osa", _("Osage")); g_hash_table_insert(table, "os", _("Ossetian; Ossetic")); g_hash_table_insert(table, "ota", _("Turkish, Ottoman (1500-1928)")); g_hash_table_insert(table, "oto", _("Otomian languages")); g_hash_table_insert(table, "paa", _("Papuan (Other)")); g_hash_table_insert(table, "pag", _("Pangasinan")); g_hash_table_insert(table, "pal", _("Pahlavi")); g_hash_table_insert(table, "pam", _("Pampanga")); g_hash_table_insert(table, "pa", _("Panjabi; Punjabi")); g_hash_table_insert(table, "pap", _("Papiamento")); g_hash_table_insert(table, "pau", _("Palauan")); g_hash_table_insert(table, "peo", _("Persian, Old (ca.600-400 B.C.)")); g_hash_table_insert(table, "fa", _("Persian")); g_hash_table_insert(table, "phi", _("Philippine (Other)")); g_hash_table_insert(table, "phn", _("Phoenician")); g_hash_table_insert(table, "pi", _("Pali")); g_hash_table_insert(table, "pl", _("Polish")); g_hash_table_insert(table, "pon", _("Pohnpeian")); g_hash_table_insert(table, "pt", _("Portuguese")); g_hash_table_insert(table, "pra", _("Prakrit languages")); g_hash_table_insert(table, "pro", _("Provençal, Old (to 1500)")); g_hash_table_insert(table, "ps", _("Pushto")); g_hash_table_insert(table, "qaa-qtz ", _("Reserved for local use")); g_hash_table_insert(table, "qu", _("Quechua")); g_hash_table_insert(table, "raj", _("Rajasthani")); g_hash_table_insert(table, "rap", _("Rapanui")); g_hash_table_insert(table, "rar", _("Rarotongan")); g_hash_table_insert(table, "roa", _("Romance (Other)")); g_hash_table_insert(table, "rm", _("Raeto-Romance")); g_hash_table_insert(table, "rom", _("Romany")); g_hash_table_insert(table, "ro", _("Romanian")); g_hash_table_insert(table, "rn", _("Rundi")); g_hash_table_insert(table, "ru", _("Russian")); g_hash_table_insert(table, "sad", _("Sandawe")); g_hash_table_insert(table, "sg", _("Sango")); g_hash_table_insert(table, "sah", _("Yakut")); g_hash_table_insert(table, "sai", _("South American Indian (Other)")); g_hash_table_insert(table, "sal", _("Salishan languages")); g_hash_table_insert(table, "sam", _("Samaritan Aramaic")); g_hash_table_insert(table, "sa", _("Sanskrit")); g_hash_table_insert(table, "sas", _("Sasak")); g_hash_table_insert(table, "sat", _("Santali")); g_hash_table_insert(table, "sr", _("Serbian")); g_hash_table_insert(table, "scn", _("Sicilian")); g_hash_table_insert(table, "sco", _("Scots")); g_hash_table_insert(table, "hr", _("Croatian")); g_hash_table_insert(table, "sel", _("Selkup")); g_hash_table_insert(table, "sem", _("Semitic (Other)")); g_hash_table_insert(table, "sga", _("Irish, Old (to 900)")); g_hash_table_insert(table, "sgn", _("Sign Languages")); g_hash_table_insert(table, "shn", _("Shan")); g_hash_table_insert(table, "sid", _("Sidamo")); g_hash_table_insert(table, "si", _("Sinhala; Sinhalese")); g_hash_table_insert(table, "sio", _("Siouan languages")); g_hash_table_insert(table, "sit", _("Sino-Tibetan (Other)")); g_hash_table_insert(table, "sla", _("Slavic (Other)")); g_hash_table_insert(table, "sk", _("Slovak")); g_hash_table_insert(table, "sl", _("Slovenian")); g_hash_table_insert(table, "sma", _("Southern Sami")); g_hash_table_insert(table, "se", _("Northern Sami")); g_hash_table_insert(table, "smi", _("Sami languages (Other)")); g_hash_table_insert(table, "smj", _("Lule Sami")); g_hash_table_insert(table, "smn", _("Inari Sami")); g_hash_table_insert(table, "sm", _("Samoan")); g_hash_table_insert(table, "sms", _("Skolt Sami")); g_hash_table_insert(table, "sn", _("Shona")); g_hash_table_insert(table, "sd", _("Sindhi")); g_hash_table_insert(table, "snk", _("Soninke")); g_hash_table_insert(table, "sog", _("Sogdian")); g_hash_table_insert(table, "so", _("Somali")); g_hash_table_insert(table, "son", _("Songhai")); g_hash_table_insert(table, "st", _("Sotho, Southern")); g_hash_table_insert(table, "es", _("Spanish; Castilian")); g_hash_table_insert(table, "sc", _("Sardinian")); g_hash_table_insert(table, "srr", _("Serer")); g_hash_table_insert(table, "ssa", _("Nilo-Saharan (Other)")); g_hash_table_insert(table, "ss", _("Swati")); g_hash_table_insert(table, "suk", _("Sukuma")); g_hash_table_insert(table, "su", _("Sundanese")); g_hash_table_insert(table, "sus", _("Susu")); g_hash_table_insert(table, "sux", _("Sumerian")); g_hash_table_insert(table, "sw", _("Swahili")); g_hash_table_insert(table, "sv", _("Swedish")); g_hash_table_insert(table, "syr", _("Syriac")); g_hash_table_insert(table, "ty", _("Tahitian")); g_hash_table_insert(table, "tai", _("Tai (Other)")); g_hash_table_insert(table, "ta", _("Tamil")); g_hash_table_insert(table, "tt", _("Tatar")); g_hash_table_insert(table, "te", _("Telugu")); g_hash_table_insert(table, "tem", _("Timne")); g_hash_table_insert(table, "ter", _("Tereno")); g_hash_table_insert(table, "tet", _("Tetum")); g_hash_table_insert(table, "tg", _("Tajik")); g_hash_table_insert(table, "tl", _("Tagalog")); g_hash_table_insert(table, "th", _("Thai")); g_hash_table_insert(table, "bo", _("Tibetan")); g_hash_table_insert(table, "tig", _("Tigre")); g_hash_table_insert(table, "ti", _("Tigrinya")); g_hash_table_insert(table, "tiv", _("Tiv")); g_hash_table_insert(table, "tkl", _("Tokelau")); g_hash_table_insert(table, "tlh", _("Klingon; tlhIngan-Hol")); g_hash_table_insert(table, "tli", _("Tlingit")); g_hash_table_insert(table, "tmh", _("Tamashek")); g_hash_table_insert(table, "tog", _("Tonga (Nyasa)")); g_hash_table_insert(table, "to", _("Tonga (Tonga Islands)")); g_hash_table_insert(table, "tpi", _("Tok Pisin")); g_hash_table_insert(table, "tsi", _("Tsimshian")); g_hash_table_insert(table, "tn", _("Tswana")); g_hash_table_insert(table, "ts", _("Tsonga")); g_hash_table_insert(table, "tk", _("Turkmen")); g_hash_table_insert(table, "tum", _("Tumbuka")); g_hash_table_insert(table, "tup", _("Tupi languages")); g_hash_table_insert(table, "tr", _("Turkish")); g_hash_table_insert(table, "tut", _("Altaic (Other)")); g_hash_table_insert(table, "tvl", _("Tuvalu")); g_hash_table_insert(table, "tw", _("Twi")); g_hash_table_insert(table, "tyv", _("Tuvinian")); g_hash_table_insert(table, "udm", _("Udmurt")); g_hash_table_insert(table, "uga", _("Ugaritic")); g_hash_table_insert(table, "ug", _("Uighur; Uyghur")); g_hash_table_insert(table, "uk", _("Ukrainian")); g_hash_table_insert(table, "umb", _("Umbundu")); g_hash_table_insert(table, "und", _("Undetermined")); g_hash_table_insert(table, "ur", _("Urdu")); g_hash_table_insert(table, "uz", _("Uzbek")); g_hash_table_insert(table, "vai", _("Vai")); g_hash_table_insert(table, "ve", _("Venda")); g_hash_table_insert(table, "vi", _("Vietnamese")); g_hash_table_insert(table, "vo", _("Volapük")); g_hash_table_insert(table, "vot", _("Votic")); g_hash_table_insert(table, "wak", _("Wakashan languages")); g_hash_table_insert(table, "wal", _("Walamo")); g_hash_table_insert(table, "war", _("Waray")); g_hash_table_insert(table, "was", _("Washo")); g_hash_table_insert(table, "cy", _("Welsh")); g_hash_table_insert(table, "wen", _("Sorbian languages")); g_hash_table_insert(table, "wa", _("Walloon")); g_hash_table_insert(table, "wo", _("Wolof")); g_hash_table_insert(table, "xal", _("Kalmyk")); g_hash_table_insert(table, "xh", _("Xhosa")); g_hash_table_insert(table, "yao", _("Yao")); g_hash_table_insert(table, "yap", _("Yapese")); g_hash_table_insert(table, "yi", _("Yiddish")); g_hash_table_insert(table, "yo", _("Yoruba")); g_hash_table_insert(table, "ypk", _("Yupik languages")); g_hash_table_insert(table, "zap", _("Zapotec")); g_hash_table_insert(table, "zen", _("Zenaga")); g_hash_table_insert(table, "za", _("Zhuang; Chuang")); g_hash_table_insert(table, "znd", _("Zande")); g_hash_table_insert(table, "zu", _("Zulu")); g_hash_table_insert(table, "zun", _("Zuni")); } #endif /* _TRANSLATE_RFC3066_PRIVATE_H */ libtranslate-0.99/src/translate-sgml-entities-private.h000644 001750 001750 00000012561 10176430755 025101 0ustar00jylefortjylefort000000 000000 /* * translate-sgml-entities-private.h - SGML entities table * * Generated automatically by ent2h.sh. * Do not edit this file directly. */ #ifndef _TRANSLATE_SGML_ENTITIES_PRIVATE_H #define _TRANSLATE_SGML_ENTITIES_PRIVATE_H static const struct { const char *name; unsigned long character; } entities[] = { /* xhtml-lat1.ent */ { "nbsp", 160 }, { "iexcl", 161 }, { "cent", 162 }, { "pound", 163 }, { "curren", 164 }, { "yen", 165 }, { "brvbar", 166 }, { "sect", 167 }, { "uml", 168 }, { "copy", 169 }, { "ordf", 170 }, { "laquo", 171 }, { "not", 172 }, { "shy", 173 }, { "reg", 174 }, { "macr", 175 }, { "deg", 176 }, { "plusmn", 177 }, { "sup", 178 }, { "sup", 179 }, { "acute", 180 }, { "micro", 181 }, { "para", 182 }, { "middot", 183 }, { "cedil", 184 }, { "sup", 185 }, { "ordm", 186 }, { "raquo", 187 }, { "frac", 188 }, { "frac", 189 }, { "frac", 190 }, { "iquest", 191 }, { "Agrave", 192 }, { "Aacute", 193 }, { "Acirc", 194 }, { "Atilde", 195 }, { "Auml", 196 }, { "Aring", 197 }, { "AElig", 198 }, { "Ccedil", 199 }, { "Egrave", 200 }, { "Eacute", 201 }, { "Ecirc", 202 }, { "Euml", 203 }, { "Igrave", 204 }, { "Iacute", 205 }, { "Icirc", 206 }, { "Iuml", 207 }, { "ETH", 208 }, { "Ntilde", 209 }, { "Ograve", 210 }, { "Oacute", 211 }, { "Ocirc", 212 }, { "Otilde", 213 }, { "Ouml", 214 }, { "times", 215 }, { "Oslash", 216 }, { "Ugrave", 217 }, { "Uacute", 218 }, { "Ucirc", 219 }, { "Uuml", 220 }, { "Yacute", 221 }, { "THORN", 222 }, { "szlig", 223 }, { "agrave", 224 }, { "aacute", 225 }, { "acirc", 226 }, { "atilde", 227 }, { "auml", 228 }, { "aring", 229 }, { "aelig", 230 }, { "ccedil", 231 }, { "egrave", 232 }, { "eacute", 233 }, { "ecirc", 234 }, { "euml", 235 }, { "igrave", 236 }, { "iacute", 237 }, { "icirc", 238 }, { "iuml", 239 }, { "eth", 240 }, { "ntilde", 241 }, { "ograve", 242 }, { "oacute", 243 }, { "ocirc", 244 }, { "otilde", 245 }, { "ouml", 246 }, { "divide", 247 }, { "oslash", 248 }, { "ugrave", 249 }, { "uacute", 250 }, { "ucirc", 251 }, { "uuml", 252 }, { "yacute", 253 }, { "thorn", 254 }, { "yuml", 255 }, /* xhtml-special.ent */ { "quot", 34 }, { "amp", 38 }, { "lt", 60 }, { "gt", 62 }, { "apos", 39 }, { "OElig", 338 }, { "oelig", 339 }, { "Scaron", 352 }, { "scaron", 353 }, { "Yuml", 376 }, { "circ", 710 }, { "tilde", 732 }, { "ensp", 8194 }, { "emsp", 8195 }, { "thinsp", 8201 }, { "zwnj", 8204 }, { "zwj", 8205 }, { "lrm", 8206 }, { "rlm", 8207 }, { "ndash", 8211 }, { "mdash", 8212 }, { "lsquo", 8216 }, { "rsquo", 8217 }, { "sbquo", 8218 }, { "ldquo", 8220 }, { "rdquo", 8221 }, { "bdquo", 8222 }, { "dagger", 8224 }, { "Dagger", 8225 }, { "permil", 8240 }, { "lsaquo", 8249 }, { "rsaquo", 8250 }, { "euro", 8364 }, /* xhtml-symbol.ent */ { "fnof", 402 }, { "Alpha", 913 }, { "Beta", 914 }, { "Gamma", 915 }, { "Delta", 916 }, { "Epsilon", 917 }, { "Zeta", 918 }, { "Eta", 919 }, { "Theta", 920 }, { "Iota", 921 }, { "Kappa", 922 }, { "Lambda", 923 }, { "Mu", 924 }, { "Nu", 925 }, { "Xi", 926 }, { "Omicron", 927 }, { "Pi", 928 }, { "Rho", 929 }, { "Sigma", 931 }, { "Tau", 932 }, { "Upsilon", 933 }, { "Phi", 934 }, { "Chi", 935 }, { "Psi", 936 }, { "Omega", 937 }, { "alpha", 945 }, { "beta", 946 }, { "gamma", 947 }, { "delta", 948 }, { "epsilon", 949 }, { "zeta", 950 }, { "eta", 951 }, { "theta", 952 }, { "iota", 953 }, { "kappa", 954 }, { "lambda", 955 }, { "mu", 956 }, { "nu", 957 }, { "xi", 958 }, { "omicron", 959 }, { "pi", 960 }, { "rho", 961 }, { "sigmaf", 962 }, { "sigma", 963 }, { "tau", 964 }, { "upsilon", 965 }, { "phi", 966 }, { "chi", 967 }, { "psi", 968 }, { "omega", 969 }, { "thetasym", 977 }, { "upsih", 978 }, { "piv", 982 }, { "bull", 8226 }, { "hellip", 8230 }, { "prime", 8242 }, { "Prime", 8243 }, { "oline", 8254 }, { "frasl", 8260 }, { "weierp", 8472 }, { "image", 8465 }, { "real", 8476 }, { "trade", 8482 }, { "alefsym", 8501 }, { "larr", 8592 }, { "uarr", 8593 }, { "rarr", 8594 }, { "darr", 8595 }, { "harr", 8596 }, { "crarr", 8629 }, { "lArr", 8656 }, { "uArr", 8657 }, { "rArr", 8658 }, { "dArr", 8659 }, { "hArr", 8660 }, { "forall", 8704 }, { "part", 8706 }, { "exist", 8707 }, { "empty", 8709 }, { "nabla", 8711 }, { "isin", 8712 }, { "notin", 8713 }, { "ni", 8715 }, { "prod", 8719 }, { "sum", 8721 }, { "minus", 8722 }, { "lowast", 8727 }, { "radic", 8730 }, { "prop", 8733 }, { "infin", 8734 }, { "ang", 8736 }, { "and", 8743 }, { "or", 8744 }, { "cap", 8745 }, { "cup", 8746 }, { "int", 8747 }, { "there", 8756 }, { "sim", 8764 }, { "cong", 8773 }, { "asymp", 8776 }, { "ne", 8800 }, { "equiv", 8801 }, { "le", 8804 }, { "ge", 8805 }, { "sub", 8834 }, { "sup", 8835 }, { "nsub", 8836 }, { "sube", 8838 }, { "supe", 8839 }, { "oplus", 8853 }, { "otimes", 8855 }, { "perp", 8869 }, { "sdot", 8901 }, { "lceil", 8968 }, { "rceil", 8969 }, { "lfloor", 8970 }, { "rfloor", 8971 }, { "lang", 9001 }, { "rang", 9002 }, { "loz", 9674 }, { "spades", 9824 }, { "clubs", 9827 }, { "hearts", 9829 }, { "diams", 9830 }, }; #endif /* _TRANSLATE_SGML_ENTITIES_PRIVATE_H */ libtranslate-0.99/src/translate-pair-private.h000644 001750 001750 00000003524 10172765615 023251 0ustar00jylefortjylefort000000 000000 /* * Copyright (C) 2004, 2005 Jean-Yves Lefort * All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in the * documentation and/or other materials provided with the distribution. * 3. Neither the name of Jean-Yves Lefort nor the names of its contributors * may be used to endorse or promote products derived from this software * without specific prior written permission. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND * CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, * INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF * MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE * DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS * BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, * EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED * TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON * ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, * OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY * OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE * POSSIBILITY OF SUCH DAMAGE. */ #ifndef _TRANSLATE_PAIR_PRIVATE_H #define _TRANSLATE_PAIR_PRIVATE_H #include "translate-pair.h" void translate_pair_set_flags (TranslatePair *pair, TranslatePairFlags flags); GSList *translate_pairs_merge (GSList *pairs1, const GSList *pairs2); #endif /* _TRANSLATE_PAIR_PRIVATE_H */ libtranslate-0.99/src/translate-pair.c000644 001750 001750 00000025145 10172765623 021576 0ustar00jylefortjylefort000000 000000 /* * Copyright (C) 2004, 2005 Jean-Yves Lefort * All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in the * documentation and/or other materials provided with the distribution. * 3. Neither the name of Jean-Yves Lefort nor the names of its contributors * may be used to endorse or promote products derived from this software * without specific prior written permission. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND * CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, * INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF * MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE * DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS * BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, * EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED * TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON * ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, * OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY * OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE * POSSIBILITY OF SUCH DAMAGE. */ #include "config.h" #include #include #include "translate-pair.h" #include "translate-pair-private.h" #include "translate.h" enum { PROP_0, PROP_FLAGS, PROP_FROM, PROP_TO }; struct _TranslatePairPrivate { TranslatePairFlags flags; char *from; char *to; }; static GObjectClass *parent_class = NULL; static void translate_pair_register_type (GType *type); static void translate_pair_flags_register_type (GType *type); static void translate_pair_class_init (TranslatePairClass *class); static void translate_pair_init (TranslatePair *pair); static void translate_pair_finalize (GObject *object); static void translate_pair_set_property (GObject *object, unsigned int prop_id, const GValue *value, GParamSpec *pspec); static void translate_pair_get_property (GObject *object, unsigned int prop_id, GValue *value, GParamSpec *pspec); static int translate_pairs_tag_compare_func (TranslatePair *a, TranslatePair *b); static int translate_pairs_name_compare_func (TranslatePair *a, TranslatePair *b); GType translate_pair_get_type (void) { static GType type; static GOnce once = G_ONCE_INIT; g_once(&once, (GThreadFunc) translate_pair_register_type, &type); return type; } static void translate_pair_register_type (GType *type) { static const GTypeInfo info = { sizeof(TranslatePairClass), NULL, NULL, (GClassInitFunc) translate_pair_class_init, NULL, NULL, sizeof(TranslatePair), 0, (GInstanceInitFunc) translate_pair_init }; *type = g_type_register_static(G_TYPE_OBJECT, "TranslatePair", &info, 0); } GType translate_pair_flags_get_type (void) { static GType type; static GOnce once = G_ONCE_INIT; g_once(&once, (GThreadFunc) translate_pair_flags_register_type, &type); return type; } static void translate_pair_flags_register_type (GType *type) { static const GFlagsValue values[] = { { TRANSLATE_PAIR_TEXT, "TRANSLATE_PAIR_TEXT", "text" }, { TRANSLATE_PAIR_WEB_PAGE, "TRANSLATE_PAIR_WEB_PAGE", "web-page" }, { 0, NULL, NULL } }; *type = g_flags_register_static("TranslatePairFlags", values); } static void translate_pair_class_init (TranslatePairClass *class) { GObjectClass *object_class = G_OBJECT_CLASS(class); g_type_class_add_private(class, sizeof(TranslatePairPrivate)); parent_class = g_type_class_peek_parent(class); object_class->finalize = translate_pair_finalize; object_class->set_property = translate_pair_set_property; object_class->get_property = translate_pair_get_property; g_object_class_install_property(object_class, PROP_FLAGS, g_param_spec_flags("flags", _("Flags"), _("The pair flags"), TRANSLATE_TYPE_PAIR_FLAGS, 0, G_PARAM_READABLE | G_PARAM_WRITABLE | G_PARAM_CONSTRUCT_ONLY)); g_object_class_install_property(object_class, PROP_FROM, g_param_spec_string("from", _("From"), _("The source language RFC 3066 tag"), NULL, G_PARAM_READABLE | G_PARAM_WRITABLE | G_PARAM_CONSTRUCT_ONLY)); g_object_class_install_property(object_class, PROP_TO, g_param_spec_string("to", _("To"), _("The destination language RFC 3066 tag"), NULL, G_PARAM_READABLE | G_PARAM_WRITABLE | G_PARAM_CONSTRUCT_ONLY)); } static void translate_pair_init (TranslatePair *pair) { pair->priv = G_TYPE_INSTANCE_GET_PRIVATE(pair, TRANSLATE_TYPE_PAIR, TranslatePairPrivate); } static void translate_pair_finalize (GObject *object) { TranslatePair *pair = TRANSLATE_PAIR(object); g_free(pair->priv->from); g_free(pair->priv->to); parent_class->finalize(object); } static void translate_pair_set_property (GObject *object, unsigned int prop_id, const GValue *value, GParamSpec *pspec) { TranslatePair *pair = TRANSLATE_PAIR(object); switch (prop_id) { case PROP_FLAGS: pair->priv->flags = g_value_get_flags(value); break; case PROP_FROM: pair->priv->from = g_value_dup_string(value); break; case PROP_TO: pair->priv->to = g_value_dup_string(value); break; default: G_OBJECT_WARN_INVALID_PROPERTY_ID(object, prop_id, pspec); break; } } static void translate_pair_get_property (GObject *object, unsigned int prop_id, GValue *value, GParamSpec *pspec) { TranslatePair *pair = TRANSLATE_PAIR(object); switch (prop_id) { case PROP_FLAGS: g_value_set_flags(value, pair->priv->flags); break; case PROP_FROM: g_value_set_string(value, pair->priv->from); break; case PROP_TO: g_value_set_string(value, pair->priv->to); break; default: G_OBJECT_WARN_INVALID_PROPERTY_ID(object, prop_id, pspec); break; } } /** * translate_pair_get_flags: * @pair: a pair. * * Gets the flags of @pair. * * Return value: the pair flags. **/ TranslatePairFlags translate_pair_get_flags (TranslatePair *pair) { g_return_val_if_fail(TRANSLATE_IS_PAIR(pair), 0); return pair->priv->flags; } void translate_pair_set_flags (TranslatePair *pair, TranslatePairFlags flags) { g_return_if_fail(TRANSLATE_IS_PAIR(pair)); pair->priv->flags = flags; } /** * translate_pair_get_from: * @pair: a pair. * * Gets the source language of @pair. * * Return value: the RFC 3066 tag of the source language of @pair. **/ const char * translate_pair_get_from (TranslatePair *pair) { g_return_val_if_fail(TRANSLATE_IS_PAIR(pair), NULL); return pair->priv->from; } /** * translate_pair_get_to: * @pair: a pair. * * Gets the destination language of @pair. * * Return value: the RFC 3066 tag of the destination language of * @pair. **/ const char * translate_pair_get_to (TranslatePair *pair) { g_return_val_if_fail(TRANSLATE_IS_PAIR(pair), NULL); return pair->priv->to; } /** * translate_pair_new: * @flags: the pair flags. * @from: the source language RFC 3066 tag. * @to: the destination language RFC 3066 tag. * * Creates a new language pair. * * Return value: a new language pair. **/ TranslatePair * translate_pair_new (TranslatePairFlags flags, const char *from, const char *to) { g_return_val_if_fail(from != NULL, NULL); g_return_val_if_fail(to != NULL, NULL); return g_object_new(TRANSLATE_TYPE_PAIR, "flags", flags, "from", from, "to", to, NULL); } GSList * translate_pairs_merge (GSList *pairs1, const GSList *pairs2) { const GSList *l; for (l = pairs2; l != NULL; l = l->next) { TranslatePair *pair = l->data; TranslatePair *existing_pair; existing_pair = translate_pairs_find(pairs1, pair->priv->from, pair->priv->to); if (existing_pair) existing_pair->priv->flags |= pair->priv->flags; else pairs1 = g_slist_append(pairs1, g_object_ref(pair)); } return pairs1; } /** * translate_pairs_sort_by_tag: * @pairs: a list of #TranslatePair objects. * * Sorts a pair list by source and destination RFC 3066 tag. Tag * comparisons are performed using translate_ascii_strcasecoll(). * * Return value: @pairs sorted. **/ GSList * translate_pairs_sort_by_tag (GSList *pairs) { return g_slist_sort(pairs, (GCompareFunc) translate_pairs_tag_compare_func); } /** * translate_pairs_sort_by_name: * @pairs: a list of #TranslatePair objects. * * Sorts a pair list by source and destination human-readable language * name. Names are obtained using translate_get_language_name(), and * are compared using translate_utf8_strcasecoll(). * * Return value: @pairs sorted. **/ GSList * translate_pairs_sort_by_name (GSList *pairs) { return g_slist_sort(pairs, (GCompareFunc) translate_pairs_name_compare_func); } static int translate_pairs_tag_compare_func (TranslatePair *a, TranslatePair *b) { int coll; coll = translate_ascii_strcasecoll(a->priv->from, b->priv->from); if (! coll) coll = translate_ascii_strcasecoll(a->priv->to, b->priv->to); return coll; } static int translate_pairs_name_compare_func (TranslatePair *a, TranslatePair *b) { int coll; coll = translate_utf8_strcasecoll(translate_get_language_name(a->priv->from), translate_get_language_name(b->priv->from)); if (! coll) coll = translate_utf8_strcasecoll(translate_get_language_name(a->priv->to), translate_get_language_name(b->priv->to)); return coll; } /** * translate_pairs_find: * @pairs: a list of #TranslatePair objects. * @from: a RFC 3066 tag, or %NULL. * @to: a RFC 3066 tag, or %NULL. * * Finds the first pair in @pairs whose source and/or destination * language match @from and/or @to. * * Return value: a pair, or %NULL if not found. The returned pair * belongs to @pairs, its reference count is not incremented. **/ TranslatePair * translate_pairs_find (const GSList *pairs, const char *from, const char *to) { const GSList *l; for (l = pairs; l != NULL; l = l->next) { TranslatePair *pair = l->data; if ((! from || ! g_ascii_strcasecmp(pair->priv->from, from)) && (! to || ! g_ascii_strcasecmp(pair->priv->to, to))) return pair; } return NULL; } libtranslate-0.99/src/translate-service-private.h000644 001750 001750 00000004240 10172765635 023754 0ustar00jylefortjylefort000000 000000 /* * Copyright (C) 2004, 2005 Jean-Yves Lefort * All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in the * documentation and/or other materials provided with the distribution. * 3. Neither the name of Jean-Yves Lefort nor the names of its contributors * may be used to endorse or promote products derived from this software * without specific prior written permission. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND * CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, * INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF * MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE * DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS * BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, * EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED * TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON * ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, * OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY * OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE * POSSIBILITY OF SUCH DAMAGE. */ #ifndef _TRANSLATE_SERVICE_PRIVATE_H #define _TRANSLATE_SERVICE_PRIVATE_H #include "translate-service.h" char *translate_service_translate_text (TranslateService *service, const char *text, const char *from, const char *to, TranslateProgressFunc progress_func, gpointer user_data, GError **err); char *translate_service_translate_web_page (TranslateService *service, const char *url, const char *from, const char *to, TranslateProgressFunc progress_func, gpointer user_data, GError **err); #endif /* _TRANSLATE_SERVICE_PRIVATE_H */ libtranslate-0.99/src/translate-service.c000644 001750 001750 00000026234 10172765643 022305 0ustar00jylefortjylefort000000 000000 /* * Copyright (C) 2004, 2005 Jean-Yves Lefort * All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in the * documentation and/or other materials provided with the distribution. * 3. Neither the name of Jean-Yves Lefort nor the names of its contributors * may be used to endorse or promote products derived from this software * without specific prior written permission. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND * CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, * INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF * MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE * DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS * BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, * EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED * TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON * ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, * OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY * OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE * POSSIBILITY OF SUCH DAMAGE. */ #include "config.h" #include #include #include "translate-service-private.h" #include "translate-pair-private.h" #include "translate.h" #define LOCK(service) g_mutex_lock((service)->priv->mutex) #define UNLOCK(service) g_mutex_unlock((service)->priv->mutex) enum { PROP_0, PROP_NAME, PROP_NICK, PROP_MAX_CHUNK_LEN, PROP_PAIRS }; struct _TranslateServicePrivate { char *name; char *nick; unsigned int max_chunk_len; GMutex *mutex; gboolean pairs_set; GSList *pairs; }; static GObjectClass *parent_class = NULL; static void translate_service_register_type (GType *type); static void translate_service_class_init (TranslateServiceClass *class); static void translate_service_init (TranslateService *service); static void translate_service_finalize (GObject *object); static void translate_service_set_property (GObject *object, unsigned int prop_id, const GValue *value, GParamSpec *pspec); static void translate_service_get_property (GObject *object, unsigned int prop_id, GValue *value, GParamSpec *pspec); GType translate_service_get_type (void) { static GType type; static GOnce once = G_ONCE_INIT; g_once(&once, (GThreadFunc) translate_service_register_type, &type); return type; } static void translate_service_register_type (GType *type) { static const GTypeInfo info = { sizeof(TranslateServiceClass), NULL, NULL, (GClassInitFunc) translate_service_class_init, NULL, NULL, sizeof(TranslateService), 0, (GInstanceInitFunc) translate_service_init }; *type = g_type_register_static(G_TYPE_OBJECT, "TranslateService", &info, G_TYPE_FLAG_ABSTRACT); } static void translate_service_class_init (TranslateServiceClass *class) { GObjectClass *object_class = G_OBJECT_CLASS(class); g_type_class_add_private(class, sizeof(TranslateServicePrivate)); parent_class = g_type_class_peek_parent(class); object_class->finalize = translate_service_finalize; object_class->set_property = translate_service_set_property; object_class->get_property = translate_service_get_property; g_object_class_install_property(object_class, PROP_NAME, g_param_spec_string("name", _("Name"), _("The service symbolic name, encoded in ASCII"), NULL, G_PARAM_READABLE | G_PARAM_WRITABLE | G_PARAM_CONSTRUCT_ONLY)); g_object_class_install_property(object_class, PROP_NICK, g_param_spec_string("nick", _("Nick"), _("The service human-readable name"), NULL, G_PARAM_READABLE | G_PARAM_WRITABLE | G_PARAM_CONSTRUCT_ONLY)); g_object_class_install_property(object_class, PROP_MAX_CHUNK_LEN, g_param_spec_uint("max-chunk-len", _("Maximum chunk length"), _("The maximum length of an input chunk, in characters (0 means unlimited)"), 0, G_MAXUINT, 0, G_PARAM_READABLE | G_PARAM_WRITABLE | G_PARAM_CONSTRUCT_ONLY)); g_object_class_install_property(object_class, PROP_PAIRS, g_param_spec_pointer("pairs", _("Pairs"), _("The list of language pairs this service implements"), G_PARAM_READABLE)); } static void translate_service_init (TranslateService *service) { service->priv = G_TYPE_INSTANCE_GET_PRIVATE(service, TRANSLATE_TYPE_SERVICE, TranslateServicePrivate); service->priv->mutex = g_mutex_new(); } static void translate_service_finalize (GObject *object) { TranslateService *service = TRANSLATE_SERVICE(object); g_free(service->priv->name); g_free(service->priv->nick); g_mutex_free(service->priv->mutex); g_slist_foreach(service->priv->pairs, (GFunc) g_object_unref, NULL); g_slist_free(service->priv->pairs); parent_class->finalize(object); } static void translate_service_set_property (GObject *object, unsigned int prop_id, const GValue *value, GParamSpec *pspec) { TranslateService *service = TRANSLATE_SERVICE(object); switch (prop_id) { case PROP_NAME: service->priv->name = g_value_dup_string(value); break; case PROP_NICK: service->priv->nick = g_value_dup_string(value); break; case PROP_MAX_CHUNK_LEN: service->priv->max_chunk_len = g_value_get_uint(value); break; default: G_OBJECT_WARN_INVALID_PROPERTY_ID(object, prop_id, pspec); break; } } static void translate_service_get_property (GObject *object, unsigned int prop_id, GValue *value, GParamSpec *pspec) { TranslateService *service = TRANSLATE_SERVICE(object); switch (prop_id) { case PROP_NAME: g_value_set_string(value, service->priv->name); break; case PROP_NICK: g_value_set_string(value, service->priv->nick); break; case PROP_MAX_CHUNK_LEN: g_value_set_uint(value, service->priv->max_chunk_len); break; case PROP_PAIRS: LOCK(service); if (! service->priv->pairs_set) { TranslateServiceClass *class = TRANSLATE_SERVICE_GET_CLASS(service); GError *err = NULL; if (class->get_pairs) { if (class->get_pairs(service, &service->priv->pairs, NULL, NULL, &err)) { GSList *l; /* hunt down programming errors */ for (l = service->priv->pairs; l != NULL; l = l->next) { TranslatePair *pair = l->data; TranslatePairFlags flags = translate_pair_get_flags(pair); if (! class->translate_text && (flags & TRANSLATE_PAIR_TEXT)) { g_critical(_("%s: the TRANSLATE_PAIR_TEXT flag is set for %s->%s, but the translate_text method is not implemented (this indicates a programming error in the service implementation): unsetting the flag"), service->priv->nick, translate_pair_get_from(pair), translate_pair_get_to(pair)); flags &= ~TRANSLATE_PAIR_TEXT; } if (! class->translate_web_page && (flags & TRANSLATE_PAIR_WEB_PAGE)) { g_critical(_("%s: the TRANSLATE_PAIR_WEB_PAGE flag is set for %s->%s, but the translate_web_page method is not implemented (this indicates a programming error in the service implementation): unsetting the flag"), service->priv->nick, translate_pair_get_from(pair), translate_pair_get_to(pair)); flags &= ~TRANSLATE_PAIR_WEB_PAGE; } translate_pair_set_flags(pair, flags); } } else { g_warning(_("%s: unable to get language pairs: %s"), service->priv->nick, err->message); g_error_free(err); } } else g_critical(_("%s: the get_pairs method is not implemented (this indicates a programming error in the service implementation)"), service->priv->nick); service->priv->pairs_set = TRUE; } UNLOCK(service); g_value_set_pointer(value, service->priv->pairs); break; default: G_OBJECT_WARN_INVALID_PROPERTY_ID(object, prop_id, pspec); break; } } /** * translate_service_get_name: * @service: a service. * * Gets the symbolic name of @service. * * Return value: the symbolic name of @service, encoded in ASCII. **/ const char * translate_service_get_name (TranslateService *service) { g_return_val_if_fail(TRANSLATE_IS_SERVICE(service), NULL); return service->priv->name; } /** * translate_service_get_nick: * @service: a service. * * Gets the human-readable name of @service. * * Return value: the human-readable name of @service. **/ const char * translate_service_get_nick (TranslateService *service) { g_return_val_if_fail(TRANSLATE_IS_SERVICE(service), NULL); return service->priv->nick; } /** * translate_service_get_max_chunk_len: * @service: a service. * * Gets the maximum chunk length of @service. * * Return value: the maximum chunk length of @service, in characters. **/ unsigned int translate_service_get_max_chunk_len (TranslateService *service) { g_return_val_if_fail(TRANSLATE_IS_SERVICE(service), 0); return service->priv->max_chunk_len; } /** * translate_service_get_pairs: * @service: a service. * * Gets the list of language pairs implemented by @service. * * Return value: a list of #TranslatePair objects. **/ const GSList * translate_service_get_pairs (TranslateService *service) { const GSList *pairs; g_return_val_if_fail(TRANSLATE_IS_SERVICE(service), NULL); g_object_get(G_OBJECT(service), "pairs", &pairs, NULL); return pairs; } char * translate_service_translate_text (TranslateService *service, const char *text, const char *from, const char *to, TranslateProgressFunc progress_func, gpointer user_data, GError **err) { g_return_val_if_fail(TRANSLATE_IS_SERVICE(service), NULL); g_return_val_if_fail(TRANSLATE_SERVICE_GET_CLASS(service)->translate_text != NULL, NULL); g_return_val_if_fail(text != NULL, NULL); g_return_val_if_fail(from != NULL, NULL); g_return_val_if_fail(to != NULL, NULL); return TRANSLATE_SERVICE_GET_CLASS(service)->translate_text(service, text, from, to, progress_func, user_data, err); } char * translate_service_translate_web_page (TranslateService *service, const char *url, const char *from, const char *to, TranslateProgressFunc progress_func, gpointer user_data, GError **err) { g_return_val_if_fail(TRANSLATE_IS_SERVICE(service), NULL); g_return_val_if_fail(TRANSLATE_SERVICE_GET_CLASS(service)->translate_web_page != NULL, NULL); g_return_val_if_fail(url != NULL, NULL); g_return_val_if_fail(from != NULL, NULL); g_return_val_if_fail(to != NULL, NULL); return TRANSLATE_SERVICE_GET_CLASS(service)->translate_web_page(service, url, from, to, progress_func, user_data, err); } libtranslate-0.99/src/translate-session.c000644 001750 001750 00000062732 10172765657 022340 0ustar00jylefortjylefort000000 000000 /* * Copyright (C) 2004, 2005 Jean-Yves Lefort * All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in the * documentation and/or other materials provided with the distribution. * 3. Neither the name of Jean-Yves Lefort nor the names of its contributors * may be used to endorse or promote products derived from this software * without specific prior written permission. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND * CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, * INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF * MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE * DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS * BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, * EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED * TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON * ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, * OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY * OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE * POSSIBILITY OF SUCH DAMAGE. */ #include "config.h" #include #include #include #include "translate-service-private.h" #include "translate.h" #include "translate-pair-private.h" #define LOCK(session) g_mutex_lock((session)->priv->mutex) #define UNLOCK(session) g_mutex_unlock((session)->priv->mutex) enum { PROP_0, PROP_SERVICES, PROP_PAIRS, PROP_MAX_THREADS, PROP_MAX_RETRIES }; struct _TranslateSessionPrivate { GMutex *mutex; GSList *services; GSList *pairs; unsigned int max_threads; int max_retries; }; typedef struct { GMutex *mutex; GCond *progress_cond; TranslateSession *session; GSList *services; GSList *chunks; const char *from; const char *to; GError *err; } TranslateInfo; typedef struct { TranslateInfo *info; const char *chunk; char *translated; double progress; } TranslateChunkInfo; static GObjectClass *parent_class = NULL; static void translate_session_register_type (GType *type); static void translate_session_class_init (TranslateSessionClass *class); static void translate_session_init (TranslateSession *session); static void translate_session_finalize (GObject *object); static void translate_session_set_property (GObject *object, unsigned int prop_id, const GValue *value, GParamSpec *pspec); static void translate_session_get_property (GObject *object, unsigned int prop_id, GValue *value, GParamSpec *pspec); static void translate_session_translate_thread (gpointer data, gpointer user_data); static gboolean translate_session_translate_progress_cb (double progress, gpointer user_data); static GSList *translate_session_split (const char *text, unsigned int max_chunk_len); GType translate_session_get_type (void) { static GType type; static GOnce once = G_ONCE_INIT; g_once(&once, (GThreadFunc) translate_session_register_type, &type); return type; } static void translate_session_register_type (GType *type) { static const GTypeInfo info = { sizeof(TranslateSessionClass), NULL, NULL, (GClassInitFunc) translate_session_class_init, NULL, NULL, sizeof(TranslateSession), 0, (GInstanceInitFunc) translate_session_init }; *type = g_type_register_static(G_TYPE_OBJECT, "TranslateSession", &info, 0); } static void translate_session_class_init (TranslateSessionClass *class) { GObjectClass *object_class = G_OBJECT_CLASS(class); g_type_class_add_private(class, sizeof(TranslateSessionPrivate)); parent_class = g_type_class_peek_parent(class); object_class->finalize = translate_session_finalize; object_class->set_property = translate_session_set_property; object_class->get_property = translate_session_get_property; /* keep the default values in sync with the setters documentation */ g_object_class_install_property(object_class, PROP_SERVICES, g_param_spec_pointer("services", _("Services"), _("The list of services used by this session"), G_PARAM_READABLE | G_PARAM_WRITABLE | G_PARAM_CONSTRUCT)); g_object_class_install_property(object_class, PROP_PAIRS, g_param_spec_pointer("pairs", _("Pairs"), _("The list of pairs this session supports"), G_PARAM_READABLE)); g_object_class_install_property(object_class, PROP_MAX_THREADS, g_param_spec_uint("max-threads", _("Maximum number of threads"), _("The maximum number of translation threads to use"), 0, G_MAXINT, 8, G_PARAM_READABLE | G_PARAM_WRITABLE | G_PARAM_CONSTRUCT)); g_object_class_install_property(object_class, PROP_MAX_RETRIES, g_param_spec_int("max-retries", _("Maximum number of retries"), _("The maximum number of times to retry a translation of the same chunk (-1 for unlimited)"), -1, G_MAXINT, 3, G_PARAM_READABLE | G_PARAM_WRITABLE | G_PARAM_CONSTRUCT)); } static void translate_session_init (TranslateSession *session) { session->priv = G_TYPE_INSTANCE_GET_PRIVATE(session, TRANSLATE_TYPE_SESSION, TranslateSessionPrivate); session->priv->mutex = g_mutex_new(); } static void translate_session_finalize (GObject *object) { TranslateSession *session = TRANSLATE_SESSION(object); g_slist_foreach(session->priv->services, (GFunc) g_object_unref, NULL); g_slist_free(session->priv->services); g_slist_foreach(session->priv->pairs, (GFunc) g_object_unref, NULL); g_slist_free(session->priv->pairs); g_mutex_free(session->priv->mutex); parent_class->finalize(object); } static void translate_session_set_property (GObject *object, unsigned int prop_id, const GValue *value, GParamSpec *pspec) { TranslateSession *session = TRANSLATE_SESSION(object); switch (prop_id) { case PROP_SERVICES: { GSList *l; LOCK(session); g_slist_foreach(session->priv->services, (GFunc) g_object_unref, NULL); g_slist_free(session->priv->services); session->priv->services = g_slist_copy(g_value_get_pointer(value)); g_slist_foreach(session->priv->services, (GFunc) g_object_ref, NULL); g_slist_foreach(session->priv->pairs, (GFunc) g_object_unref, NULL); g_slist_free(session->priv->pairs); session->priv->pairs = NULL; for (l = session->priv->services; l != NULL; l = l->next) { TranslateService *service = l->data; session->priv->pairs = translate_pairs_merge(session->priv->pairs, translate_service_get_pairs(service)); } UNLOCK(session); g_object_notify(object, "pairs"); } break; case PROP_MAX_THREADS: LOCK(session); session->priv->max_threads = g_value_get_uint(value); UNLOCK(session); break; case PROP_MAX_RETRIES: LOCK(session); session->priv->max_retries = g_value_get_int(value); UNLOCK(session); break; default: G_OBJECT_WARN_INVALID_PROPERTY_ID(object, prop_id, pspec); break; } } /** * translate_session_set_services: * @session: a session. * @services: a list of #TranslateService objects to use. * * Sets the services used by @session. Default value: %NULL. * * The list of services determines the available language pairs (see * translate_session_get_pairs()). The order of the list is important, * as translate_session_translate_text() and * translate_session_translate_web_page() iterate over the list until * the translation can be performed. **/ void translate_session_set_services (TranslateSession *session, const GSList *services) { g_return_if_fail(TRANSLATE_IS_SESSION(session)); g_object_set(G_OBJECT(session), "services", services, NULL); } /** * translate_session_set_max_threads: * @session: a session. * @max_threads: a maximum number of threads. * * Sets the maximum number of concurrent threads to use for * translating text. Default value: 8. **/ void translate_session_set_max_threads (TranslateSession *session, unsigned int max_threads) { g_return_if_fail(TRANSLATE_IS_SESSION(session)); g_object_set(G_OBJECT(session), "max-threads", max_threads, NULL); } /** * translate_session_set_max_retries: * @session: a session. * @max_retries: a maximum number of retries. * * Sets the maximum number of retries per text chunk. Default value: * 3. **/ void translate_session_set_max_retries (TranslateSession *session, unsigned int max_retries) { g_return_if_fail(TRANSLATE_IS_SESSION(session)); g_object_set(G_OBJECT(session), "max-retries", max_retries, NULL); } static void translate_session_get_property (GObject *object, unsigned int prop_id, GValue *value, GParamSpec *pspec) { TranslateSession *session = TRANSLATE_SESSION(object); switch (prop_id) { case PROP_SERVICES: LOCK(session); g_slist_foreach(session->priv->services, (GFunc) g_object_ref, NULL); g_value_set_pointer(value, g_slist_copy(session->priv->services)); UNLOCK(session); break; case PROP_PAIRS: LOCK(session); g_slist_foreach(session->priv->pairs, (GFunc) g_object_ref, NULL); g_value_set_pointer(value, g_slist_copy(session->priv->pairs)); UNLOCK(session); break; case PROP_MAX_THREADS: LOCK(session); g_value_set_uint(value, session->priv->max_threads); UNLOCK(session); break; case PROP_MAX_RETRIES: LOCK(session); g_value_set_int(value, session->priv->max_retries); UNLOCK(session); break; default: G_OBJECT_WARN_INVALID_PROPERTY_ID(object, prop_id, pspec); break; } } /** * translate_session_get_services: * @session: a session. * * Gets the services used by session. When no longer needed, the list * should be freed with: * * * g_slist_foreach(list, (GFunc) g_object_unref, NULL); * g_slist_free(list); * * * Return value: the list of #TranslateService objects used by * @session. **/ GSList * translate_session_get_services (TranslateSession *session) { GSList *services; g_return_val_if_fail(TRANSLATE_IS_SESSION(session), NULL); g_object_get(G_OBJECT(session), "services", &services, NULL); return services; } /** * translate_session_get_pairs: * @session: a session. * * Gets the list of language pairs available for translations. When no longer * needed, the list should be freed with: * * * g_slist_foreach(list, (GFunc) g_object_unref, NULL); * g_slist_free(list); * * * Return value: the list of #TranslatePair objects available for * translations. **/ GSList * translate_session_get_pairs (TranslateSession *session) { GSList *pairs; g_return_val_if_fail(TRANSLATE_IS_SESSION(session), NULL); g_object_get(G_OBJECT(session), "pairs", &pairs, NULL); return pairs; } /** * translate_session_get_max_threads: * @session: a session. * * Gets the maximum number of concurrent threads to use for * translating text. * * Return value: the maximum number of threads. **/ unsigned int translate_session_get_max_threads (TranslateSession *session) { unsigned int max_threads; g_return_val_if_fail(TRANSLATE_IS_SESSION(session), 0); g_object_get(G_OBJECT(session), "max-threads", &max_threads, NULL); return max_threads; } /** * translate_session_get_max_retries: * @session: a session. * * Gets the maximum number of retries per text chunk. * * Return value: the maximum number of retries. **/ int translate_session_get_max_retries (TranslateSession *session) { int max_retries; g_return_val_if_fail(TRANSLATE_IS_SESSION(session), 0); g_object_get(G_OBJECT(session), "max-retries", &max_retries, NULL); return max_retries; } static GSList * translate_session_get_services_for_translation (TranslateSession *session, TranslatePairFlags flags, const char *from, const char *to) { GSList *services = NULL; GSList *l; g_return_val_if_fail(TRANSLATE_IS_SESSION(session), NULL); g_return_val_if_fail(from != NULL, NULL); g_return_val_if_fail(to != NULL, NULL); for (l = session->priv->services; l != NULL; l = l->next) { TranslateService *service = l->data; const GSList *pairs; TranslatePair *pair; pairs = translate_service_get_pairs(service); pair = translate_pairs_find(pairs, from, to); if (pair && translate_pair_get_flags(pair) & flags) services = g_slist_append(services, g_object_ref(service)); } return services; } /** * translate_session_translate_text: * @session: a session. * @text: a nul-terminated string. * @from: a RFC 3066 language tag. * @to: a RFC 3066 language tag. * @progress_func: a function to call when progressing, or %NULL. * @user_data: data to pass to @progress_func, or %NULL. * @err: a location to report errors, or %NULL. Any of the errors in * #TranslateSessionError, #TranslateError or other domains may occur. * * Translates text from the language @from into the language @to. * * If @progress_func is specified, it may be * called periodically to report progress. If, when called, * @progress_func returns %FALSE, the translation is cancelled as soon * as possible, %NULL is returned, and @err is set to an error of * domain #TRANSLATE_ERROR and code #TRANSLATE_ERROR_CANCELLED. * * Return value: the translated text on success, or %NULL on failure * (in such case @err is set). The returned string should be freed * when no longer needed. **/ char * translate_session_translate_text (TranslateSession *session, const char *text, const char *from, const char *to, TranslateProgressFunc progress_func, gpointer user_data, GError **err) { GSList *chunks; TranslateInfo info; int n_chunks; unsigned int max_threads; GThreadPool *pool; GSList *l; unsigned int max_chunk_len = 0; char *translated = NULL; g_return_val_if_fail(TRANSLATE_IS_SESSION(session), NULL); g_return_val_if_fail(text != NULL, NULL); g_return_val_if_fail(from != NULL, NULL); g_return_val_if_fail(to != NULL, NULL); LOCK(session); info.services = translate_session_get_services_for_translation(session, TRANSLATE_PAIR_TEXT, from, to); max_threads = session->priv->max_threads; UNLOCK(session); if (! info.services) { g_set_error(err, TRANSLATE_SESSION_ERROR, TRANSLATE_SESSION_ERROR_NO_SERVICE, _("no service provides %s to %s text translation"), translate_get_language_name(from), translate_get_language_name(to)); return NULL; } /* compute max_chunk_len */ for (l = info.services; l != NULL; l = l->next) { TranslateService *service = l->data; unsigned int service_max_chunk_len = translate_service_get_max_chunk_len(service); if (service_max_chunk_len != 0 && (max_chunk_len == 0 || service_max_chunk_len < max_chunk_len)) max_chunk_len = service_max_chunk_len; } chunks = translate_session_split(text, max_chunk_len); info.mutex = g_mutex_new(); info.progress_cond = progress_func ? g_cond_new() : NULL; info.session = session; info.chunks = NULL; info.from = from; info.to = to; info.err = NULL; n_chunks = g_slist_length(chunks); pool = g_thread_pool_new(translate_session_translate_thread, &info, MIN(max_threads, n_chunks), TRUE, err); if (! pool) goto end; for (l = chunks; l != NULL; l = l->next) { TranslateChunkInfo *chunk_info; GError *tmp_err = NULL; chunk_info = g_new0(TranslateChunkInfo, 1); chunk_info->info = &info; chunk_info->chunk = l->data; info.chunks = g_slist_append(info.chunks, chunk_info); g_thread_pool_push(pool, chunk_info, &tmp_err); if (tmp_err) { /* inform threads that an error has occurred */ g_mutex_lock(info.mutex); if (info.err) g_error_free(tmp_err); else info.err = tmp_err; g_mutex_unlock(info.mutex); /* finish */ goto pool_end; } } if (info.progress_cond) { g_mutex_lock(info.mutex); while (g_thread_pool_unprocessed(pool) > 0) { double progress = 0; GSList *l; int n_chunks; g_cond_wait(info.progress_cond, info.mutex); if (info.err) break; for (l = info.chunks, n_chunks = 0; l != NULL; l = l->next, n_chunks++) { TranslateChunkInfo *chunk_info = l->data; progress += chunk_info->progress; } progress /= n_chunks; if (! progress_func(progress, user_data)) { info.err = g_error_new(TRANSLATE_ERROR, TRANSLATE_ERROR_CANCELLED, _("cancelled by user")); break; } } g_mutex_unlock(info.mutex); } pool_end: g_thread_pool_free(pool, FALSE, TRUE); if (info.err) g_propagate_error(err, info.err); else { GString *string; string = g_string_new(NULL); for (l = info.chunks; l != NULL; l = l->next) { TranslateChunkInfo *chunk_info = l->data; g_string_append(string, chunk_info->translated); } translated = g_string_free(string, FALSE); } for (l = info.chunks; l != NULL; l = l->next) { TranslateChunkInfo *chunk_info = l->data; g_free(chunk_info->translated); g_free(chunk_info); } g_slist_free(info.chunks); end: g_slist_foreach(chunks, (GFunc) g_free, NULL); g_slist_free(chunks); g_mutex_free(info.mutex); if (info.progress_cond) g_cond_free(info.progress_cond); g_slist_foreach(info.services, (GFunc) g_object_unref, NULL); g_slist_free(info.services); return translated; } static void translate_session_translate_thread (gpointer data, gpointer user_data) { int max_retries; TranslateChunkInfo *chunk_info = data; TranslateInfo *info = user_data; int i; LOCK(info->session); max_retries = info->session->priv->max_retries; UNLOCK(info->session); for (i = 0; (i < max_retries || max_retries == -1) && ! chunk_info->translated; i++) { GSList *l; for (l = info->services; l != NULL && ! chunk_info->translated; l = l->next) { TranslateService *service = l->data; gboolean ret; GError *tmp_err = NULL; g_mutex_lock(info->mutex); ret = info->err != NULL; g_mutex_unlock(info->mutex); if (ret) return; chunk_info->translated = translate_service_translate_text(service, chunk_info->chunk, info->from, info->to, info->progress_cond ? translate_session_translate_progress_cb : NULL, info->progress_cond ? chunk_info : NULL, &tmp_err); if (! chunk_info->translated) { if (g_error_matches(tmp_err, TRANSLATE_ERROR, TRANSLATE_ERROR_CANCELLED)) { g_mutex_lock(info->mutex); if (info->err) g_error_free(tmp_err); else g_propagate_error(&info->err, tmp_err); g_mutex_unlock(info->mutex); return; } else { g_warning(_("unable to translate chunk using %s: %s"), translate_service_get_nick(service), tmp_err->message); g_error_free(tmp_err); } } } } g_mutex_lock(info->mutex); if (chunk_info->translated) { if (info->progress_cond) { chunk_info->progress = 1.0; g_cond_signal(info->progress_cond); } } else { if (! info->err) info->err = g_error_new(TRANSLATE_SESSION_ERROR, TRANSLATE_SESSION_ERROR_NO_SERVICE, _("no service could translate chunk")); } g_mutex_unlock(info->mutex); } static gboolean translate_session_translate_progress_cb (double progress, gpointer user_data) { TranslateChunkInfo *chunk_info = user_data; gboolean cont; g_mutex_lock(chunk_info->info->mutex); if (chunk_info->info->err) cont = FALSE; else { if (progress >= 0) chunk_info->progress = progress; g_cond_signal(chunk_info->info->progress_cond); cont = TRUE; } g_mutex_unlock(chunk_info->info->mutex); return cont; } static GSList * translate_session_split (const char *text, unsigned int max_chunk_len) { GSList *chunks = NULL; GString *chunk; int chunk_len; /* in UTF-8 chars */ g_return_val_if_fail(text != NULL, NULL); if (max_chunk_len == 0) /* unlimited */ return g_slist_append(chunks, g_strdup(text)); chunk = g_string_new(NULL); chunk_len = 0; while (*text) { char *sentence_end; /* ptr to char following end of sentence */ int sentence_len; /* in UTF-8 chars */ #define SENTENCE_TERMINATORS ".?!" #define CLAUSE_TERMINATORS ",;:\"'-) " sentence_end = translate_utf8_strpbrk(text, -1, SENTENCE_TERMINATORS); sentence_end = sentence_end ? sentence_end + 1 : strchr(text, 0); sentence_len = g_utf8_strlen(text, sentence_end - text); if (sentence_len + chunk_len > max_chunk_len) { if (chunk_len > 0) { chunks = g_slist_append(chunks, g_string_free(chunk, FALSE)); chunk = g_string_new(NULL); chunk_len = 0; } if (sentence_len > max_chunk_len) { /* still too long, fallback to clause */ char *chunk_end; char *clause_end; chunk_end = g_utf8_offset_to_pointer(text, max_chunk_len); clause_end = translate_utf8_strrpbrk(text, chunk_end - text, CLAUSE_TERMINATORS); if (clause_end) { sentence_end = clause_end + 1; sentence_len = g_utf8_strlen(text, sentence_end - text); } else { /* didn't work, just use max_chunk_len */ sentence_end = chunk_end; sentence_len = max_chunk_len; } } } g_string_append_len(chunk, text, sentence_end - text); text = sentence_end; chunk_len += sentence_len; } if (*chunk->str || ! chunks) chunks = g_slist_append(chunks, g_string_free(chunk, FALSE)); else g_string_free(chunk, TRUE); return chunks; } /** * translate_session_translate_web_page: * @session: a session. * @url: an URL. * @from: a RFC 3066 language tag. * @to: a RFC 3066 language tag. * @progress_func: a function to call when progressing, or %NULL. * @user_data: data to pass to @progress_func, or %NULL. * @err: a location to report errors, or %NULL. Any of the errors in * #TranslateSessionError, #TranslateError or other domains may occur. * * Translates a web page from the language @from into the language * @to. * * If @progress_func is specified, it may be * called periodically to report progress. If, when called, * @progress_func returns %FALSE, the translation is cancelled as soon * as possible, %NULL is returned, and @err is set to an error of * domain #TRANSLATE_ERROR and code #TRANSLATE_ERROR_CANCELLED. * * Return value: an URL pointing to the translated web page on * success, or %NULL on failure (in such case @err is set). The * returned string should be freed when no longer needed. **/ char * translate_session_translate_web_page (TranslateSession *session, const char *url, const char *from, const char *to, TranslateProgressFunc progress_func, gpointer user_data, GError **err) { GSList *services; char *translated_url = NULL; GSList *l; gboolean cancelled = FALSE; g_return_val_if_fail(TRANSLATE_IS_SESSION(session), NULL); g_return_val_if_fail(url != NULL, NULL); g_return_val_if_fail(from != NULL, NULL); g_return_val_if_fail(to != NULL, NULL); LOCK(session); services = translate_session_get_services_for_translation(session, TRANSLATE_PAIR_WEB_PAGE, from, to); UNLOCK(session); if (! services) { g_set_error(err, TRANSLATE_SESSION_ERROR, TRANSLATE_SESSION_ERROR_NO_SERVICE, _("no service provides %s to %s web page translation"), translate_get_language_name(from), translate_get_language_name(to)); return NULL; } for (l = services; l != NULL && ! translated_url; l = l->next) { TranslateService *service = l->data; GError *tmp_err = NULL; translated_url = translate_service_translate_web_page(service, url, from, to, progress_func, user_data, &tmp_err); if (! translated_url) { if (g_error_matches(tmp_err, TRANSLATE_ERROR, TRANSLATE_ERROR_CANCELLED)) { g_propagate_error(err, tmp_err); cancelled = TRUE; } else { g_warning(_("unable to translate web page using %s: %s"), translate_service_get_nick(service), tmp_err->message); g_error_free(tmp_err); } } } g_slist_foreach(services, (GFunc) g_object_unref, NULL); g_slist_free(services); if (! translated_url && ! cancelled) g_set_error(err, TRANSLATE_SESSION_ERROR, TRANSLATE_SESSION_ERROR_NO_SERVICE, _("no service could translate web page")); return translated_url; } /** * translate_session_new: * @services: a list of #TranslateService objects to use. See * translate_session_set_services(). * * Creates a new translation session, which will use @services for * performing translations. * * Return value: a new translation session. **/ TranslateSession * translate_session_new (const GSList *services) { return g_object_new(TRANSLATE_TYPE_SESSION, "services", services, NULL); } GQuark translate_session_error_quark (void) { return g_quark_from_static_string("translate-session-error"); } libtranslate-0.99/src/translate-util.c000644 001750 001750 00000030144 10172765671 021616 0ustar00jylefortjylefort000000 000000 /* * Copyright (C) 2004, 2005 Jean-Yves Lefort * All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in the * documentation and/or other materials provided with the distribution. * 3. Neither the name of Jean-Yves Lefort nor the names of its contributors * may be used to endorse or promote products derived from this software * without specific prior written permission. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND * CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, * INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF * MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE * DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS * BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, * EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED * TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON * ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, * OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY * OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE * POSSIBILITY OF SUCH DAMAGE. */ #include "config.h" #include #include #include #include #include #include #include #include "translate.h" #include "translate-sgml-entities-private.h" static gunichar translate_sgml_ref_get_unichar (const char *ref); /** * translate_ascii_strcase_equal: * @s1: a nul-terminated string. * @s2: a nul-terminated string. * * Compares two strings, ignoring the case of ASCII characters of both * strings, and returns %TRUE if they are equal. It can be passed to * g_hash_table_new() as the @key_equal_func parameter, when using * strings as case-insensitive keys in a #GHashTable. * * Return value: %TRUE if the two strings match. **/ gboolean translate_ascii_strcase_equal (gconstpointer s1, gconstpointer s2) { return g_ascii_strcasecmp(s1, s2) == 0; } /** * translate_ascii_strcase_hash: * @key: a string key. * * Converts a string to a hash value, ignoring the case of ASCII * characters of the string. It can be passed to g_hash_table_new() as * the @hash_func parameter, when using strings as case-insensitive * keys in a #GHashTable. * * Return value: a hash value corresponding to the key. **/ unsigned int translate_ascii_strcase_hash (gconstpointer key) { const char *p = key; unsigned int h = g_ascii_tolower(*p); if (h) for (p++; *p; p++) h = (h << 5) - h + g_ascii_tolower(*p); return h; } /** * translate_ascii_strcasestr: * @big: a nul-terminated string, which may not be encoded in UTF-8. * @little: the nul-terminated string to search for, which may not be * encoded in UTF-8. * * Locates the first occurrence of @little in @big, ignoring the case * of ASCII characters of both strings. * * Return value: if @little is an empty string, @big is returned; if * @little occurs nowhere in @big, %NULL is returned; otherwise a * pointer to the first character of the first occurrence of @little * in @big is returned. **/ char * translate_ascii_strcasestr (const char *big, const char *little) { g_return_val_if_fail(big != NULL, NULL); g_return_val_if_fail(little != NULL, NULL); return translate_ascii_strcasestr_len(big, -1, little); } /** * translate_ascii_strcasestr_len: * @big: a nul-terminated string, which may not be encoded in UTF-8. * @big_len: length of @big in bytes, or -1 if @big is nul-terminated. * @little: the nul-terminated string to search for, which may not be * encoded in UTF-8. * * Locates the first occurrence of @little in @big, ignoring the case * of ASCII characters of both strings, and limiting the length of the * search to @big_len. * * Return value: if @little is an empty string, @big is returned; if * @little occurs nowhere in @big, %NULL is returned; otherwise a * pointer to the first character of the first occurrence of @little * in @big is returned. **/ char * translate_ascii_strcasestr_len (const char *big, unsigned int big_len, const char *little) { char *lower_big; char *lower_little; char *s; g_return_val_if_fail(big != NULL, NULL); g_return_val_if_fail(little != NULL, NULL); lower_big = g_ascii_strdown(big, big_len); lower_little = g_ascii_strdown(little, -1); s = strstr(lower_big, lower_little); if (s) s = (char *) big + (s - lower_big); g_free(lower_big); g_free(lower_little); return s; } /** * translate_ascii_strcasecoll: * @s1: a nul-terminated string, which may not be encoded in UTF-8. * @s2: a nul-terminated string, which may not be encoded in UTF-8. * * Compares two strings for ordering using the linguistically correct * rules for the current locale, ignoring the case of ASCII characters * of both strings. * * Return value: an integer greater than, equal to, or less than 0, * according as @s1 is greater than, equal to, or less than @s2. **/ int translate_ascii_strcasecoll (const char *s1, const char *s2) { char *lower_s1; char *lower_s2; int coll; lower_s1 = g_ascii_strdown(s1, -1); lower_s2 = g_ascii_strdown(s2, -1); coll = strcoll(lower_s1, lower_s2); g_free(lower_s1); g_free(lower_s2); return coll; } /** * translate_utf8_strcasecoll: * @s1: a nul-terminated string. * @s2: a nul-terminated string. * * Compares two UTF-8 strings for ordering using the linguistically * correct rules for the current locale, ignoring the case of both * strings. * * Return value: an integer greater than, equal to, or less than 0, * according as @s1 is greater than, equal to, or less than @s2. **/ int translate_utf8_strcasecoll (const char *s1, const char *s2) { char *folded_s1; char *folded_s2; int coll; g_return_val_if_fail(s1 != NULL, 0); g_return_val_if_fail(s2 != NULL, 0); folded_s1 = g_utf8_casefold(s1, -1); folded_s2 = g_utf8_casefold(s2, -1); coll = g_utf8_collate(folded_s1, folded_s2); g_free(folded_s1); g_free(folded_s2); return coll; } /** * translate_utf8_strcmp: * @s1: a nul-terminated string. * @s2: a nul-terminated string. * * Compares two UTF-8 strings for ordering. * * Return value: an integer greater than, equal to, or less than 0, * according as @s1 is greater than, equal to, or less than @s2. **/ int translate_utf8_strcmp (const char *s1, const char *s2) { char *normalized_s1; char *normalized_s2; int cmp; g_return_val_if_fail(s1 != NULL, 0); g_return_val_if_fail(s2 != NULL, 0); normalized_s1 = g_utf8_normalize(s1, -1, G_NORMALIZE_ALL); normalized_s2 = g_utf8_normalize(s2, -1, G_NORMALIZE_ALL); cmp = strcmp(normalized_s1, normalized_s2); g_free(normalized_s1); g_free(normalized_s2); return cmp; } /** * translate_utf8_strcasecmp: * @s1: a nul-terminated string. * @s2: a nul-terminated string. * * Compares two UTF-8 strings for ordering, ignoring the case of both * strings. * * Return value: an integer greater than, equal to, or less than 0, * according as @s1 is greater than, equal to, or less than @s2. **/ int translate_utf8_strcasecmp (const char *s1, const char *s2) { char *normalized_s1; char *normalized_s2; char *case_normalized_s1; char *case_normalized_s2; int cmp; g_return_val_if_fail(s1 != NULL, 0); g_return_val_if_fail(s2 != NULL, 0); normalized_s1 = g_utf8_normalize(s1, -1, G_NORMALIZE_ALL); normalized_s2 = g_utf8_normalize(s2, -1, G_NORMALIZE_ALL); case_normalized_s1 = g_utf8_casefold(normalized_s1, -1); case_normalized_s2 = g_utf8_casefold(normalized_s2, -1); cmp = strcmp(case_normalized_s1, case_normalized_s2); g_free(normalized_s1); g_free(normalized_s2); g_free(case_normalized_s1); g_free(case_normalized_s2); return cmp; } /** * translate_time: * * Returns the current time, issuing a warning if an error occurs. * * Return value: the number of seconds since 0 hours, 0 minutes, 0 * seconds, January 1, 1970, Coordinated Universal Time, or 0 if an * error has occurred. **/ time_t translate_time (void) { time_t now; now = time(NULL); if (now < 0) { g_warning(_("cannot get current time: %s"), g_strerror(errno)); now = 0; } return now; } static gunichar translate_sgml_ref_get_unichar (const char *ref) { g_return_val_if_fail(ref != NULL, 0); if (*ref == '#') { /* numeric reference */ const char *nptr; int base; if (*(ref + 1) == 'x' || *(ref + 1) == 'X') { /* hexadecimal number */ nptr = ref + 2; base = 16; } else { /* decimal number */ nptr = ref + 1; base = 10; } if (*nptr) { char *end; unsigned long code; code = strtoul(nptr, &end, base); if (*end == 0) /* could convert */ return code; } } else { /* entity reference */ int i; for (i = 0; i < G_N_ELEMENTS(entities); i++) if (! strcmp(ref, entities[i].name)) return entities[i].character; } return 0; /* invalid reference */ } /** * translate_sgml_ref_expand: * @str: a nul-terminated string. * * Parses @str, expanding its SGML character references and XHTML * character entities into their Unicode character value. * * Numerical SGML character references as well as XHTML entities are * supported. Unsupported entities will be inserted verbatim into the * result. * * Return value: the expansion of str. The returned string should be * freed when no longer needed. **/ char * translate_sgml_ref_expand (const char *str) { GString *unescaped; const char *start; g_return_val_if_fail(str != NULL, NULL); unescaped = g_string_new(NULL); while ((start = strchr(str, '&'))) { const char *end; gunichar c; end = strpbrk(start + 1, "; &\t\n"); if (! end) end = strchr(start + 1, 0); { char ref[end - start]; strncpy(ref, start + 1, end - start - 1); ref[end - start - 1] = 0; c = translate_sgml_ref_get_unichar(ref); } if (*end == ';') /* semicolon is part of entity, skip it */ end++; g_string_append_len(unescaped, str, start - str); if (c) g_string_append_unichar(unescaped, c); else /* invalid reference, append it raw */ g_string_append_len(unescaped, start, end - start); str = end; } g_string_append(unescaped, str); return g_string_free(unescaped, FALSE); } /** * translate_utf8_strpbrk: * @p: a nul-terminated string. * @len: length of @p in bytes, or -1 if @p is nul-terminated. * @charset: the set of characters to search for. * * Locates in @p the first occurrence of any character in the string * @charset. * * Return value: the first occurrence of any character of @charset in * @p, or %NULL if no characters from @charset occur anywhere in @p. **/ char * translate_utf8_strpbrk (const char *p, gssize len, const char *charset) { g_return_val_if_fail(p != NULL, NULL); g_return_val_if_fail(charset != NULL, NULL); for (; *charset; charset = g_utf8_next_char(charset)) { char *match; match = g_utf8_strchr(p, len, g_utf8_get_char(charset)); if (match) return match; } return NULL; } /** * translate_utf8_strrpbrk: * @p: a nul-terminated string. * @len: length of @p in bytes, or -1 if @p is nul-terminated. * @charset: the set of characters to search for. * * Locates in @p the last occurrence of any character in the string * @charset. * * Return value: the last occurrence of any character of @charset in * @p, or %NULL if no characters from @charset occur anywhere in @p. **/ char * translate_utf8_strrpbrk (const char *p, gssize len, const char *charset) { g_return_val_if_fail(p != NULL, NULL); g_return_val_if_fail(charset != NULL, NULL); for (; *charset; charset = g_utf8_next_char(charset)) { char *match; match = g_utf8_strrchr(p, len, g_utf8_get_char(charset)); if (match) return match; } return NULL; } libtranslate-0.99/src/translate.c000644 001750 001750 00000025155 10172765702 020644 0ustar00jylefortjylefort000000 000000 /* * Copyright (C) 2004, 2005 Jean-Yves Lefort * All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in the * documentation and/or other materials provided with the distribution. * 3. Neither the name of Jean-Yves Lefort nor the names of its contributors * may be used to endorse or promote products derived from this software * without specific prior written permission. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND * CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, * INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF * MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE * DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS * BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, * EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED * TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON * ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, * OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY * OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE * POSSIBILITY OF SUCH DAMAGE. */ #include "config.h" #include #include #include #include #include "translate.h" #include "translate-rfc3066-private.h" const unsigned int translate_major_version = TRANSLATE_MAJOR_VERSION; const unsigned int translate_minor_version = TRANSLATE_MINOR_VERSION; const unsigned int translate_micro_version = TRANSLATE_MICRO_VERSION; gboolean translate_initialized = FALSE; static GSList *services = NULL; G_LOCK_DEFINE_STATIC(services); static GHashTable *languages = NULL; G_LOCK_DEFINE_STATIC(languages); static char *proxy_uri = NULL; G_LOCK_DEFINE_STATIC(proxy_uri); static void translate_load_modules (const char *directory); static gboolean translate_load_module (const char *filename, GError **err); GQuark translate_error_quark (void) { return g_quark_from_static_string("translate-error"); } GQuark translate_init_error_quark (void) { return g_quark_from_static_string("translate-init-error"); } /** * translate_init: * @err: a location to report errors, or %NULL. Any of the errors in * #TranslateInitError or other domains may occur. * * Initializes libtranslate. This function can safely be called * multiple times (however, it is not * thread-safe, read below). When it is called more than once, it * returns the status (and error if any) of the initial invocation. * * * Unlike other libtranslate functions, translate_init() is * not thread-safe, and must * not be called while any mutex is held. The * reason is that translate_init() may call g_thread_init(). Refer to * the g_thread_init() documentation for more details. * * * Return value: %TRUE if the initialization was successful, %FALSE * otherwise (in such case @err is set to the error that has * occurred). **/ gboolean translate_init (GError **err) { if (! translate_initialized) { static GError *init_err = NULL; if (! init_err) { #ifdef ENABLE_NLS bindtextdomain(GETTEXT_PACKAGE, LOCALEDIR); bind_textdomain_codeset(GETTEXT_PACKAGE, "UTF-8"); #endif /* ENABLE_NLS */ g_type_init(); if (! g_thread_supported()) g_thread_init(NULL); if (g_thread_supported()) { char *user_modules; translate_initialized = TRUE; languages = g_hash_table_new(translate_ascii_strcase_hash, translate_ascii_strcase_equal); translate_rfc3066_init(languages); translate_load_modules(MODULESDIR); user_modules = g_build_filename(g_get_home_dir(), ".libtranslate", "modules", NULL); translate_load_modules(user_modules); g_free(user_modules); } else init_err = g_error_new(TRANSLATE_INIT_ERROR, TRANSLATE_INIT_ERROR_MULTI_THREADING_NOT_SUPPORTED, _("multi-threading is not supported")); } if (init_err && err) *err = g_error_copy(init_err); } return translate_initialized; } static void translate_load_modules (const char *directory) { GError *err = NULL; GDir *dir; const char *filename; g_return_if_fail(directory != NULL); if (! g_file_test(directory, G_FILE_TEST_IS_DIR)) return; dir = g_dir_open(directory, 0, &err); if (! dir) { g_warning(_("unable to scan modules directory \"%s\": %s"), directory, err->message); g_error_free(err); return; } while ((filename = g_dir_read_name(dir))) { char *pathname; char *extension; pathname = g_build_filename(directory, filename, NULL); if (g_file_test(pathname, G_FILE_TEST_IS_REGULAR) && (extension = strrchr(filename, '.')) && ! strcmp(++extension, G_MODULE_SUFFIX)) { if (! translate_load_module(pathname, &err)) { g_warning(_("unable to load module \"%s\": %s"), pathname, err->message); g_clear_error(&err); } } g_free(pathname); } g_dir_close(dir); } static gboolean translate_load_module (const char *filename, GError **err) { GModule *module; gpointer func; g_return_val_if_fail(filename != NULL, FALSE); module = g_module_open(filename, 0); if (! module) { g_set_error(err, TRANSLATE_ERROR, TRANSLATE_ERROR_FAILED, "%s", g_module_error()); return FALSE; } if (g_module_symbol(module, "translate_module_init", &func)) { if (((TranslateModuleInitFunc) func)(err)) return TRUE; } else g_set_error(err, TRANSLATE_ERROR, TRANSLATE_ERROR_FAILED, _("unable to find translate_module_init() function")); /* failed, close the module */ g_module_close(module); return FALSE; } /** * translate_add_service: * @service: a service. * * Adds @service to the libtranslate service list. If a service with * the same name is already in the list, nothing is done and %FALSE is * returned. * * Return value: %TRUE if the service was added, %FALSE if it was * already in the list. **/ gboolean translate_add_service (TranslateService *service) { const char *name; gboolean added = TRUE; GSList *l; g_return_val_if_fail(TRANSLATE_IS_SERVICE(service), FALSE); name = translate_service_get_name(service); g_return_val_if_fail(name != NULL, FALSE); G_LOCK(services); for (l = services; l != NULL && added; l = l->next) if (! strcmp(translate_service_get_name(l->data), name)) added = FALSE; if (added) services = g_slist_append(services, g_object_ref(service)); G_UNLOCK(services); return added; } /** * translate_get_service: * @name: a service name, encoded in ASCII. * * Looks up a service in the libtranslate service list. * * Return value: a new reference to the service with name @name, or * %NULL if not found. **/ TranslateService * translate_get_service (const char *name) { TranslateService *service = NULL; GSList *l; g_return_val_if_fail(name != NULL, NULL); G_LOCK(services); for (l = services; l != NULL && ! service; l = l->next) if (! strcmp(translate_service_get_name(l->data), name)) service = g_object_ref(l->data); G_UNLOCK(services); return service; } /** * translate_get_services: * * Gets a copy of the libtranslate service list. When no longer * needed, the list should be freed with: * * * g_slist_foreach(list, (GFunc) g_object_unref, NULL); * g_slist_free(list); * * * Return value: a copy of the libtranslate service list. **/ GSList * translate_get_services (void) { GSList *copy; G_LOCK(services); copy = g_slist_copy(services); g_slist_foreach(copy, (GFunc) g_object_ref, NULL); G_UNLOCK(services); return copy; } /** * translate_add_language: * @tag: a RFC 3066 language tag. * @name: the language human-readable name. * * Adds a language tag to name mapping to the libtranslate language * database. If a language with the same tag already exists in the * database, nothing is done and %FALSE is returned. * * * Some RFC 3066 tag to name mappings are built into libtranslate and do not * need to be added. * * * Return value: %TRUE if the language was added, %FALSE if it was * already in the database. **/ gboolean translate_add_language (const char *tag, const char *name) { gboolean added; g_return_val_if_fail(tag != NULL, FALSE); g_return_val_if_fail(name != NULL, FALSE); G_LOCK(languages); if (g_hash_table_lookup(languages, tag)) added = FALSE; else { g_hash_table_insert(languages, g_strdup(tag), g_strdup(name)); added = TRUE; } G_UNLOCK(languages); return added; } /** * translate_get_language_name: * @tag: a RFC 3066 language tag. * * Looks up a language tag in the libtranslate language database, and * returns its human-readable name. * * Return value: the human-readable name of the language with tag * @tag, or @tag itself if not found. If the returned string is not * @tag, it is owned by libtranslate and must not be modified or * freed. **/ const char * translate_get_language_name (const char *tag) { const char *name; g_return_val_if_fail(tag != NULL, NULL); G_LOCK(languages); /* * We do not return a copy of the name (less overhead and * thread-safe, because once a language is added in the hash, it * cannot be removed). */ name = g_hash_table_lookup(languages, tag); G_UNLOCK(languages); return name ? name : tag; } /** * translate_set_proxy: * @uri: the URI of a proxy server, or %NULL to unset. * * Sets the URI of a proxy server to use for network transfers. **/ void translate_set_proxy (const char *uri) { G_LOCK(proxy_uri); g_free(proxy_uri); proxy_uri = g_strdup(uri); G_UNLOCK(proxy_uri); } /** * translate_get_proxy: * * Gets the URI thas has been previously set with * translate_set_proxy(). * * If you are implementing a service, you must * use this URI for proxying network transfers. * * Return value: the libtranslate proxy URI, or %NULL if no proxy is * set. The returned string should be freed when no longer needed. **/ char * translate_get_proxy (void) { char *copy; G_LOCK(proxy_uri); copy = g_strdup(proxy_uri); G_UNLOCK(proxy_uri); return copy; } libtranslate-0.99/src/test-util.c000644 001750 001750 00000010471 10172765565 020603 0ustar00jylefortjylefort000000 000000 /* * Copyright (C) 2005 Jean-Yves Lefort * All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in the * documentation and/or other materials provided with the distribution. * 3. Neither the name of Jean-Yves Lefort nor the names of its contributors * may be used to endorse or promote products derived from this software * without specific prior written permission. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND * CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, * INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF * MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE * DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS * BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, * EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED * TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON * ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, * OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY * OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE * POSSIBILITY OF SUCH DAMAGE. */ #include #include #include "translate.h" #define FAIL \ { \ g_printerr("failure at %s\n", G_STRLOC); \ exit(1); \ } int main (int argc, char **argv) { const char *str; if (translate_ascii_strcase_equal("string", "otherstring")) FAIL; if (! translate_ascii_strcase_equal("string", "sTrInG")) FAIL; if (translate_ascii_strcase_hash("string") == translate_ascii_strcase_hash("otherstring")) FAIL; if (translate_ascii_strcase_hash("string") != translate_ascii_strcase_hash("sTrInG")) FAIL; str = "some string"; if (translate_ascii_strcasestr(str, "sTrInG") != str + 5) FAIL; if (translate_ascii_strcasestr(str, "none") != NULL) FAIL; if (translate_ascii_strcasestr_len(str, 4, "sTriNg") != NULL) FAIL; if (translate_ascii_strcasecoll("string", "sTrInG") != 0) FAIL; if (! translate_ascii_strcasecoll("string", "A_lesserstring") < 0) FAIL; if (! translate_ascii_strcasecoll("string", "Z_greaterstring") > 0) FAIL; if (translate_utf8_strcasecoll("string-é", "string-É") != 0) FAIL; if (! translate_utf8_strcasecoll("string-é", "A_lesserstring-é") < 0) FAIL; if (! translate_utf8_strcasecoll("string-é", "Z_greaterstring-é") > 0) FAIL; if (translate_utf8_strcmp("string-é", "string-é") != 0) FAIL; if (! translate_utf8_strcmp("string-é", "a_lesserstring-é") < 0) FAIL; if (! translate_utf8_strcmp("string-é", "z_greaterstring-é") > 0) FAIL; if (translate_utf8_strcasecmp("string-é", "string-É") != 0) FAIL; if (! translate_utf8_strcasecmp("string-é", "A_lesserstring-é") < 0) FAIL; if (! translate_utf8_strcasecmp("string-é", "Z_greaterstring-é") > 0) FAIL; str = "string-é"; if (translate_utf8_strpbrk(str, -1, "èé") != str + 7) FAIL; str = "é-string-è"; if (translate_utf8_strpbrk(str, 4, "è") != NULL) FAIL; str = "é-string-é"; if (translate_utf8_strrpbrk(str, -1, "èé") != str + 10) FAIL; str = "é-string-è"; if (translate_utf8_strrpbrk(str, 4, "è") != NULL) FAIL; if (translate_time() < 0) FAIL; if (strcmp(translate_sgml_ref_expand("<tag>"), "") != 0) FAIL; if (strcmp(translate_sgml_ref_expand("ABC"), "ABC") != 0) FAIL; if (strcmp(translate_sgml_ref_expand("ABC"), "ABC") != 0) FAIL; if (strcmp(translate_sgml_ref_expand("ABC"), "ABC") != 0) FAIL; if (strcmp(translate_sgml_ref_expand("ABC"), "ABC") != 0) FAIL; if (strcmp(translate_sgml_ref_expand("<tag> &unknown;"), " &unknown;") != 0) FAIL; if (strcmp(translate_sgml_ref_expand("<tag> &unknown end"), " &unknown end") != 0) FAIL; g_print("+++ TEST-UTIL PASSED\n"); return 0; } libtranslate-0.99/src/translate-cli.c000644 001750 001750 00000034356 10172766220 021410 0ustar00jylefortjylefort000000 000000 /* * Copyright (C) 2004, 2005 Jean-Yves Lefort * All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in the * documentation and/or other materials provided with the distribution. * 3. Neither the name of Jean-Yves Lefort nor the names of its contributors * may be used to endorse or promote products derived from this software * without specific prior written permission. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND * CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, * INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF * MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE * DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS * BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, * EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED * TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON * ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, * OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY * OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE * POSSIBILITY OF SUCH DAMAGE. */ #include "config.h" #include #include #include #include #include #include #include #include #include #include "translate.h" static void translate_cli_fatal (const char *format, ...) G_GNUC_NORETURN G_GNUC_PRINTF(1, 2); static void translate_cli_print_help (void); static void translate_cli_print_version (void); static void translate_cli_list_services (void); static void translate_cli_list_pairs (TranslateSession *session, const char *from, const char *to); static void translate_cli_translate (TranslateSession *session, const char *from, const char *to, const char *arg); static void translate_cli_translate_text (TranslateSession *session, const char *from, const char *to, const char *filename, gboolean tty); static void translate_cli_translate_web_page (TranslateSession *session, const char *from, const char *to, const char *url, gboolean tty); static gboolean translate_cli_progress_cb (double progress, gpointer user_data); int main (int argc, char **argv) { int c; char mode = 0; /* translate */ char *services = NULL; char *from = NULL; char *to = NULL; gboolean set_max_threads = FALSE; unsigned int max_threads; gboolean set_max_retries = FALSE; int max_retries; #define OPT_HELP '?' #define OPT_HELP_S "?" #define OPT_VERSION 'v' #define OPT_VERSION_S "v" #define OPT_LIST_SERVICES '1' #define OPT_SERVICES 's' #define OPT_SERVICES_S "s" #define OPT_FROM 'f' #define OPT_FROM_S "f" #define OPT_TO 't' #define OPT_TO_S "t" #define OPT_LIST_PAIRS 'l' #define OPT_LIST_PAIRS_S "l" #define OPT_MAX_THREADS '2' #define OPT_MAX_RETRIES '3' const struct option options[] = { { "help", no_argument, NULL, OPT_HELP }, { "version", no_argument, NULL, OPT_VERSION }, { "list-services", no_argument, NULL, OPT_LIST_SERVICES }, { "services", required_argument, NULL, OPT_SERVICES }, { "from", required_argument, NULL, OPT_FROM }, { "to", required_argument, NULL, OPT_TO }, { "list-pairs", no_argument, NULL, OPT_LIST_PAIRS }, { "max-threads", required_argument, NULL, OPT_MAX_THREADS }, { "max-retries", required_argument, NULL, OPT_MAX_RETRIES }, { NULL, 0, NULL, 0 } }; g_set_prgname(argc > 0 ? argv[0] : "translate"); setlocale(LC_ALL, ""); /* use user's locale */ #ifdef ENABLE_NLS bindtextdomain(GETTEXT_PACKAGE, LOCALEDIR); bind_textdomain_codeset(GETTEXT_PACKAGE, "UTF-8"); textdomain(GETTEXT_PACKAGE); #endif while ((c = getopt_long(argc, argv, OPT_HELP_S OPT_VERSION_S OPT_SERVICES_S ":" OPT_FROM_S ":" OPT_TO_S ":" OPT_LIST_PAIRS_S, options, NULL)) != -1) switch (c) { case OPT_HELP: case OPT_VERSION: case OPT_LIST_SERVICES: case OPT_LIST_PAIRS: mode = c; break; case OPT_SERVICES: g_free(services); services = g_strdup(optarg); break; case OPT_FROM: g_free(from); from = g_strdup(optarg); break; case OPT_TO: g_free(to); to = g_strdup(optarg); break; case OPT_MAX_THREADS: set_max_threads = TRUE; max_threads = atoi(optarg); break; case OPT_MAX_RETRIES: set_max_retries = TRUE; max_retries = atoi(optarg); break; default: g_assert_not_reached(); } argc -= optind; argv += optind; if (argc > (mode ? 0: 1)) translate_cli_fatal(_("too many arguments")); if (mode == OPT_HELP) translate_cli_print_help(); else if (mode == OPT_VERSION) translate_cli_print_version(); else { GError *err = NULL; const char *http_proxy; if (! translate_init(&err)) translate_cli_fatal(_("unable to initialize libtranslate: %s"), err->message); http_proxy = g_getenv("HTTP_PROXY"); if (! http_proxy) http_proxy = g_getenv("http_proxy"); translate_set_proxy(http_proxy); if (mode == OPT_LIST_SERVICES) translate_cli_list_services(); else { GSList *list = NULL; TranslateSession *session; if (services) { char **vector; int i; vector = g_strsplit(services, ",", 0); for (i = 0; vector[i]; i++) { TranslateService *service; service = translate_get_service(vector[i]); if (! service) translate_cli_fatal(_("unknown service \"%s\""), vector[i]); list = g_slist_append(list, service); } g_strfreev(vector); } else list = translate_get_services(); session = translate_session_new(list); g_slist_foreach(list, (GFunc) g_object_unref, NULL); g_slist_free(list); if (set_max_threads) translate_session_set_max_threads(session, max_threads); if (set_max_retries) translate_session_set_max_retries(session, max_retries); if (mode == OPT_LIST_PAIRS) translate_cli_list_pairs(session, from, to); else translate_cli_translate(session, from, to, argc == 1 ? argv[0] : NULL); g_object_unref(session); } } /* on some systems, the return value of main() is ignored */ exit(0); return 0; } static void translate_cli_fatal (const char *format, ...) { va_list args; char *message; g_assert(format != NULL); va_start(args, format); message = g_strdup_vprintf(format, args); va_end(args); g_printerr("%s: %s\n", g_get_prgname(), message); g_free(message); exit(1); } static void translate_cli_print_help (void) { g_print("%s\n", _("Synopsis:")); g_print(" %s {-? | -v | --list-services}\n", g_get_prgname()); g_print(" %s [-s SERVICES] [-f LANG] [-t LANG] -l\n", g_get_prgname()); g_print(" %s [-s SERVICES] [-f LANG] [-t LANG] {HTTP_URL | HTTPS_URL}\n", g_get_prgname()); g_print(" %s [-s SERVICES] [-f LANG] [-t LANG] [--max-threads=N] [--max-retries=N] [FILE]\n", g_get_prgname()); g_print("\n"); g_print("%s\n", _("Options:")); g_print(" -?, --help %s\n", _("Show this help")); g_print(" -v, --version %s\n", _("Show version information")); g_print(" --list-services %s\n", _("List the available services")); g_print(" -s, --services=SERVICES %s\n", _("Specify the list of services to use")); g_print(" -f, --from=LANG %s\n", _("Specify the source language")); g_print(" -t, --to=LANG %s\n", _("Specify the destination language")); g_print(" -l, --list-pairs %s\n", _("List the available language pairs")); g_print(" --max-threads=N %s\n", _("Specify the maximum number of threads to use")); g_print(" --max-retries=N %s\n", _("Specify the maximum number of retries per chunk")); } static void translate_cli_print_version (void) { g_print(_("%s version %s\n"), "translate", VERSION); g_print("Copyright (C) 2004, 2005 Jean-Yves Lefort\n"); } static void translate_cli_list_services (void) { GSList *l; GSList *services; services = translate_get_services(); for (l = services; l != NULL; l = l->next) g_print("%s (%s)\n", translate_service_get_name(l->data), translate_service_get_nick(l->data)); g_slist_foreach(services, (GFunc) g_object_unref, NULL); g_slist_free(services); } static void translate_cli_list_pairs (TranslateSession *session, const char *from, const char *to) { GSList *pairs; GSList *l; g_return_if_fail(TRANSLATE_IS_SESSION(session)); pairs = translate_session_get_pairs(session); pairs = translate_pairs_sort_by_name(pairs); for (l = pairs; l != NULL; l = l->next) { TranslatePair *pair = l->data; const char *pair_from = translate_pair_get_from(pair); const char *pair_to = translate_pair_get_to(pair); if ((! from || ! g_ascii_strcasecmp(from, pair_from)) && (! to || ! g_ascii_strcasecmp(to, pair_to))) { TranslatePairFlags flags = translate_pair_get_flags(pair); g_print("%s (%s) -> %s (%s): %s\n", pair_from, translate_get_language_name(pair_from), pair_to, translate_get_language_name(pair_to), (flags & TRANSLATE_PAIR_TEXT && flags & TRANSLATE_PAIR_WEB_PAGE) ? _("text, web page") : ((flags & TRANSLATE_PAIR_TEXT) ? _("text") : ((flags & TRANSLATE_PAIR_WEB_PAGE) ? _("web page") : ""))); } } g_slist_foreach(pairs, (GFunc) g_object_unref, NULL); g_slist_free(pairs); } static void translate_cli_translate (TranslateSession *session, const char *from, const char *to, const char *arg) { const char *var; char *default_from; char *default_to; gboolean tty; var = g_getenv("TRANSLATE_DEFAULT_FROM"); default_from = g_strdup(var ? var : "en"); var = g_getenv("TRANSLATE_DEFAULT_TO"); default_to = g_strdup(var ? var : "fr"); if (! from) from = ! to || g_ascii_strcasecmp(to, default_from) ? default_from : default_to; if (! to) to = ! from || g_ascii_strcasecmp(from, default_to) ? default_to : default_from; tty = isatty(fileno(stderr)); if (arg && (g_str_has_prefix(arg, "http://") || g_str_has_prefix(arg, "https://"))) translate_cli_translate_web_page(session, from, to, arg, tty); else translate_cli_translate_text(session, from, to, arg, tty); g_free(default_from); g_free(default_to); } static void translate_cli_translate_text (TranslateSession *session, const char *from, const char *to, const char *filename, gboolean tty) { FILE *file; char buf[4096]; GString *string; size_t len; char *converted; char *translated; GError *err = NULL; g_return_if_fail(TRANSLATE_IS_SESSION(session)); g_return_if_fail(from != NULL); g_return_if_fail(to != NULL); if (filename && strcmp(filename, "-")) { file = fopen(filename, "r"); if (! file) translate_cli_fatal(_("unable to open \"%s\": %s"), filename, g_strerror(errno)); } else file = stdin; string = g_string_new(NULL); while ((len = fread(buf, 1, sizeof(buf), file))) g_string_append_len(string, buf, len); if (ferror(file)) { if (file == stdin) translate_cli_fatal(_("unable to read from standard input: %s"), g_strerror(errno)); else translate_cli_fatal(_("unable to read from \"%s\": %s"), filename, g_strerror(errno)); } if (file != stdin) fclose(file); if (g_utf8_validate(string->str, -1, NULL)) converted = g_string_free(string, FALSE); else { converted = g_locale_to_utf8(string->str, -1, NULL, NULL, &err); g_string_free(string, TRUE); if (! converted) translate_cli_fatal(_("unable to convert input text to UTF-8: %s"), err->message); } if (tty) g_printerr("[%77c]", ' '); translated = translate_session_translate_text(session, converted, from, to, tty ? translate_cli_progress_cb : NULL, NULL, &err); g_free(converted); if (tty) g_printerr("\r%79c\r", ' '); if (translated) { g_print("%s", translated); g_free(translated); } else translate_cli_fatal(_("unable to translate: %s"), err->message); } static void translate_cli_translate_web_page (TranslateSession *session, const char *from, const char *to, const char *url, gboolean tty) { char *translated_url; GError *err = NULL; g_return_if_fail(TRANSLATE_IS_SESSION(session)); g_return_if_fail(from != NULL); g_return_if_fail(to != NULL); g_return_if_fail(url != NULL); if (tty) g_printerr("[%77c]", ' '); translated_url = translate_session_translate_web_page(session, url, from, to, tty ? translate_cli_progress_cb : NULL, NULL, &err); if (tty) g_printerr("\r%79c\r", ' '); if (translated_url) { g_print("%s\n", translated_url); g_free(translated_url); } else translate_cli_fatal(_("unable to get URL of translated web page: %s"), err->message); } static gboolean translate_cli_progress_cb (double progress, gpointer user_data) { int i; g_printerr("\r["); if (progress < 0) { static int pre_spaces = 0; static int direction = 1; int post_spaces; switch (direction) { case 1: if (pre_spaces + 1 > 74) direction = -1; break; case -1: if (pre_spaces - 1 < 0) direction = 1; break; } switch (direction) { case 1: pre_spaces++; break; case -1: pre_spaces--; break; } post_spaces = 74 - pre_spaces; for (i = 0; i < pre_spaces; i++) g_printerr(" "); g_printerr("###"); for (i = 0; i < post_spaces; i++) g_printerr(" "); } else { int n_dashes; int n_spaces; n_dashes = progress * 77; n_spaces = 77 - n_dashes; for (i = 0; i < n_dashes; i++) g_printerr("#"); for (i = 0; i < n_spaces; i++) g_printerr(" "); } g_printerr("]"); return TRUE; /* continue */ } libtranslate-0.99/src/xhtml-lat1.ent000644 001750 001750 00000027015 10161371573 021200 0ustar00jylefortjylefort000000 000000 libtranslate-0.99/src/xhtml-special.ent000644 001750 001750 00000010050 10161371573 021746 0ustar00jylefortjylefort000000 000000 libtranslate-0.99/src/xhtml-symbol.ent000644 001750 001750 00000033457 10161371573 021653 0ustar00jylefortjylefort000000 000000 libtranslate-0.99/src/ent2h.sh000755 001750 001750 00000004203 10172765510 020046 0ustar00jylefortjylefort000000 000000 #!/bin/sh # # ent2h.sh - convert one or more SGML entity sets to a C header # # Copyright (C) 2004 Jean-Yves Lefort # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. Neither the name of Jean-Yves Lefort nor the names of its contributors # may be used to endorse or promote products derived from this software # without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND # CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, # INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE # DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS # BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, # EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED # TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON # ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, # OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY # OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. cat < Copyright (C) 19yy This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA Also add information on how to contact you by electronic and paper mail. If the program is interactive, make it output a short notice like this when it starts in an interactive mode: Gnomovision version 69, Copyright (C) 19yy name of author Gnomovision comes with ABSOLUTELY NO WARRANTY; for details type `show w'. This is free software, and you are welcome to redistribute it under certain conditions; type `show c' for details. The hypothetical commands `show w' and `show c' should show the appropriate parts of the General Public License. Of course, the commands you use may be called something other than `show w' and `show c'; they could even be mouse-clicks or menu items--whatever suits your program. You should also get your employer (if you work as a programmer) or your school, if any, to sign a "copyright disclaimer" for the program, if necessary. Here is a sample; alter the names: Yoyodyne, Inc., hereby disclaims all copyright interest in the program `Gnomovision' (which makes passes at compilers) written by James Hacker. , 1 April 1989 Ty Coon, President of Vice This General Public License does not permit incorporating your program into proprietary programs. If your program is a subroutine library, you may consider it more useful to permit linking proprietary applications with the library. If this is what you want to do, use the GNU Library General Public License instead of this License. libtranslate-0.99/src/sample-text.expected000644 001750 001750 00000046572 10167065115 022472 0ustar00jylefortjylefort000000 000000 Version 2, Juin 1991 de PERMIS De GRAND PUBLIC de Gnu Garantissez les droits d'auteur (c) 1989, La Base Libre Du Logiciel 1991, Inc.. l'endroit de 59 temples, la suite 330, Boston, mA 02111-1307 Etats-Unis chacun est autorisé pour copier et distribuer les copies in extenso de ce document de permis, mais le changer n'est pas permis. Préambule Les permis pour la plupart de logiciel sont conçus pour emporter votre liberté pour la partager et changer. En revanche, le permis de grand public de GNU est prévu de garantir votre liberté pour partager et logiciel de changement librement -- s'assurer le logiciel est libre pour tous ses utilisateurs. Ce permis de grand public s'applique à la majeure partie du logiciel libre du logiciel Foundation's et à n'importe quel autre programme dont les auteurs commettent à l'employer. (un autre logiciel libre de base de logiciel est couvert par le permis de grand public de bibliothèque de GNU à la place.) Vous pouvez vous appliquer l'à vos programmes, aussi. Quand nous parlons du logiciel libre, nous nous référons à la liberté, pour ne pas évaluer. Nos permis de grand public sont conçus de s'assurer que vous avez la liberté pour distribuer des copies de logiciel libre (et facturer ce service si vous souhait), que vous recevez le code source ou pouvez l'obtenir si vous le voulez, que vous puissiez changer le logiciel ou employer des morceaux de lui dans de nouveaux programmes libres ; et cela que vous savez que vous pouvez faire ces choses. Pour protéger vos droites, nous devons faire les restrictions qui interdisent n'importe qui de vous refuser ces droites ou de vous demander de rendre les droites. Ces restrictions traduisent à certaines responsabilités de vous si vous distribuez des copies du logiciel, ou si vous le modifiez. Par exemple, si vous distribuez des copies d'un tel programme, si gratuitement ou pour des honoraires, vous devez donner aux destinataires tous les droits que vous avez. Vous devez vous assurer qu'ils, aussi, recevez ou pouvez obtenir le code source. Et vous devez leur montrer ces limites ainsi elles savent leurs droites. Nous protégeons vos droites avec deux étapes : (1) garantissent les droits d'auteur le logiciel, et (2) l'offre vous ce permis qui vous donne la permission légale de copier, distribuer et/ou modifier le logiciel. En outre, pour chaque protection d'author's et le nôtre, nous voulons nous assurer que chacun comprend qu'il n'y a aucune garantie pour ce logiciel libre. Si le logiciel est modifié par quelqu'un d'autre et transmis, nous voulons que ses destinataires sachent que ce qu'elles ont n'est pas l'original, de sorte qu'aucun problème présenté par d'autres ne réfléchisse sur l'authors' original ; réputations. En conclusion, n'importe quel programme libre est menacé constamment par des brevets de logiciel. Nous souhaitons éviter le danger que les redistributors d'un programme libre obtiendront individuellement des permis de brevet, en effet faisant la classe des propriétaires de programme. Pour empêcher ceci, nous avons indiqué clairement que n'importe quel brevet doit être autorisé pour everyone's emploient librement ou non autorisé du tout. Les modalités et les conditions précises pour copier, distribution et modification suivent. MODALITÉS ET CONDITIONS DE PERMIS DE GRAND PUBLIC DE GNU POUR COPIER, DISTRIBUTION ET MODIFICATION 0. Ce permis s'applique à n'importe quel programme ou l'autre travail qui contient une notification placée par le support de copyright indiquant il peut être distribué en vertu de ce permis de grand public. Le "Program" ;, au-dessous de, se rapporte à un tel programme ou travail, et à un "work basé sur le Program" ; signifie le programme ou n'importe quel travail dérivé en vertu de la loi de copyright : c'est-à-dire, un travail contenant le programme ou une partie d'elle, in extenso ou avec des modifications et/ou traduit en une autre langue. (ci-après, la traduction est incluse sans limitation dans le "modification" de limite ;.) Chaque concessionnaire est adressé comme "you" ;. Des activités autres que copier, distribution et modification ne sont pas couvertes par ce permis ; elles sont en dehors de sa portée. L'acte d'exécuter le programme n'est pas restreint, et le rendement du programme est couvert seulement si son contenu constitue un travail basé sur le programme (indépendant de l'fabrication en exécutant le programme). Si c'est vrai dépend de ce que le programme . 1. Vous pouvez copier et distribuer les copies in extenso du code source de Program's comme vous le recevez, dans n'importe quel milieu, à condition que vous éditez clairement et convenablement sur chaque copie une notification de copyright et un déni appropriés de garantie ; gardez intact toutes les notices qui se rapportent à ce permis et à l'absence de n'importe quelle garantie ; et donnez à tous les autres destinataires du programme une copie de ce permis avec le programme. Vous pouvez charger des honoraires pour l'acte de transfert physique d'une copie, et vous pouvez à votre protection de garantie d'offre d'option en échange des honoraires. 2. Vous pouvez modifier votre copie ou copies du programme ou de n'importe quelle partie d'elle, de ce fait formant un travail basé sur le programme, et la copie et distribuer une telle modifications ou travail en vertu de la section 1 ci-dessus, à condition que vous rencontriez également toutes ces conditions : a) Vous devez faire porter les dossiers modifiés les notices en avant déclarant que vous avez changé les dossiers et la date de n'importe quel changement. b) Vous devez causer n'importe quel travail que vous distribuez ou éditez, celui entièrement ou partiellement contient ou est dérivé du programme ou de n'importe quelle partie en, pour être autorisé dans l'ensemble à aucune charge à tous les tiers en vertu de ce permis. c) Si le programme modifié lit normalement des commandes interactivement une fois exécuté, vous doit le causer, quand courir commencé pour un tel usage interactif de la manière la plus ordinaire, d'imprimer ou montrer une annonce comprenant une notification de copyright appropriée et une notification qu'il n'y a aucune garantie (ou bien, dire que vous fournissez une garantie) et que les utilisateurs peuvent redistribuer le programme dans ces conditions, et disant à l'utilisateur comment regarder une copie de ce permis. (exception : si le programme lui-même est interactif mais n'imprime pas normalement une telle annonce, votre travail basé sur le programme n'est pas exigé pour imprimer une annonce.) Ces conditions s'appliquent au travail modifié dans l'ensemble. Si des sections identifiables de ce travail ne sont pas dérivées du programme, et peuvent être raisonnablement considérées indépendant et séparer des travaux dans elles-mêmes, alors ce permis, et ses limites, ne s'appliquent pas à sections quand vous les distribuez en tant que travaux séparés. Mais quand vous distribuez les mêmes sections en tant qu'élément d'une totalité qui est un travail basé sur le programme, la distribution du tout doit être aux conditions de ce permis, dont les permissions pour d'autres concessionnaires se prolongent à l'entier entier, et ainsi à chaque partie indépendamment de qui l'a écrite. Ainsi, ce n'est pas l'intention de cette section pour revendiquer des droits ou pour contester vos droites au travail écrit entièrement par vous ; plutôt, l'intention est d'exercer la droite de commander la distribution des travaux dérivés ou collectifs basés sur le programme. En outre, la seule agrégation d'un autre travail non basé sur le programme avec le programme (ou avec un travail basé sur le programme) sur un volume d'un milieu de stockage ou de distribution n'apporte pas l'autre travail sous la portée de ce permis. 3. Vous pouvez copier et distribuer le programme (ou un travail basé sur lui, sous section 2) sous le code d'objet ou la forme exécutable en vertu de sections 1 et 2 ci-dessus à condition que vous fassiez également un de ce qui suit : a) Accompagnez-le du code source compréhensible par une machine correspondant complet, qui doit être distribué en vertu des sections 1 et 2 ci-dessus sur un milieu d'habitude utilisé pour l'échange de logiciel ; ou, b) Accompagnez-le d'une offre écrite, valable au moins trois années, pour donner n'importe quel tiers, pour une charge pas plus que votre coût d'effectuer physiquement la distribution de source, une copie compréhensible par une machine complète du code source correspondant, pour être distribué en vertu des sections 1 et 2 ci-dessus sur un milieu d'habitude utilisé pour l'échange de logiciel ; ou, c) Accompagnez-le de l'information que vous avez reçu quant à l'offre pour distribuer le code source correspondant. (on permet cette alternative seulement pour la distribution non commerciale et seulement si vous receviez le programme sous le code d'objet ou la forme exécutable avec une telle offre, en accord avec la sous-section b ci-dessus.) Le code source pour un travail signifie la forme préférée du travail pour faire des modifications à lui. Pour un travail exécutable, le code source complet signifie tout le code source pour tous les modules qu'il contient, plus tous les dossiers associés de définition d'interface, plus les manuscrits employés pour commander la compilation et l'installation de l'exécutable. Cependant, comme exception spéciale, le code source distribué n'a pas besoin d'inclure tout ce qui est normalement distribué (sous la source ou la forme binaire) avec les composants principaux (compilateur, grain, et ainsi de suite) du logiciel d'exploitation sur lequel les courses exécutables, à moins que ce composant lui-même accompagne l'exécutable. Si la distribution d'exécutable ou code d'objet est faite en offrant l'accès à la copie à partir d'un endroit indiqué, alors l'accès équivalent d'offre pour copier le code source du même endroit compte comme distribution du code source, quoique des tiers ne soient pas obligés pour copier la source avec le code d'objet. 4. Vous ne pouvez pas copier, modifier, sublicense, ou distribuer le programme à moins que comme expressément fourni sous ce permis. En essayent autrement de copier, modifier, le sublicense ou distribuer le programme est vide, et terminera automatiquement vos droites sous ce permis. Cependant, les parties qui ont reçu des copies, ou les droites, de vous sous ce permis n'auront pas leurs permis terminées à condition que de telles parties demeurent dans la totale conformité. 5. Vous n'êtes pas requis d'accepter ce permis, puisque vous démuni l'avez signé. Cependant, rien autrement concessions vous permission de modifier ou distribuer le programme ou ses travaux dérivés. Ces actions sont interdites par loi si vous n'acceptez pas ce permis. Par conséquent, en modifiant ou en distribuant le programme (ou tout travail basé sur le programme), vous indiquez votre acceptation de ce permis de faire ainsi, et toutes ses modalités et conditions pour copier, distribuer ou modifier le programme ou les travaux basés sur lui. 6. Chaque fois que vous redistribuez le programme (ou tout travail basé sur le programme), le destinataire reçoit automatiquement un permis du concesseur original de copier, distribue ou modifie le programme sujet à ces modalités et conditions. Vous ne pouvez pas imposer toute autre restriction au recipients' ; l'exercice des droites a accordé ci-dessus. Vous n'êtes pas responsable d'imposer la conformité par les tiers à ce permis. 7. Si, par suite d'un jugement de la Cour ou d'une allégation de contrefaçon ou pour n'importe quelle autre raison (non limitée aux issues de brevet), des conditions sont imposées à vous (par ordre de cour, accord ou autrement) qui contredisent les conditions de ce permis, ils ne vous excusent pas des conditions de ce permis. Si vous ne pouvez pas distribuer afin de satisfaire simultanément vos engagements sous ce permis et aucun autre engagement convenable, alors par conséquent vous ne pouvez pas distribuer le programme du tout. Par exemple, si un permis de brevet ne permettrait pas la redistribution redevance-libre du programme par tout ceux qui reçoivent des copies directement ou indirectement par vous, alors la seule manière vous pourriez satisfaire tous les deux il et ce permis devrait s'abstenir entièrement à la distribution du programme. Si n'importe quelle partie de cette section est jugée de dessous inadmissible ou inapplicable n'importe quelle circonstance particulière, l'équilibre de la section est prévu pour s'appliquer et la section dans l'ensemble est prévue pour s'appliquer dans d'autres circonstances. Ce n'est pas le but de cette section de vous induire ne violer aucun brevet ou d'autres réclamations de droite de propriété ou contester la validité d'des telles réclamations ; cette section a le but unique de protéger l'intégrité du système libre de distribution de logiciel, qui est mis en application par des pratiques en matière publiques de permis. Beaucoup de gens ont apporté les contributions généreuses à l'éventail de logiciel distribué par ce système dans la confiance sur à application conformée de ce système ; il appartient à l'author/donor pour décider si lui ou elle est disposée à distribuer le logiciel par n'importe quel autre système et un concessionnaire ne peut pas imposer ce choix. Cette section est prévue pour rendre complètement clair on pense que ce qui est une conséquence du reste de ce permis. 8. Si la distribution et/ou l'utilisation du programme est limitée dans certains pays par des brevets ou par les interfaces garanties les droits d'auteur, le support original de copyright qui place le programme sous ce permis peut ajouter une limitation explicite de répartition géographique à l'exclusion de ces pays, de sorte que la distribution soit autorisée seulement dans ou parmi des pays exclus pas ainsi. Dans un tel cas, ce permis incorpore la limitation comme si écrit dans le corps de ce permis. 9. La base libre de logiciel peut éditer révisé et/ou les nouvelles versions du grand public autorisent de temps en temps. De telles nouvelles versions seront semblables dans l'esprit à la présente version, mais peuvent différer en détail pour adresser de nouveaux problèmes ou soucis. Chaque version est donnée un nombre de version de distinction. Si le programme indique un nombre de version de ce permis qui s'applique à lui et au version" postérieur "any ;, vous avez l'option de suivre les modalités et les conditions l'une ou l'autre de cette version ou de n'importe quelle version postérieure éditée par la base libre de logiciel. Si le programme n'indique pas un nombre de version de ce permis, vous pouvez choisir n'importe quelle version jamais éditée par la base libre de logiciel. 10. Si vous souhaitez incorporer des parties du programme à d'autres programmes libres dont les états de distribution sont différents, écrivez à l'auteur pour demander la permission. Pour le logiciel qui est garanti les droits d'auteur par la base libre de logiciel, écrivez à la base libre de logiciel ; nous faisons parfois des exceptions pour ceci. Notre décision sera guidée par les deux buts de préserver le statut libre de tous les dérivés de notre logiciel libre et de favoriser le partage et la réutilisation du logiciel généralement. AUCUNE GARANTIE 11. PUISQUE LE PROGRAMME EST AUTORISÉ GRATUITEMENT, IL N'Y A AUCUNE GARANTIE POUR LE PROGRAMME, JUSQU'AU DEGRÉ AUTORISÉ PAR APPLICABLE LAW. EXCEPTÉ UNE FOIS AUTREMENT INDIQUÉ EN ÉCRIVANT LES SUPPORTS de COPYRIGHT ET/OU D'AUTRES PARTIES FOURNISSEZ Les "AS IS" de PROGRAMME ; SANS GARANTIE De la SORTE, EXPRIMÉE OU IMPLICITE, Y COMPRIS, MAIS NON LIMITÉE À, GARANTIES IMPLICITES De VALEUR MARCHANDE ET FORME PHYSIQUE POUR Un BUT PARTICULIER. LE RISQUE ENTIER QUANT À LA QUALITÉ ET À L'EXÉCUTION DU PROGRAMME EST AVEC VOUS. SI LE PROGRAMME PROUVE DÉFECTUEUX, VOUS ASSUMEZ LE COÛT DE TOUTE L'ENTRETIEN, RÉPARATION OU CORRECTION NÉCESSAIRE. 12. DANS AUCUN CAS À MOINS QUE REQUIS PAR APPLICABLE LAW OU AGREED D'ACCORD SUR DANS L'ÉCRITURE VOULEZ N'IMPORTE QUEL SUPPORT De COPYRIGHT, OU N'IMPORTE QUELLE AUTRE OMS De PARTIE PEUT MODIFIER ET/OU REDISTRIBUER Le PROGRAMME COMME AUTORISÉ CI-DESSUS, SOIT EXPOSÉE À VOUS POUR Des DOMMAGES, Y COMPRIS Des DOMMAGES GÉNÉRAUX, SPÉCIAUX, FORTUITS OU CONSÉCUTIFS PROVENANT De l'UTILISATION OU L'INCAPACITÉ D'EMPLOYER Le PROGRAMME (Y COMPRIS MAIS NON LIMITÉ À la PERTE De DONNÉES OU DONNÉES ÉTANT RENDUES IMPRÉCISES OU PERTES SOUTENUES PAR VOUS OU Les TIERS OU Un MANQUE Du PROGRAMME DE FONCTIONNER AVEC TOUS AUTRES PROGRAMMES), MÊME SI UN TEL SUPPORT OU L'AUTRE PARTIE A ÉTÉ CONSEILLÉE De la POSSIBILITÉ De TELS DOMMAGES. FIN DES MODALITÉS ET DES CONDITIONS Comment s'appliquer ces limites à vos nouveaux programmes Si vous développez un nouveau programme, et vous voulez qu'il soit utile plus grand possible au public, la meilleure manière de réaliser ceci est de lui faire le logiciel libre que chacun peut redistribuer et changer en vertu de ces conditions. Pour faire ainsi, attachez les notices suivantes au programme. Il est le plus sûr de les attacher au début de chaque fichier source pour donner le plus efficacement l'exclusion de la garantie ; et chaque dossier devrait avoir au moins le "copyright" ; rayez et un indicateur à où la pleine notification est trouvée. Vous devriez avoir reçu une copie du permis de grand public de GNU avec ce programme ; si pas, écrivez à Free Software Foundation, Inc., endroit de 59 temples, la suite 330, Boston, mA 02111-1307 Etats-Unis Ajoutez en outre l'information sur la façon dont vous contacter par courrier électronique et de papier. Si le programme est interactif, faites-le produire une notification courte comme ceci quand elle commence en mode interactif : La version 69, nom de Gnomovision de copyright (c) 19yy d'auteur Gnomovision vient avec ABSOLUMENT AUCUNE GARANTIE ; pour le type exposition w' de détails de ` ;. C'est logiciel libre, et vous êtes bienvenu pour le redistribuer dans certaines conditions ; dactylographiez l'exposition c' de ` ; pour des détails. L'exposition hypothétique w' de ` de commandes ; et exposition c' de ` ; si l'exposition les parties appropriées du grand public autorisent. Naturellement, les commandes que vous employez peuvent s'appeler quelque chose autre que l'exposition w' de ` ; et exposition c' de ` ; ; elles pourraient même être des articles de mouse-clic ou de menu -- quelque costumes votre programme. Vous devriez également obliger votre employeur (si vous travaillez comme programmeur) ou votre école, le cas échéant, à signer un disclaimer" de "copyright ; pour le programme, au besoin. Voici un échantillon ; changez les noms : Yoyodyne, Inc., dément par ceci tout l'intérêt de copyright pour le ` Gnomovision' de programme ; (qui fait des passages aux compilateurs) écrit par l'intrus de James. , ragondin de 1 avril 1989 Ty, président de vice Ce permis de grand public ne laisse pas incorporer votre programme aux programmes de propriété industrielle. Si votre programme est une bibliothèque de sous-programme, vous pouvez la considérer plus utile pour laisser lier des applications de propriété industrielle avec la bibliothèque. Si est ce ce que vous voulez faire, employez le permis de grand public de bibliothèque de GNU au lieu de ce permis. libtranslate-0.99/src/test-translate.sh000755 001750 001750 00000006222 10172765553 022012 0ustar00jylefortjylefort000000 000000 #!/bin/sh # # Copyright (C) 2005 Jean-Yves Lefort # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. Neither the name of Jean-Yves Lefort nor the names of its contributors # may be used to endorse or promote products derived from this software # without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND # CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, # INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE # DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS # BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, # EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED # TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON # ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, # OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY # OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. thread_re="Thread .* has exited with leftover" fatal() { echo "$1" exit 1 } test_translate () { echo "translating \"$4\" from \"$2\" to \"$3\" using \"$1\"" translation=`echo "$4" | ./translate -s $1 -f $2 -t $3 | grep -v "$thread_re"` \ || fatal "FAILED" [ "x$translation" = "x$5" ] || fatal "FAILED (expected \"$5\", got \"$translation\")" echo "PASSED" } # test all services separately, and test UTF-8 input/output test_translate babelfish fr it "Cet été sera chaud." "Quest'estate sarà calda." test_translate systran fr it "Cet été sera chaud." "Quest'estate sarà calda." test_translate google fr de "Cet été sera chaud." "Dieser Sommer wird heiß sein." test_translate freetranslation fr en "Cet été sera chaud." "This summer will be hot. " test_translate freetranslation en fr "This summer will be hot." "Cet été aura chaud. " test_translate worldlingo fr it "Cet été sera chaud." "Quest'estate sarà calda." test_translate 1800translate fr it "Cet été sera chaud." "Questa estate sarà calda." test_translate tsunami fr it "Cet été sera chaud." "Quest'estate sarà calda." test_translate kataku en id "This été will be hot." "Ini été akan panas." test_translate papiamentu en pap "This été will be hot." "esaki été ta wòrdu kayente." # test the translation of a multi-chunk text using Babel Fish echo "translating sample-text.input from \"en\" to \"fr\" using \"babelfish\"" ./translate sample-text.input -s babelfish -f en -t fr | grep -v "$thread_re" > sample-text.output || fatal "FAILED" diff sample-text.expected sample-text.output || fatal "FAILED" echo "PASSED" rm -f sample-text.output libtranslate-0.99/src/modules000777 001750 001750 00000000000 10176431054 020062 5ustar00jylefortjylefort000000 000000 libtranslate-0.99/src/modules/Makefile.am000644 001750 001750 00000001713 10166755031 022176 0ustar00jylefortjylefort000000 000000 include $(top_srcdir)/common.make if WITH_GENERIC generic = generic.la endif if WITH_TALKFILTERS talkfilters = talkfilters.la endif modules_LTLIBRARIES = $(generic) $(talkfilters) generic_la_SOURCES = \ translate-generic-main.c \ translate-generic-main.h \ translate-generic-parser.c \ translate-generic-parser.h \ translate-generic-service.c \ translate-generic-service.h \ translate-generic-soup-cookie-jar.c \ translate-generic-soup-cookie-jar.h generic_la_LDFLAGS = -avoid-version -module $(SOUP_LIBS) $(LIBXML_LIBS) generic_la_CPPFLAGS = $(WARN_CFLAGS) $(TRANSLATE_CFLAGS) $(SOUP_CFLAGS) $(LIBXML_CFLAGS) \ -DG_LOG_DOMAIN="\"$(PACKAGE)(generic)\"" \ -DSERVICESFILE="\"$(pkgdatadir)/services.xml\"" talkfilters_la_SOURCES = translate-talkfilters.c talkfilters_la_LDFLAGS = -avoid-version -module $(TALKFILTERS_LIBS) talkfilters_la_CPPFLAGS = $(WARN_CFLAGS) $(TRANSLATE_CFLAGS) $(TALKFILTERS_CFLAGS) \ -DG_LOG_DOMAIN="\"$(PACKAGE)(talkfilters)\"" libtranslate-0.99/src/modules/Makefile.in000644 001750 001750 00000060773 10176430642 022221 0ustar00jylefortjylefort000000 000000 # Makefile.in generated by automake 1.9.2 from Makefile.am. # @configure_input@ # Copyright (C) 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001, 2002, # 2003, 2004 Free Software Foundation, Inc. # This Makefile.in is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY, to the extent permitted by law; without # even the implied warranty of MERCHANTABILITY or FITNESS FOR A # PARTICULAR PURPOSE. @SET_MAKE@ SOURCES = $(generic_la_SOURCES) $(talkfilters_la_SOURCES) srcdir = @srcdir@ top_srcdir = @top_srcdir@ VPATH = @srcdir@ pkgdatadir = $(datadir)/@PACKAGE@ pkglibdir = $(libdir)/@PACKAGE@ pkgincludedir = $(includedir)/@PACKAGE@ top_builddir = ../.. am__cd = CDPATH="$${ZSH_VERSION+.}$(PATH_SEPARATOR)" && cd INSTALL = @INSTALL@ install_sh_DATA = $(install_sh) -c -m 644 install_sh_PROGRAM = $(install_sh) -c install_sh_SCRIPT = $(install_sh) -c INSTALL_HEADER = $(INSTALL_DATA) transform = $(program_transform_name) NORMAL_INSTALL = : PRE_INSTALL = : POST_INSTALL = : NORMAL_UNINSTALL = : PRE_UNINSTALL = : POST_UNINSTALL = : build_triplet = @build@ host_triplet = @host@ DIST_COMMON = $(srcdir)/Makefile.am $(srcdir)/Makefile.in \ $(top_srcdir)/common.make subdir = src/modules ACLOCAL_M4 = $(top_srcdir)/aclocal.m4 am__aclocal_m4_deps = $(top_srcdir)/m4/talkfilters.m4 \ $(top_srcdir)/acinclude.m4 $(top_srcdir)/configure.ac am__configure_deps = $(am__aclocal_m4_deps) $(CONFIGURE_DEPENDENCIES) \ $(ACLOCAL_M4) mkinstalldirs = $(SHELL) $(top_srcdir)/mkinstalldirs CONFIG_HEADER = $(top_builddir)/config.h CONFIG_CLEAN_FILES = am__vpath_adj_setup = srcdirstrip=`echo "$(srcdir)" | sed 's|.|.|g'`; am__vpath_adj = case $$p in \ $(srcdir)/*) f=`echo "$$p" | sed "s|^$$srcdirstrip/||"`;; \ *) f=$$p;; \ esac; am__strip_dir = `echo $$p | sed -e 's|^.*/||'`; am__installdirs = "$(DESTDIR)$(modulesdir)" modulesLTLIBRARIES_INSTALL = $(INSTALL) LTLIBRARIES = $(modules_LTLIBRARIES) generic_la_LIBADD = am_generic_la_OBJECTS = generic_la-translate-generic-main.lo \ generic_la-translate-generic-parser.lo \ generic_la-translate-generic-service.lo \ generic_la-translate-generic-soup-cookie-jar.lo generic_la_OBJECTS = $(am_generic_la_OBJECTS) @WITH_GENERIC_TRUE@am_generic_la_rpath = -rpath $(modulesdir) talkfilters_la_LIBADD = am_talkfilters_la_OBJECTS = talkfilters_la-translate-talkfilters.lo talkfilters_la_OBJECTS = $(am_talkfilters_la_OBJECTS) @WITH_TALKFILTERS_TRUE@am_talkfilters_la_rpath = -rpath $(modulesdir) DEFAULT_INCLUDES = -I. -I$(srcdir) -I$(top_builddir) depcomp = $(SHELL) $(top_srcdir)/depcomp am__depfiles_maybe = depfiles COMPILE = $(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(AM_CPPFLAGS) \ $(CPPFLAGS) $(AM_CFLAGS) $(CFLAGS) LTCOMPILE = $(LIBTOOL) --mode=compile --tag=CC $(CC) $(DEFS) \ $(DEFAULT_INCLUDES) $(INCLUDES) $(AM_CPPFLAGS) $(CPPFLAGS) \ $(AM_CFLAGS) $(CFLAGS) CCLD = $(CC) LINK = $(LIBTOOL) --mode=link --tag=CC $(CCLD) $(AM_CFLAGS) $(CFLAGS) \ $(AM_LDFLAGS) $(LDFLAGS) -o $@ SOURCES = $(generic_la_SOURCES) $(talkfilters_la_SOURCES) DIST_SOURCES = $(generic_la_SOURCES) $(talkfilters_la_SOURCES) ETAGS = etags CTAGS = ctags DISTFILES = $(DIST_COMMON) $(DIST_SOURCES) $(TEXINFOS) $(EXTRA_DIST) ACLOCAL = @ACLOCAL@ AMDEP_FALSE = @AMDEP_FALSE@ AMDEP_TRUE = @AMDEP_TRUE@ AMTAR = @AMTAR@ AR = @AR@ AUTOCONF = @AUTOCONF@ AUTOHEADER = @AUTOHEADER@ AUTOMAKE = @AUTOMAKE@ AWK = @AWK@ CATALOGS = @CATALOGS@ CATOBJEXT = @CATOBJEXT@ CC = @CC@ CCDEPMODE = @CCDEPMODE@ CFLAGS = @CFLAGS@ CPP = @CPP@ CPPFLAGS = @CPPFLAGS@ CXX = @CXX@ CXXCPP = @CXXCPP@ CXXDEPMODE = @CXXDEPMODE@ CXXFLAGS = @CXXFLAGS@ CYGPATH_W = @CYGPATH_W@ DATADIRNAME = @DATADIRNAME@ DEFS = @DEFS@ DEPDIR = @DEPDIR@ ECHO = @ECHO@ ECHO_C = @ECHO_C@ ECHO_N = @ECHO_N@ ECHO_T = @ECHO_T@ EGREP = @EGREP@ ENABLE_GTK_DOC_FALSE = @ENABLE_GTK_DOC_FALSE@ ENABLE_GTK_DOC_TRUE = @ENABLE_GTK_DOC_TRUE@ EXEEXT = @EXEEXT@ F77 = @F77@ FFLAGS = @FFLAGS@ GETTEXT_PACKAGE = @GETTEXT_PACKAGE@ GLIB_CFLAGS = @GLIB_CFLAGS@ GLIB_LIBS = @GLIB_LIBS@ GMOFILES = @GMOFILES@ GMSGFMT = @GMSGFMT@ GTK_DOC_USE_LIBTOOL_FALSE = @GTK_DOC_USE_LIBTOOL_FALSE@ GTK_DOC_USE_LIBTOOL_TRUE = @GTK_DOC_USE_LIBTOOL_TRUE@ HTML_DIR = @HTML_DIR@ ICONV = @ICONV@ INSTALL_DATA = @INSTALL_DATA@ INSTALL_PROGRAM = @INSTALL_PROGRAM@ INSTALL_SCRIPT = @INSTALL_SCRIPT@ INSTALL_STRIP_PROGRAM = @INSTALL_STRIP_PROGRAM@ INSTOBJEXT = @INSTOBJEXT@ INTLLIBS = @INTLLIBS@ INTLTOOL_CAVES_RULE = @INTLTOOL_CAVES_RULE@ INTLTOOL_DESKTOP_RULE = @INTLTOOL_DESKTOP_RULE@ INTLTOOL_DIRECTORY_RULE = @INTLTOOL_DIRECTORY_RULE@ INTLTOOL_EXTRACT = @INTLTOOL_EXTRACT@ INTLTOOL_KBD_RULE = @INTLTOOL_KBD_RULE@ INTLTOOL_KEYS_RULE = @INTLTOOL_KEYS_RULE@ INTLTOOL_MERGE = @INTLTOOL_MERGE@ INTLTOOL_OAF_RULE = @INTLTOOL_OAF_RULE@ INTLTOOL_PERL = @INTLTOOL_PERL@ INTLTOOL_PONG_RULE = @INTLTOOL_PONG_RULE@ INTLTOOL_PROP_RULE = @INTLTOOL_PROP_RULE@ INTLTOOL_SCHEMAS_RULE = @INTLTOOL_SCHEMAS_RULE@ INTLTOOL_SERVER_RULE = @INTLTOOL_SERVER_RULE@ INTLTOOL_SHEET_RULE = @INTLTOOL_SHEET_RULE@ INTLTOOL_SOUNDLIST_RULE = @INTLTOOL_SOUNDLIST_RULE@ INTLTOOL_THEME_RULE = @INTLTOOL_THEME_RULE@ INTLTOOL_UI_RULE = @INTLTOOL_UI_RULE@ INTLTOOL_UPDATE = @INTLTOOL_UPDATE@ INTLTOOL_XAM_RULE = @INTLTOOL_XAM_RULE@ INTLTOOL_XML_NOMERGE_RULE = @INTLTOOL_XML_NOMERGE_RULE@ INTLTOOL_XML_RULE = @INTLTOOL_XML_RULE@ LDFLAGS = @LDFLAGS@ LIBOBJS = @LIBOBJS@ LIBS = @LIBS@ LIBTOOL = @LIBTOOL@ LIBXML_CFLAGS = @LIBXML_CFLAGS@ LIBXML_LIBS = @LIBXML_LIBS@ LN_S = @LN_S@ LTLIBOBJS = @LTLIBOBJS@ MAINT = @MAINT@ MAINTAINER_MODE_FALSE = @MAINTAINER_MODE_FALSE@ MAINTAINER_MODE_TRUE = @MAINTAINER_MODE_TRUE@ MAKEINFO = @MAKEINFO@ MKINSTALLDIRS = @MKINSTALLDIRS@ MSGFMT = @MSGFMT@ MSGMERGE = @MSGMERGE@ OBJEXT = @OBJEXT@ PACKAGE = @PACKAGE@ PACKAGE_BUGREPORT = @PACKAGE_BUGREPORT@ PACKAGE_NAME = @PACKAGE_NAME@ PACKAGE_STRING = @PACKAGE_STRING@ PACKAGE_TARNAME = @PACKAGE_TARNAME@ PACKAGE_VERSION = @PACKAGE_VERSION@ PATH_SEPARATOR = @PATH_SEPARATOR@ PKG_CONFIG = @PKG_CONFIG@ POFILES = @POFILES@ POSUB = @POSUB@ PO_IN_DATADIR_FALSE = @PO_IN_DATADIR_FALSE@ PO_IN_DATADIR_TRUE = @PO_IN_DATADIR_TRUE@ RANLIB = @RANLIB@ SET_MAKE = @SET_MAKE@ SHELL = @SHELL@ SOUP_CFLAGS = @SOUP_CFLAGS@ SOUP_LIBS = @SOUP_LIBS@ STRIP = @STRIP@ TALKFILTERS_CFLAGS = @TALKFILTERS_CFLAGS@ TALKFILTERS_LIBS = @TALKFILTERS_LIBS@ USE_NLS = @USE_NLS@ VERSION = @VERSION@ WARN_CFLAGS = @WARN_CFLAGS@ WITH_GENERIC_FALSE = @WITH_GENERIC_FALSE@ WITH_GENERIC_TRUE = @WITH_GENERIC_TRUE@ WITH_REGRESSION_TESTS_FALSE = @WITH_REGRESSION_TESTS_FALSE@ WITH_REGRESSION_TESTS_TRUE = @WITH_REGRESSION_TESTS_TRUE@ WITH_TALKFILTERS_FALSE = @WITH_TALKFILTERS_FALSE@ WITH_TALKFILTERS_TRUE = @WITH_TALKFILTERS_TRUE@ XGETTEXT = @XGETTEXT@ ac_ct_AR = @ac_ct_AR@ ac_ct_CC = @ac_ct_CC@ ac_ct_CXX = @ac_ct_CXX@ ac_ct_F77 = @ac_ct_F77@ ac_ct_RANLIB = @ac_ct_RANLIB@ ac_ct_STRIP = @ac_ct_STRIP@ am__fastdepCC_FALSE = @am__fastdepCC_FALSE@ am__fastdepCC_TRUE = @am__fastdepCC_TRUE@ am__fastdepCXX_FALSE = @am__fastdepCXX_FALSE@ am__fastdepCXX_TRUE = @am__fastdepCXX_TRUE@ am__include = @am__include@ am__leading_dot = @am__leading_dot@ am__quote = @am__quote@ am__tar = @am__tar@ am__untar = @am__untar@ bindir = @bindir@ build = @build@ build_alias = @build_alias@ build_cpu = @build_cpu@ build_os = @build_os@ build_vendor = @build_vendor@ datadir = @datadir@ exec_prefix = @exec_prefix@ host = @host@ host_alias = @host_alias@ host_cpu = @host_cpu@ host_os = @host_os@ host_vendor = @host_vendor@ includedir = @includedir@ infodir = @infodir@ install_sh = @install_sh@ libdir = @libdir@ libexecdir = @libexecdir@ localstatedir = @localstatedir@ mandir = @mandir@ mkdir_p = @mkdir_p@ oldincludedir = @oldincludedir@ prefix = @prefix@ program_transform_name = @program_transform_name@ sbindir = @sbindir@ sharedstatedir = @sharedstatedir@ sysconfdir = @sysconfdir@ target_alias = @target_alias@ modulesdir = $(pkglibdir)/modules TRANSLATE_CFLAGS = $(GLIB_CFLAGS) -I$(top_srcdir)/src @WITH_GENERIC_TRUE@generic = generic.la @WITH_TALKFILTERS_TRUE@talkfilters = talkfilters.la modules_LTLIBRARIES = $(generic) $(talkfilters) generic_la_SOURCES = \ translate-generic-main.c \ translate-generic-main.h \ translate-generic-parser.c \ translate-generic-parser.h \ translate-generic-service.c \ translate-generic-service.h \ translate-generic-soup-cookie-jar.c \ translate-generic-soup-cookie-jar.h generic_la_LDFLAGS = -avoid-version -module $(SOUP_LIBS) $(LIBXML_LIBS) generic_la_CPPFLAGS = $(WARN_CFLAGS) $(TRANSLATE_CFLAGS) $(SOUP_CFLAGS) $(LIBXML_CFLAGS) \ -DG_LOG_DOMAIN="\"$(PACKAGE)(generic)\"" \ -DSERVICESFILE="\"$(pkgdatadir)/services.xml\"" talkfilters_la_SOURCES = translate-talkfilters.c talkfilters_la_LDFLAGS = -avoid-version -module $(TALKFILTERS_LIBS) talkfilters_la_CPPFLAGS = $(WARN_CFLAGS) $(TRANSLATE_CFLAGS) $(TALKFILTERS_CFLAGS) \ -DG_LOG_DOMAIN="\"$(PACKAGE)(talkfilters)\"" all: all-am .SUFFIXES: .SUFFIXES: .c .lo .o .obj $(srcdir)/Makefile.in: @MAINTAINER_MODE_TRUE@ $(srcdir)/Makefile.am $(top_srcdir)/common.make $(am__configure_deps) @for dep in $?; do \ case '$(am__configure_deps)' in \ *$$dep*) \ cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh \ && exit 0; \ exit 1;; \ esac; \ done; \ echo ' cd $(top_srcdir) && $(AUTOMAKE) --foreign src/modules/Makefile'; \ cd $(top_srcdir) && \ $(AUTOMAKE) --foreign src/modules/Makefile .PRECIOUS: Makefile Makefile: $(srcdir)/Makefile.in $(top_builddir)/config.status @case '$?' in \ *config.status*) \ cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh;; \ *) \ echo ' cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe)'; \ cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe);; \ esac; $(top_builddir)/config.status: $(top_srcdir)/configure $(CONFIG_STATUS_DEPENDENCIES) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh $(top_srcdir)/configure: @MAINTAINER_MODE_TRUE@ $(am__configure_deps) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh $(ACLOCAL_M4): @MAINTAINER_MODE_TRUE@ $(am__aclocal_m4_deps) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh install-modulesLTLIBRARIES: $(modules_LTLIBRARIES) @$(NORMAL_INSTALL) test -z "$(modulesdir)" || $(mkdir_p) "$(DESTDIR)$(modulesdir)" @list='$(modules_LTLIBRARIES)'; for p in $$list; do \ if test -f $$p; then \ f=$(am__strip_dir) \ echo " $(LIBTOOL) --mode=install $(modulesLTLIBRARIES_INSTALL) $(INSTALL_STRIP_FLAG) '$$p' '$(DESTDIR)$(modulesdir)/$$f'"; \ $(LIBTOOL) --mode=install $(modulesLTLIBRARIES_INSTALL) $(INSTALL_STRIP_FLAG) "$$p" "$(DESTDIR)$(modulesdir)/$$f"; \ else :; fi; \ done uninstall-modulesLTLIBRARIES: @$(NORMAL_UNINSTALL) @set -x; list='$(modules_LTLIBRARIES)'; for p in $$list; do \ p=$(am__strip_dir) \ echo " $(LIBTOOL) --mode=uninstall rm -f '$(DESTDIR)$(modulesdir)/$$p'"; \ $(LIBTOOL) --mode=uninstall rm -f "$(DESTDIR)$(modulesdir)/$$p"; \ done clean-modulesLTLIBRARIES: -test -z "$(modules_LTLIBRARIES)" || rm -f $(modules_LTLIBRARIES) @list='$(modules_LTLIBRARIES)'; for p in $$list; do \ dir="`echo $$p | sed -e 's|/[^/]*$$||'`"; \ test "$$dir" != "$$p" || dir=.; \ echo "rm -f \"$${dir}/so_locations\""; \ rm -f "$${dir}/so_locations"; \ done generic.la: $(generic_la_OBJECTS) $(generic_la_DEPENDENCIES) $(LINK) $(am_generic_la_rpath) $(generic_la_LDFLAGS) $(generic_la_OBJECTS) $(generic_la_LIBADD) $(LIBS) talkfilters.la: $(talkfilters_la_OBJECTS) $(talkfilters_la_DEPENDENCIES) $(LINK) $(am_talkfilters_la_rpath) $(talkfilters_la_LDFLAGS) $(talkfilters_la_OBJECTS) $(talkfilters_la_LIBADD) $(LIBS) mostlyclean-compile: -rm -f *.$(OBJEXT) distclean-compile: -rm -f *.tab.c @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/generic_la-translate-generic-main.Plo@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/generic_la-translate-generic-parser.Plo@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/generic_la-translate-generic-service.Plo@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/generic_la-translate-generic-soup-cookie-jar.Plo@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/talkfilters_la-translate-talkfilters.Plo@am__quote@ .c.o: @am__fastdepCC_TRUE@ if $(COMPILE) -MT $@ -MD -MP -MF "$(DEPDIR)/$*.Tpo" -c -o $@ $<; \ @am__fastdepCC_TRUE@ then mv -f "$(DEPDIR)/$*.Tpo" "$(DEPDIR)/$*.Po"; else rm -f "$(DEPDIR)/$*.Tpo"; exit 1; fi @AMDEP_TRUE@@am__fastdepCC_FALSE@ source='$<' object='$@' libtool=no @AMDEPBACKSLASH@ @AMDEP_TRUE@@am__fastdepCC_FALSE@ DEPDIR=$(DEPDIR) $(CCDEPMODE) $(depcomp) @AMDEPBACKSLASH@ @am__fastdepCC_FALSE@ $(COMPILE) -c $< .c.obj: @am__fastdepCC_TRUE@ if $(COMPILE) -MT $@ -MD -MP -MF "$(DEPDIR)/$*.Tpo" -c -o $@ `$(CYGPATH_W) '$<'`; \ @am__fastdepCC_TRUE@ then mv -f "$(DEPDIR)/$*.Tpo" "$(DEPDIR)/$*.Po"; else rm -f "$(DEPDIR)/$*.Tpo"; exit 1; fi @AMDEP_TRUE@@am__fastdepCC_FALSE@ source='$<' object='$@' libtool=no @AMDEPBACKSLASH@ @AMDEP_TRUE@@am__fastdepCC_FALSE@ DEPDIR=$(DEPDIR) $(CCDEPMODE) $(depcomp) @AMDEPBACKSLASH@ @am__fastdepCC_FALSE@ $(COMPILE) -c `$(CYGPATH_W) '$<'` .c.lo: @am__fastdepCC_TRUE@ if $(LTCOMPILE) -MT $@ -MD -MP -MF "$(DEPDIR)/$*.Tpo" -c -o $@ $<; \ @am__fastdepCC_TRUE@ then mv -f "$(DEPDIR)/$*.Tpo" "$(DEPDIR)/$*.Plo"; else rm -f "$(DEPDIR)/$*.Tpo"; exit 1; fi @AMDEP_TRUE@@am__fastdepCC_FALSE@ source='$<' object='$@' libtool=yes @AMDEPBACKSLASH@ @AMDEP_TRUE@@am__fastdepCC_FALSE@ DEPDIR=$(DEPDIR) $(CCDEPMODE) $(depcomp) @AMDEPBACKSLASH@ @am__fastdepCC_FALSE@ $(LTCOMPILE) -c -o $@ $< generic_la-translate-generic-main.lo: translate-generic-main.c @am__fastdepCC_TRUE@ if $(LIBTOOL) --mode=compile --tag=CC $(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(generic_la_CPPFLAGS) $(CPPFLAGS) $(AM_CFLAGS) $(CFLAGS) -MT generic_la-translate-generic-main.lo -MD -MP -MF "$(DEPDIR)/generic_la-translate-generic-main.Tpo" -c -o generic_la-translate-generic-main.lo `test -f 'translate-generic-main.c' || echo '$(srcdir)/'`translate-generic-main.c; \ @am__fastdepCC_TRUE@ then mv -f "$(DEPDIR)/generic_la-translate-generic-main.Tpo" "$(DEPDIR)/generic_la-translate-generic-main.Plo"; else rm -f "$(DEPDIR)/generic_la-translate-generic-main.Tpo"; exit 1; fi @AMDEP_TRUE@@am__fastdepCC_FALSE@ source='translate-generic-main.c' object='generic_la-translate-generic-main.lo' libtool=yes @AMDEPBACKSLASH@ @AMDEP_TRUE@@am__fastdepCC_FALSE@ DEPDIR=$(DEPDIR) $(CCDEPMODE) $(depcomp) @AMDEPBACKSLASH@ @am__fastdepCC_FALSE@ $(LIBTOOL) --mode=compile --tag=CC $(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(generic_la_CPPFLAGS) $(CPPFLAGS) $(AM_CFLAGS) $(CFLAGS) -c -o generic_la-translate-generic-main.lo `test -f 'translate-generic-main.c' || echo '$(srcdir)/'`translate-generic-main.c generic_la-translate-generic-parser.lo: translate-generic-parser.c @am__fastdepCC_TRUE@ if $(LIBTOOL) --mode=compile --tag=CC $(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(generic_la_CPPFLAGS) $(CPPFLAGS) $(AM_CFLAGS) $(CFLAGS) -MT generic_la-translate-generic-parser.lo -MD -MP -MF "$(DEPDIR)/generic_la-translate-generic-parser.Tpo" -c -o generic_la-translate-generic-parser.lo `test -f 'translate-generic-parser.c' || echo '$(srcdir)/'`translate-generic-parser.c; \ @am__fastdepCC_TRUE@ then mv -f "$(DEPDIR)/generic_la-translate-generic-parser.Tpo" "$(DEPDIR)/generic_la-translate-generic-parser.Plo"; else rm -f "$(DEPDIR)/generic_la-translate-generic-parser.Tpo"; exit 1; fi @AMDEP_TRUE@@am__fastdepCC_FALSE@ source='translate-generic-parser.c' object='generic_la-translate-generic-parser.lo' libtool=yes @AMDEPBACKSLASH@ @AMDEP_TRUE@@am__fastdepCC_FALSE@ DEPDIR=$(DEPDIR) $(CCDEPMODE) $(depcomp) @AMDEPBACKSLASH@ @am__fastdepCC_FALSE@ $(LIBTOOL) --mode=compile --tag=CC $(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(generic_la_CPPFLAGS) $(CPPFLAGS) $(AM_CFLAGS) $(CFLAGS) -c -o generic_la-translate-generic-parser.lo `test -f 'translate-generic-parser.c' || echo '$(srcdir)/'`translate-generic-parser.c generic_la-translate-generic-service.lo: translate-generic-service.c @am__fastdepCC_TRUE@ if $(LIBTOOL) --mode=compile --tag=CC $(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(generic_la_CPPFLAGS) $(CPPFLAGS) $(AM_CFLAGS) $(CFLAGS) -MT generic_la-translate-generic-service.lo -MD -MP -MF "$(DEPDIR)/generic_la-translate-generic-service.Tpo" -c -o generic_la-translate-generic-service.lo `test -f 'translate-generic-service.c' || echo '$(srcdir)/'`translate-generic-service.c; \ @am__fastdepCC_TRUE@ then mv -f "$(DEPDIR)/generic_la-translate-generic-service.Tpo" "$(DEPDIR)/generic_la-translate-generic-service.Plo"; else rm -f "$(DEPDIR)/generic_la-translate-generic-service.Tpo"; exit 1; fi @AMDEP_TRUE@@am__fastdepCC_FALSE@ source='translate-generic-service.c' object='generic_la-translate-generic-service.lo' libtool=yes @AMDEPBACKSLASH@ @AMDEP_TRUE@@am__fastdepCC_FALSE@ DEPDIR=$(DEPDIR) $(CCDEPMODE) $(depcomp) @AMDEPBACKSLASH@ @am__fastdepCC_FALSE@ $(LIBTOOL) --mode=compile --tag=CC $(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(generic_la_CPPFLAGS) $(CPPFLAGS) $(AM_CFLAGS) $(CFLAGS) -c -o generic_la-translate-generic-service.lo `test -f 'translate-generic-service.c' || echo '$(srcdir)/'`translate-generic-service.c generic_la-translate-generic-soup-cookie-jar.lo: translate-generic-soup-cookie-jar.c @am__fastdepCC_TRUE@ if $(LIBTOOL) --mode=compile --tag=CC $(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(generic_la_CPPFLAGS) $(CPPFLAGS) $(AM_CFLAGS) $(CFLAGS) -MT generic_la-translate-generic-soup-cookie-jar.lo -MD -MP -MF "$(DEPDIR)/generic_la-translate-generic-soup-cookie-jar.Tpo" -c -o generic_la-translate-generic-soup-cookie-jar.lo `test -f 'translate-generic-soup-cookie-jar.c' || echo '$(srcdir)/'`translate-generic-soup-cookie-jar.c; \ @am__fastdepCC_TRUE@ then mv -f "$(DEPDIR)/generic_la-translate-generic-soup-cookie-jar.Tpo" "$(DEPDIR)/generic_la-translate-generic-soup-cookie-jar.Plo"; else rm -f "$(DEPDIR)/generic_la-translate-generic-soup-cookie-jar.Tpo"; exit 1; fi @AMDEP_TRUE@@am__fastdepCC_FALSE@ source='translate-generic-soup-cookie-jar.c' object='generic_la-translate-generic-soup-cookie-jar.lo' libtool=yes @AMDEPBACKSLASH@ @AMDEP_TRUE@@am__fastdepCC_FALSE@ DEPDIR=$(DEPDIR) $(CCDEPMODE) $(depcomp) @AMDEPBACKSLASH@ @am__fastdepCC_FALSE@ $(LIBTOOL) --mode=compile --tag=CC $(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(generic_la_CPPFLAGS) $(CPPFLAGS) $(AM_CFLAGS) $(CFLAGS) -c -o generic_la-translate-generic-soup-cookie-jar.lo `test -f 'translate-generic-soup-cookie-jar.c' || echo '$(srcdir)/'`translate-generic-soup-cookie-jar.c talkfilters_la-translate-talkfilters.lo: translate-talkfilters.c @am__fastdepCC_TRUE@ if $(LIBTOOL) --mode=compile --tag=CC $(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(talkfilters_la_CPPFLAGS) $(CPPFLAGS) $(AM_CFLAGS) $(CFLAGS) -MT talkfilters_la-translate-talkfilters.lo -MD -MP -MF "$(DEPDIR)/talkfilters_la-translate-talkfilters.Tpo" -c -o talkfilters_la-translate-talkfilters.lo `test -f 'translate-talkfilters.c' || echo '$(srcdir)/'`translate-talkfilters.c; \ @am__fastdepCC_TRUE@ then mv -f "$(DEPDIR)/talkfilters_la-translate-talkfilters.Tpo" "$(DEPDIR)/talkfilters_la-translate-talkfilters.Plo"; else rm -f "$(DEPDIR)/talkfilters_la-translate-talkfilters.Tpo"; exit 1; fi @AMDEP_TRUE@@am__fastdepCC_FALSE@ source='translate-talkfilters.c' object='talkfilters_la-translate-talkfilters.lo' libtool=yes @AMDEPBACKSLASH@ @AMDEP_TRUE@@am__fastdepCC_FALSE@ DEPDIR=$(DEPDIR) $(CCDEPMODE) $(depcomp) @AMDEPBACKSLASH@ @am__fastdepCC_FALSE@ $(LIBTOOL) --mode=compile --tag=CC $(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(talkfilters_la_CPPFLAGS) $(CPPFLAGS) $(AM_CFLAGS) $(CFLAGS) -c -o talkfilters_la-translate-talkfilters.lo `test -f 'translate-talkfilters.c' || echo '$(srcdir)/'`translate-talkfilters.c mostlyclean-libtool: -rm -f *.lo clean-libtool: -rm -rf .libs _libs distclean-libtool: -rm -f libtool uninstall-info-am: ID: $(HEADERS) $(SOURCES) $(LISP) $(TAGS_FILES) list='$(SOURCES) $(HEADERS) $(LISP) $(TAGS_FILES)'; \ unique=`for i in $$list; do \ if test -f "$$i"; then echo $$i; else echo $(srcdir)/$$i; fi; \ done | \ $(AWK) ' { files[$$0] = 1; } \ END { for (i in files) print i; }'`; \ mkid -fID $$unique tags: TAGS TAGS: $(HEADERS) $(SOURCES) $(TAGS_DEPENDENCIES) \ $(TAGS_FILES) $(LISP) tags=; \ here=`pwd`; \ list='$(SOURCES) $(HEADERS) $(LISP) $(TAGS_FILES)'; \ unique=`for i in $$list; do \ if test -f "$$i"; then echo $$i; else echo $(srcdir)/$$i; fi; \ done | \ $(AWK) ' { files[$$0] = 1; } \ END { for (i in files) print i; }'`; \ if test -z "$(ETAGS_ARGS)$$tags$$unique"; then :; else \ test -n "$$unique" || unique=$$empty_fix; \ $(ETAGS) $(ETAGSFLAGS) $(AM_ETAGSFLAGS) $(ETAGS_ARGS) \ $$tags $$unique; \ fi ctags: CTAGS CTAGS: $(HEADERS) $(SOURCES) $(TAGS_DEPENDENCIES) \ $(TAGS_FILES) $(LISP) tags=; \ here=`pwd`; \ list='$(SOURCES) $(HEADERS) $(LISP) $(TAGS_FILES)'; \ unique=`for i in $$list; do \ if test -f "$$i"; then echo $$i; else echo $(srcdir)/$$i; fi; \ done | \ $(AWK) ' { files[$$0] = 1; } \ END { for (i in files) print i; }'`; \ test -z "$(CTAGS_ARGS)$$tags$$unique" \ || $(CTAGS) $(CTAGSFLAGS) $(AM_CTAGSFLAGS) $(CTAGS_ARGS) \ $$tags $$unique GTAGS: here=`$(am__cd) $(top_builddir) && pwd` \ && cd $(top_srcdir) \ && gtags -i $(GTAGS_ARGS) $$here distclean-tags: -rm -f TAGS ID GTAGS GRTAGS GSYMS GPATH tags distdir: $(DISTFILES) $(mkdir_p) $(distdir)/../.. @srcdirstrip=`echo "$(srcdir)" | sed 's|.|.|g'`; \ topsrcdirstrip=`echo "$(top_srcdir)" | sed 's|.|.|g'`; \ list='$(DISTFILES)'; for file in $$list; do \ case $$file in \ $(srcdir)/*) file=`echo "$$file" | sed "s|^$$srcdirstrip/||"`;; \ $(top_srcdir)/*) file=`echo "$$file" | sed "s|^$$topsrcdirstrip/|$(top_builddir)/|"`;; \ esac; \ if test -f $$file || test -d $$file; then d=.; else d=$(srcdir); fi; \ dir=`echo "$$file" | sed -e 's,/[^/]*$$,,'`; \ if test "$$dir" != "$$file" && test "$$dir" != "."; then \ dir="/$$dir"; \ $(mkdir_p) "$(distdir)$$dir"; \ else \ dir=''; \ fi; \ if test -d $$d/$$file; then \ if test -d $(srcdir)/$$file && test $$d != $(srcdir); then \ cp -pR $(srcdir)/$$file $(distdir)$$dir || exit 1; \ fi; \ cp -pR $$d/$$file $(distdir)$$dir || exit 1; \ else \ test -f $(distdir)/$$file \ || cp -p $$d/$$file $(distdir)/$$file \ || exit 1; \ fi; \ done check-am: all-am check: check-am all-am: Makefile $(LTLIBRARIES) installdirs: for dir in "$(DESTDIR)$(modulesdir)"; do \ test -z "$$dir" || $(mkdir_p) "$$dir"; \ done install: install-am install-exec: install-exec-am install-data: install-data-am uninstall: uninstall-am install-am: all-am @$(MAKE) $(AM_MAKEFLAGS) install-exec-am install-data-am installcheck: installcheck-am install-strip: $(MAKE) $(AM_MAKEFLAGS) INSTALL_PROGRAM="$(INSTALL_STRIP_PROGRAM)" \ install_sh_PROGRAM="$(INSTALL_STRIP_PROGRAM)" INSTALL_STRIP_FLAG=-s \ `test -z '$(STRIP)' || \ echo "INSTALL_PROGRAM_ENV=STRIPPROG='$(STRIP)'"` install mostlyclean-generic: clean-generic: distclean-generic: -test -z "$(CONFIG_CLEAN_FILES)" || rm -f $(CONFIG_CLEAN_FILES) maintainer-clean-generic: @echo "This command is intended for maintainers to use" @echo "it deletes files that may require special tools to rebuild." clean: clean-am clean-am: clean-generic clean-libtool clean-modulesLTLIBRARIES \ mostlyclean-am distclean: distclean-am -rm -rf ./$(DEPDIR) -rm -f Makefile distclean-am: clean-am distclean-compile distclean-generic \ distclean-libtool distclean-tags dvi: dvi-am dvi-am: html: html-am info: info-am info-am: install-data-am: install-modulesLTLIBRARIES install-exec-am: install-info: install-info-am install-man: installcheck-am: maintainer-clean: maintainer-clean-am -rm -rf ./$(DEPDIR) -rm -f Makefile maintainer-clean-am: distclean-am maintainer-clean-generic mostlyclean: mostlyclean-am mostlyclean-am: mostlyclean-compile mostlyclean-generic \ mostlyclean-libtool pdf: pdf-am pdf-am: ps: ps-am ps-am: uninstall-am: uninstall-info-am uninstall-modulesLTLIBRARIES .PHONY: CTAGS GTAGS all all-am check check-am clean clean-generic \ clean-libtool clean-modulesLTLIBRARIES ctags distclean \ distclean-compile distclean-generic distclean-libtool \ distclean-tags distdir dvi dvi-am html html-am info info-am \ install install-am install-data install-data-am install-exec \ install-exec-am install-info install-info-am install-man \ install-modulesLTLIBRARIES install-strip installcheck \ installcheck-am installdirs maintainer-clean \ maintainer-clean-generic mostlyclean mostlyclean-compile \ mostlyclean-generic mostlyclean-libtool pdf pdf-am ps ps-am \ tags uninstall uninstall-am uninstall-info-am \ uninstall-modulesLTLIBRARIES # Tell versions [3.59,3.63) of GNU make to not export all variables. # Otherwise a system limit (for SysV at least) may be exceeded. .NOEXPORT: libtranslate-0.99/src/modules/translate-generic-main.c000644 001750 001750 00000005442 10172765722 024647 0ustar00jylefortjylefort000000 000000 /* * Copyright (C) 2004, 2005 Jean-Yves Lefort * All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in the * documentation and/or other materials provided with the distribution. * 3. Neither the name of Jean-Yves Lefort nor the names of its contributors * may be used to endorse or promote products derived from this software * without specific prior written permission. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND * CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, * INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF * MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE * DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS * BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, * EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED * TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON * ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, * OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY * OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE * POSSIBILITY OF SUCH DAMAGE. */ #include #include #include "translate.h" #include "translate-generic-main.h" #include "translate-generic-parser.h" #include "translate-generic-soup-cookie-jar.h" TranslateGenericDebugFlags translate_generic_debug_flags = 0; G_MODULE_EXPORT gboolean translate_module_init (GError **err) { const char *debug; char *user_services; debug = g_getenv("TRANSLATE_GENERIC_DEBUG"); if (debug) { static const GDebugKey keys[] = { { "log-transfers", TRANSLATE_GENERIC_DEBUG_LOG_TRANSFERS } }; translate_generic_debug_flags = g_parse_debug_string(debug, keys, G_N_ELEMENTS(keys)); } translate_generic_parse(SERVICESFILE); user_services = g_build_filename(g_get_home_dir(), ".libtranslate", "services.xml", NULL); translate_generic_parse(user_services); g_free(user_services); /* * Work around http://bugzilla.gnome.org/show_bug.cgi?id=64764: * initialize the classes we will be accessing concurrently (in * translate_service_generic_translate(), which is called by the * translate_session_translate() thread pool). */ g_type_class_ref(SOUP_TYPE_SESSION); g_type_class_ref(SOUP_TYPE_MESSAGE); g_type_class_ref(TRANSLATE_GENERIC_TYPE_SOUP_COOKIE_JAR); return TRUE; } libtranslate-0.99/src/modules/translate-generic-main.h000644 001750 001750 00000003474 10172765731 024657 0ustar00jylefortjylefort000000 000000 /* * Copyright (C) 2005 Jean-Yves Lefort * All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in the * documentation and/or other materials provided with the distribution. * 3. Neither the name of Jean-Yves Lefort nor the names of its contributors * may be used to endorse or promote products derived from this software * without specific prior written permission. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND * CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, * INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF * MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE * DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS * BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, * EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED * TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON * ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, * OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY * OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE * POSSIBILITY OF SUCH DAMAGE. */ #ifndef _TRANSLATE_GENERIC_MAIN_H #define _TRANSLATE_GENERIC_MAIN_H typedef enum { TRANSLATE_GENERIC_DEBUG_LOG_TRANSFERS = 1 << 0 } TranslateGenericDebugFlags; extern TranslateGenericDebugFlags translate_generic_debug_flags; #endif /* _TRANSLATE_GENERIC_MAIN_H */ libtranslate-0.99/src/modules/translate-generic-parser.c000644 001750 001750 00000052032 10172765740 025214 0ustar00jylefortjylefort000000 000000 /* * Copyright (C) 2004, 2005 Jean-Yves Lefort * All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in the * documentation and/or other materials provided with the distribution. * 3. Neither the name of Jean-Yves Lefort nor the names of its contributors * may be used to endorse or promote products derived from this software * without specific prior written permission. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND * CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, * INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF * MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE * DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS * BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, * EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED * TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON * ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, * OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY * OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE * POSSIBILITY OF SUCH DAMAGE. */ #include "config.h" #include #include #include #include "translate.h" #include "translate-generic-parser.h" #include "translate-generic-service.h" typedef struct { char *name; char *nick; unsigned int max_chunk_len; TranslateGenericGroup *group; GSList *groups; } ServiceDefinition; typedef struct { GMarkupParseContext *context; const char *filename; char *path; ServiceDefinition *definition; GSList *definitions; } ParseInfo; typedef enum { REQUIRED, OPTIONAL } AttributeType; static void translate_generic_parser_start_element_cb (GMarkupParseContext *context, const char *element_name, const char **attribute_names, const char **attribute_values, gpointer user_data, GError **err); static void translate_generic_parser_end_element_cb (GMarkupParseContext *context, const char *element_name, gpointer user_data, GError **err); static void translate_generic_parser_scan_attributes (ParseInfo *info, const char **attribute_names, const char **attribute_values, GError **err, ...); static void translate_generic_parser_warning (ParseInfo *info, const char *format, ...) G_GNUC_PRINTF(2, 3); static void translate_generic_parser_set_error (GError **err, ParseInfo *info, const char *format, ...) G_GNUC_PRINTF(3, 4); static void translate_generic_definition_free (ServiceDefinition *definition); static void translate_generic_parser_handle_http_header (ParseInfo *info, const char **attribute_names, const char **attribute_values, GSList **list, GError **err); static void translate_generic_http_header_free (TranslateGenericHttpHeader *header); static void translate_generic_parser_handle_location (ParseInfo *info, const char **attribute_names, const char **attribute_values, TranslateGenericLocation **location, GError **err); static void translate_generic_location_free (TranslateGenericLocation *location); void translate_generic_parse (const char *filename) { GError *err = NULL; GIOChannel *channel; char *contents; gsize length; ParseInfo info; GMarkupParser parser = { translate_generic_parser_start_element_cb, translate_generic_parser_end_element_cb, NULL, NULL, NULL }; g_return_if_fail(filename != NULL); if (! g_file_test(filename, G_FILE_TEST_IS_REGULAR)) return; channel = g_io_channel_new_file(filename, "r", &err); if (! channel) { g_warning(_("unable to open %s: %s"), filename, err->message); g_error_free(err); return; } if (g_io_channel_read_to_end(channel, &contents, &length, &err) != G_IO_STATUS_NORMAL) { g_warning(_("unable to read %s: %s"), filename, err->message); g_error_free(err); goto end; } info.context = g_markup_parse_context_new(&parser, 0, &info, NULL); info.filename = filename; info.path = NULL; info.definition = NULL; info.definitions = NULL; if (g_markup_parse_context_parse(info.context, contents, length, &err) && g_markup_parse_context_end_parse(info.context, &err)) { GSList *l; for (l = info.definitions; l != NULL; l = l->next) { ServiceDefinition *definition = l->data; TranslateService *service; service = translate_generic_service_new(definition->name, definition->nick, definition->max_chunk_len, definition->groups); if (! translate_add_service(service)) g_warning(_("%s: service \"%s\" already exists, ignored"), filename, translate_service_get_name(service)); g_object_unref(service); } } else { g_warning(_("unable to parse %s: %s"), filename, err->message); g_error_free(err); } g_markup_parse_context_free(info.context); g_free(info.path); if (info.definition) translate_generic_definition_free(info.definition); g_slist_foreach(info.definitions, (GFunc) translate_generic_definition_free, NULL); g_slist_free(info.definitions); end: g_io_channel_shutdown(channel, TRUE, NULL); g_io_channel_unref(channel); } static void translate_generic_parser_start_element_cb (GMarkupParseContext *context, const char *element_name, const char **attribute_names, const char **attribute_values, gpointer user_data, GError **err) { ParseInfo *info = user_data; char *new_path; if (info->path) { new_path = g_strconcat(info->path, "/", element_name, NULL); g_free(info->path); } else new_path = g_strconcat("/", element_name, NULL); info->path = new_path; if (! strcmp(info->path, "/services")) translate_generic_parser_scan_attributes(info, attribute_names, attribute_values, err, NULL); else if (! strcmp(info->path, "/services/custom-language")) { const char *tag; const char *name; translate_generic_parser_scan_attributes(info, attribute_names, attribute_values, err, "tag", REQUIRED, &tag, "name", REQUIRED, &name, NULL); if (! *err) { if (! translate_add_language(tag, _(name))) translate_generic_parser_warning(info, _("language \"%s\" already exists, ignored"), tag); } } else if (! strcmp(info->path, "/services/service")) { const char *name; const char *nick; const char *max_chunk_len; translate_generic_parser_scan_attributes(info, attribute_names, attribute_values, err, "name", REQUIRED, &name, "nick", OPTIONAL, &nick, "max-chunk-len", OPTIONAL, &max_chunk_len, NULL); if (! *err) { unsigned int max_chunk_len_i = 1000; /* keep in sync with services.dtd */ if (max_chunk_len) { if (! *max_chunk_len) translate_generic_parser_set_error(err, info, _("max-chunk-len is empty")); else if (strspn(max_chunk_len, "0123456789") != strlen(max_chunk_len)) translate_generic_parser_set_error(err, info, _("max-chunk-len \"%s\" is not an unsigned integer"), max_chunk_len); else max_chunk_len_i = atoi(max_chunk_len); } if (! *err) { info->definition = g_new0(ServiceDefinition, 1); info->definition->name = g_strdup(name); info->definition->nick = g_strdup(nick ? nick : name); info->definition->max_chunk_len = max_chunk_len_i; } } } else if (! strcmp(info->path, "/services/service/group")) { translate_generic_parser_scan_attributes(info, attribute_names, attribute_values, err, NULL); if (! *err) { info->definition->group = g_new0(TranslateGenericGroup, 1); info->definition->group->ref_count = 1; info->definition->group->service_tags = g_hash_table_new_full(translate_ascii_strcase_hash, translate_ascii_strcase_equal, g_free, g_free); } } else if (! strcmp(info->path, "/services/service/group/language")) { const char *tag; const char *service_tag; const char *to; translate_generic_parser_scan_attributes(info, attribute_names, attribute_values, err, "tag", REQUIRED, &tag, "service-tag", OPTIONAL, &service_tag, "to", OPTIONAL, &to, NULL); if (! *err) { TranslateGenericLanguage *language; language = g_new(TranslateGenericLanguage, 1); language->tag = g_strdup(tag); language->target_tags = to ? g_strsplit(to, ",", 0) : NULL; info->definition->group->languages = g_slist_append(info->definition->group->languages, language); if (service_tag) g_hash_table_insert(info->definition->group->service_tags, g_strdup(tag), g_strdup(service_tag)); } } else if (! strcmp(info->path, "/services/service/group/http-header")) translate_generic_parser_handle_http_header(info, attribute_names, attribute_values, &info->definition->group->http_headers, err); else if (! strcmp(info->path, "/services/service/group/text-translation")) { if (info->definition->group->text_location) translate_generic_parser_warning(info, _("element \"text-translation\" already specified")); else translate_generic_parser_handle_location(info, attribute_names, attribute_values, &info->definition->group->text_location, err); } else if (! strcmp(info->path, "/services/service/group/text-translation/pre-marker")) { const char *text; translate_generic_parser_scan_attributes(info, attribute_names, attribute_values, err, "text", REQUIRED, &text, NULL); if (! *err) info->definition->group->text_pre_markers = g_slist_append(info->definition->group->text_pre_markers, g_strdup(text)); } else if (! strcmp(info->path, "/services/service/group/text-translation/error-marker")) { const char *text; translate_generic_parser_scan_attributes(info, attribute_names, attribute_values, err, "text", REQUIRED, &text, NULL); if (! *err) info->definition->group->text_error_markers = g_slist_append(info->definition->group->text_error_markers, g_strdup(text)); } else if (! strcmp(info->path, "/services/service/group/text-translation/post-marker")) { if (info->definition->group->text_post_marker) translate_generic_parser_warning(info, _("element \"post-marker\" already specified")); else { const char *text; translate_generic_parser_scan_attributes(info, attribute_names, attribute_values, err, "text", REQUIRED, &text, NULL); if (! *err) info->definition->group->text_post_marker = g_strdup(text); } } else if (! strcmp(info->path, "/services/service/group/text-translation/http-header")) translate_generic_parser_handle_http_header(info, attribute_names, attribute_values, &info->definition->group->text_location->http_headers, err); else if (! strcmp(info->path, "/services/service/group/web-page-translation")) { if (info->definition->group->web_page_location) translate_generic_parser_warning(info, _("element \"web-page-translation\" already specified")); else translate_generic_parser_handle_location(info, attribute_names, attribute_values, &info->definition->group->web_page_location, err); } else if (! strcmp(info->path, "/services/service/group/web-page-translation/http-header")) translate_generic_parser_handle_http_header(info, attribute_names, attribute_values, &info->definition->group->web_page_location->http_headers, err); else translate_generic_parser_warning(info, _("unknown element \"%s\", ignored"), element_name); } static void translate_generic_parser_end_element_cb (GMarkupParseContext *context, const char *element_name, gpointer user_data, GError **err) { ParseInfo *info = user_data; char *slash; g_return_if_fail(info->path != NULL); if (! strcmp(info->path, "/services/service")) { info->definitions = g_slist_append(info->definitions, info->definition); info->definition = NULL; } else if (! strcmp(info->path, "/services/service/group")) { info->definition->groups = g_slist_append(info->definition->groups, info->definition->group); info->definition->group = NULL; } slash = strrchr(info->path, '/'); if (slash) *slash = 0; else { g_free(info->path); info->path = NULL; } } static void translate_generic_parser_scan_attributes (ParseInfo *info, const char **attribute_names, const char **attribute_values, GError **err, ...) { va_list args; const char *name; GSList *seen_attributes = NULL; GSList *l; int i; gboolean found; g_return_if_fail(info != NULL); g_return_if_fail(attribute_names != NULL); g_return_if_fail(attribute_values != NULL); va_start(args, err); while ((name = va_arg(args, const char *))) { AttributeType type; const char **ptr; type = va_arg(args, AttributeType); ptr = va_arg(args, const char **); g_return_if_fail(ptr != NULL); *ptr = NULL; found = FALSE; for (i = 0; attribute_names[i] && attribute_values[i]; i++) if (! strcmp(attribute_names[i], name)) { if (found) translate_generic_parser_warning(info, _("attribute \"%s\" already specified"), name); else { seen_attributes = g_slist_append(seen_attributes, (gpointer) name); *ptr = attribute_values[i]; found = TRUE; } } if (! found && type == REQUIRED) { translate_generic_parser_set_error(err, info, _("required attribute \"%s\" missing"), name); goto end; } } for (i = 0; attribute_names[i] && attribute_values[i]; i++) { found = FALSE; for (l = seen_attributes; l != NULL && ! found; l = l->next) if (! strcmp(l->data, attribute_names[i])) found = TRUE; if (! found) translate_generic_parser_warning(info, _("unknown attribute \"%s\", ignored"), attribute_names[i]); } end: va_end(args); g_slist_free(seen_attributes); } static void translate_generic_parser_warning (ParseInfo *info, const char *format, ...) { va_list args; char *message; int line_number; g_return_if_fail(info != NULL); g_return_if_fail(format != NULL); va_start(args, format); message = g_strdup_vprintf(format, args); va_end(args); g_markup_parse_context_get_position(info->context, &line_number, NULL); g_warning(_("%s: around line %i: %s"), info->filename, line_number, message); g_free(message); } static void translate_generic_parser_set_error (GError **err, ParseInfo *info, const char *format, ...) { va_list args; char *message; int line_number; g_return_if_fail(info != NULL); g_return_if_fail(format != NULL); va_start(args, format); message = g_strdup_vprintf(format, args); va_end(args); g_markup_parse_context_get_position(info->context, &line_number, NULL); g_set_error(err, G_MARKUP_ERROR, G_MARKUP_ERROR_INVALID_CONTENT, "around line %i: %s", line_number, message); g_free(message); } static void translate_generic_definition_free (ServiceDefinition *definition) { g_return_if_fail(definition != NULL); g_free(definition->name); g_free(definition->nick); if (definition->group) translate_generic_group_unref(definition->group); g_slist_foreach(definition->groups, (GFunc) translate_generic_group_unref, NULL); g_slist_free(definition->groups); g_free(definition); } TranslateGenericGroup * translate_generic_group_ref (TranslateGenericGroup *group) { g_return_val_if_fail(group != NULL, NULL); g_atomic_int_inc(&group->ref_count); return group; } void translate_generic_group_unref (TranslateGenericGroup *group) { g_return_if_fail(group != NULL); if (g_atomic_int_dec_and_test(&group->ref_count)) { GSList *l; for (l = group->languages; l != NULL; l = l->next) { TranslateGenericLanguage *language = l->data; g_free(language->tag); g_strfreev(language->target_tags); g_free(language); } g_slist_free(group->languages); g_hash_table_destroy(group->service_tags); g_slist_foreach(group->http_headers, (GFunc) translate_generic_http_header_free, NULL); g_slist_free(group->http_headers); if (group->text_location) translate_generic_location_free(group->text_location); g_slist_foreach(group->text_pre_markers, (GFunc) g_free, NULL); g_slist_free(group->text_pre_markers); g_free(group->text_post_marker); g_slist_foreach(group->text_error_markers, (GFunc) g_free, NULL); g_slist_free(group->text_error_markers); if (group->web_page_location) translate_generic_location_free(group->web_page_location); g_free(group); } } const char * translate_generic_group_get_service_tag (TranslateGenericGroup *group, const char *tag) { const char *service_tag; g_return_val_if_fail(group != NULL, NULL); g_return_val_if_fail(tag != NULL, NULL); service_tag = g_hash_table_lookup(group->service_tags, tag); return service_tag ? service_tag : tag; } void translate_generic_group_foreach_pair (TranslateGenericGroup *group, TranslateGenericGroupForeachPairFunc func, gpointer user_data) { GSList *l; g_return_if_fail(group != NULL); g_return_if_fail(func != NULL); for (l = group->languages; l != NULL; l = l->next) { TranslateGenericLanguage *language = l->data; if (language->target_tags) { int i; for (i = 0; language->target_tags[i]; i++) if (! strcmp(language->target_tags[i], "*")) { GSList *m; for (m = group->languages; m != NULL; m = m->next) { TranslateGenericLanguage *to = m->data; if (g_ascii_strcasecmp(language->tag, to->tag)) { if (! func(language->tag, to->tag, user_data)) return; } } } else { if (! func(language->tag, language->target_tags[i], user_data)) return; } } } } static void translate_generic_parser_handle_http_header (ParseInfo *info, const char **attribute_names, const char **attribute_values, GSList **list, GError **err) { const char *name; const char *value; g_return_if_fail(info != NULL); g_return_if_fail(attribute_names != NULL); g_return_if_fail(attribute_values != NULL); g_return_if_fail(list != NULL); translate_generic_parser_scan_attributes(info, attribute_names, attribute_values, err, "name", REQUIRED, &name, "value", REQUIRED, &value, NULL); if (! *err) { TranslateGenericHttpHeader *header; header = g_new(TranslateGenericHttpHeader, 1); header->name = g_strdup(name); header->value = g_strdup(value); *list = g_slist_append(*list, header); } } static void translate_generic_http_header_free (TranslateGenericHttpHeader *header) { g_return_if_fail(header != NULL); g_free(header->name); g_free(header->value); g_free(header); } static void translate_generic_parser_handle_location (ParseInfo *info, const char **attribute_names, const char **attribute_values, TranslateGenericLocation **location, GError **err) { const char *url; const char *post; const char *content_type; g_return_if_fail(info != NULL); g_return_if_fail(attribute_names != NULL); g_return_if_fail(attribute_values != NULL); g_return_if_fail(location != NULL); translate_generic_parser_scan_attributes(info, attribute_names, attribute_values, err, "url", REQUIRED, &url, "post", OPTIONAL, &post, "content-type", OPTIONAL, &content_type, NULL); if (! *err) { *location = g_new0(TranslateGenericLocation, 1); (*location)->url = g_strdup(url); (*location)->post = g_strdup(post); (*location)->content_type = g_strdup(content_type ? content_type : "application/x-www-form-urlencoded"); } } static void translate_generic_location_free (TranslateGenericLocation *location) { g_return_if_fail(location != NULL); g_free(location->url); g_free(location->post); g_free(location->content_type); g_slist_foreach(location->http_headers, (GFunc) translate_generic_http_header_free, NULL); g_slist_free(location->http_headers); g_free(location); } libtranslate-0.99/src/modules/translate-generic-parser.h000644 001750 001750 00000005572 10172765746 025236 0ustar00jylefortjylefort000000 000000 /* * Copyright (C) 2004, 2005 Jean-Yves Lefort * All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in the * documentation and/or other materials provided with the distribution. * 3. Neither the name of Jean-Yves Lefort nor the names of its contributors * may be used to endorse or promote products derived from this software * without specific prior written permission. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND * CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, * INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF * MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE * DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS * BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, * EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED * TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON * ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, * OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY * OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE * POSSIBILITY OF SUCH DAMAGE. */ #ifndef _TRANSLATE_GENERIC_PARSER_H #define _TRANSLATE_GENERIC_PARSER_H #include typedef struct { char *tag; char **target_tags; } TranslateGenericLanguage; typedef struct { char *name; char *value; } TranslateGenericHttpHeader; typedef struct { char *url; char *post; char *content_type; GSList *http_headers; } TranslateGenericLocation; typedef struct { int ref_count; GSList *languages; GHashTable *service_tags; GSList *http_headers; TranslateGenericLocation *text_location; GSList *text_pre_markers; char *text_post_marker; GSList *text_error_markers; TranslateGenericLocation *web_page_location; } TranslateGenericGroup; void translate_generic_parse (const char *filename); TranslateGenericGroup *translate_generic_group_ref (TranslateGenericGroup *group); void translate_generic_group_unref (TranslateGenericGroup *group); const char *translate_generic_group_get_service_tag (TranslateGenericGroup *group, const char *tag); typedef gboolean (*TranslateGenericGroupForeachPairFunc) (const char *from, const char *to, gpointer user_data); void translate_generic_group_foreach_pair (TranslateGenericGroup *group, TranslateGenericGroupForeachPairFunc func, gpointer user_data); #endif /* _TRANSLATE_GENERIC_PARSER_H */ libtranslate-0.99/src/modules/translate-generic-service.c000644 001750 001750 00000107425 10172765756 025376 0ustar00jylefortjylefort000000 000000 /* * Copyright (C) 2004, 2005 Jean-Yves Lefort * All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in the * documentation and/or other materials provided with the distribution. * 3. Neither the name of Jean-Yves Lefort nor the names of its contributors * may be used to endorse or promote products derived from this software * without specific prior written permission. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND * CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, * INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF * MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE * DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS * BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, * EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED * TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON * ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, * OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY * OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE * POSSIBILITY OF SUCH DAMAGE. */ #include "config.h" #include #include #include #include #include #include #include #include "translate.h" #include "translate-generic-service.h" #include "translate-generic-main.h" #include "translate-generic-parser.h" #include "translate-generic-soup-cookie-jar.h" #define MAKE_WARNING_PREFIX(service, group_pos, attribute, element) \ g_strdup_printf(_("in %s, group %i, \"%s\" attribute of \"%s\" element"), \ translate_service_get_name((service)), \ (group_pos), (attribute), (element)) enum { PROP_0, PROP_GROUPS }; struct _TranslateGenericServicePrivate { GSList *groups; }; typedef struct { GSList **pairs; TranslatePairFlags flags; } GetPairsInfo; typedef struct { gboolean found; const char *from; const char *to; } GetGroupInfo; typedef enum { TRANSFER_FOLLOW_REFRESH = 1 << 0, TRANSFER_CONVERT = 1 << 1 } TransferFlags; typedef enum { HTML_CONTEXT_PRE_HEAD, HTML_CONTEXT_HEAD, HTML_CONTEXT_POST_HEAD } HTMLContext; typedef struct { SoupSession *session; TranslateProgressFunc progress_func; gpointer user_data; unsigned int length; unsigned int received; /* HTML parser */ gboolean parse_html; HTMLContext html_context; GHashTable *html_http_equiv; } TransferInfo; static GObjectClass *parent_class = NULL; static void translate_generic_service_register_type (GType *type); static void translate_generic_service_class_init (TranslateGenericServiceClass *class); static void translate_generic_service_init (TranslateGenericService *service); static void translate_generic_service_finalize (GObject *object); static void translate_generic_service_set_property (GObject *object, unsigned int prop_id, const GValue *value, GParamSpec *pspec); static gboolean translate_generic_service_get_pairs (TranslateService *service, GSList **pairs, TranslateProgressFunc progress_func, gpointer user_data, GError **err); static gboolean translate_generic_service_get_pairs_cb (const char *from, const char *to, gpointer user_data); static TranslateGenericGroup *translate_generic_service_get_group (TranslateGenericService *service, const char *from, const char *to, int *pos); static gboolean translate_generic_service_get_group_cb (const char *from, const char *to, gpointer user_data); static char *translate_generic_service_get (const char *uri, const char *post, const char *post_content_type, const GSList *headers, TransferFlags flags, TranslateProgressFunc progress_func, gpointer user_data, GError **err); static const char *translate_generic_service_get_header (SoupMessage *message, TransferInfo *info, const char *name); static void translate_generic_service_log_connect (SoupMessage *message); static void translate_generic_service_log_wrote_headers_h (SoupMessage *message, gpointer user_data); static void translate_generic_service_log_wrote_body_h (SoupMessage *message, gpointer user_data); static void translate_generic_service_log_got_headers_h (SoupMessage *message, gpointer user_data); static void translate_generic_service_log_got_body_h (SoupMessage *message, gpointer user_data); static void translate_generic_service_log_headers_cb (const char *key, const char *value, gpointer user_data); static void translate_generic_service_progress_got_headers_h (SoupMessage *message, gpointer user_data); static void translate_generic_service_progress_got_chunk_h (SoupMessage *message, gpointer user_data); static void translate_generic_service_html_got_headers_h (SoupMessage *message, gpointer user_data); static void translate_generic_service_html_got_body_h (SoupMessage *message, gpointer user_data); static void translate_generic_service_html_start_element_cb (gpointer user_data, const xmlChar *name, const xmlChar **atts); static void translate_generic_service_html_end_element_cb (gpointer user_data, const xmlChar *name); static void translate_generic_service_refresh_got_body_h (SoupMessage *message, gpointer user_data); static void translate_generic_service_redirect_handler (SoupMessage *message, gpointer user_data); static char *translate_generic_service_translate_text (TranslateService *service, const char *text, const char *from, const char *to, TranslateProgressFunc progress_func, gpointer user_data, GError **err); char *translate_generic_service_expand (const char *warning_prefix, const char *str, ...); static char *translate_generic_service_expand_variable (const char *warning_prefix, const char *variable, GHashTable *subs); static char *translate_generic_service_modify_value (const char *warning_prefix, const char *value, const char *modifier_name, const char *modifier_value); static char *translate_generic_service_translate_web_page (TranslateService *service, const char *url, const char *from, const char *to, TranslateProgressFunc progress_func, gpointer user_data, GError **err); static SoupSession *translate_generic_service_soup_session_sync_new (void); GType translate_generic_service_get_type (void) { static GType type; static GOnce once = G_ONCE_INIT; g_once(&once, (GThreadFunc) translate_generic_service_register_type, &type); return type; } static void translate_generic_service_register_type (GType *type) { static const GTypeInfo info = { sizeof(TranslateGenericServiceClass), NULL, NULL, (GClassInitFunc) translate_generic_service_class_init, NULL, NULL, sizeof(TranslateGenericService), 0, (GInstanceInitFunc) translate_generic_service_init }; *type = g_type_register_static(TRANSLATE_TYPE_SERVICE, "TranslateGenericService", &info, 0); } static void translate_generic_service_class_init (TranslateGenericServiceClass *class) { GObjectClass *object_class = G_OBJECT_CLASS(class); TranslateServiceClass *service_class = TRANSLATE_SERVICE_CLASS(class); g_type_class_add_private(class, sizeof(TranslateGenericServicePrivate)); parent_class = g_type_class_peek_parent(class); object_class->finalize = translate_generic_service_finalize; object_class->set_property = translate_generic_service_set_property; service_class->get_pairs = translate_generic_service_get_pairs; service_class->translate_text = translate_generic_service_translate_text; service_class->translate_web_page = translate_generic_service_translate_web_page; g_object_class_install_property(object_class, PROP_GROUPS, g_param_spec_pointer("groups", NULL, NULL, G_PARAM_WRITABLE | G_PARAM_CONSTRUCT_ONLY)); } static void translate_generic_service_init (TranslateGenericService *service) { service->priv = G_TYPE_INSTANCE_GET_PRIVATE(service, TRANSLATE_GENERIC_TYPE_SERVICE, TranslateGenericServicePrivate); } static void translate_generic_service_finalize (GObject *object) { TranslateGenericService *service = TRANSLATE_GENERIC_SERVICE(object); g_slist_foreach(service->priv->groups, (GFunc) translate_generic_group_unref, NULL); g_slist_free(service->priv->groups); parent_class->finalize(object); } static void translate_generic_service_set_property (GObject *object, unsigned int prop_id, const GValue *value, GParamSpec *pspec) { TranslateGenericService *service = TRANSLATE_GENERIC_SERVICE(object); switch (prop_id) { case PROP_GROUPS: service->priv->groups = g_slist_copy(g_value_get_pointer(value)); g_slist_foreach(service->priv->groups, (GFunc) translate_generic_group_ref, NULL); break; default: G_OBJECT_WARN_INVALID_PROPERTY_ID(object, prop_id, pspec); break; } } static gboolean translate_generic_service_get_pairs (TranslateService *service, GSList **pairs, TranslateProgressFunc progress_func, gpointer user_data, GError **err) { TranslateGenericService *generic = TRANSLATE_GENERIC_SERVICE(service); GetPairsInfo info; GSList *l; info.pairs = pairs; *info.pairs = NULL; for (l = generic->priv->groups; l != NULL; l = l ->next) { TranslateGenericGroup *group = l->data; info.flags = 0; if (group->text_location) info.flags |= TRANSLATE_PAIR_TEXT; if (group->web_page_location) info.flags |= TRANSLATE_PAIR_WEB_PAGE; translate_generic_group_foreach_pair(group, translate_generic_service_get_pairs_cb, &info); } return TRUE; } static gboolean translate_generic_service_get_pairs_cb (const char *from, const char *to, gpointer user_data) { GetPairsInfo *info = user_data; *info->pairs = g_slist_append(*info->pairs, translate_pair_new(info->flags, from, to)); return TRUE; /* continue */ } static TranslateGenericGroup * translate_generic_service_get_group (TranslateGenericService *service, const char *from, const char *to, int *pos) { GSList *l; int _pos; GetGroupInfo info = { FALSE, from, to }; g_return_val_if_fail(TRANSLATE_GENERIC_IS_SERVICE(service), NULL); g_return_val_if_fail(from != NULL, NULL); g_return_val_if_fail(to != NULL, NULL); g_return_val_if_fail(pos != NULL, NULL); for (l = service->priv->groups, _pos = 1; l != NULL; l = l ->next, _pos++) { TranslateGenericGroup *group = l->data; translate_generic_group_foreach_pair(group, translate_generic_service_get_group_cb, &info); if (info.found) { *pos = _pos; return group; } } *pos = -1; return NULL; } static gboolean translate_generic_service_get_group_cb (const char *from, const char *to, gpointer user_data) { GetGroupInfo *info = user_data; if (! g_ascii_strcasecmp(from, info->from) && ! g_ascii_strcasecmp(to, info->to)) { info->found = TRUE; return FALSE; /* abort */ } else return TRUE; /* continue */ } static char * translate_generic_service_get (const char *uri, const char *post, const char *post_content_type, const GSList *headers, TransferFlags flags, TranslateProgressFunc progress_func, gpointer user_data, GError **err) { TransferInfo info; SoupMessage *message; const GSList *l; char *response = NULL; g_return_val_if_fail(uri != NULL, FALSE); message = soup_message_new(post ? SOUP_METHOD_POST : SOUP_METHOD_GET, uri); if (! message) { g_set_error(err, TRANSLATE_GENERIC_SERVICE_ERROR, TRANSLATE_GENERIC_SERVICE_ERROR_TRANSFER, _("unable to parse URI \"%s\""), uri); return NULL; } if (post) { g_return_val_if_fail(post_content_type != NULL, NULL); soup_message_set_request(message, post_content_type, SOUP_BUFFER_USER_OWNED, (char *) post, strlen(post)); } for (l = headers; l != NULL; l = l->next) { TranslateGenericHttpHeader *header = l->data; soup_message_add_header(message->request_headers, header->name, header->value); } info.session = translate_generic_service_soup_session_sync_new(); info.parse_html = FALSE; info.html_http_equiv = NULL; if (translate_generic_debug_flags & TRANSLATE_GENERIC_DEBUG_LOG_TRANSFERS) g_object_connect(message, "signal::wrote-headers", translate_generic_service_log_wrote_headers_h, &info, "signal::wrote-body", translate_generic_service_log_wrote_body_h, &info, "signal::got-headers", translate_generic_service_log_got_headers_h, &info, "signal::got-body", translate_generic_service_log_got_body_h, &info, NULL); if (progress_func) { info.progress_func = progress_func; info.user_data = user_data; info.length = -1; info.received = 0; g_object_connect(message, "signal::got-headers", translate_generic_service_progress_got_headers_h, &info, "signal::got-chunk", translate_generic_service_progress_got_chunk_h, &info, NULL); } /* * We parse the HTML to retrieve the http-equiv meta tags, and we * only need them if we convert or follow refresh. */ if ((flags & TRANSFER_FOLLOW_REFRESH) || (flags & TRANSFER_CONVERT)) g_object_connect(message, "signal::got-headers", translate_generic_service_html_got_headers_h, &info, "signal::got-body", translate_generic_service_html_got_body_h, &info, NULL); if (flags & TRANSFER_FOLLOW_REFRESH) g_signal_connect(message, "got-body", G_CALLBACK(translate_generic_service_refresh_got_body_h), &info); /* http://bugzilla.ximian.com/show_bug.cgi?id=70688 */ soup_message_set_flags(message, SOUP_MESSAGE_NO_REDIRECT); soup_message_add_status_class_handler(message, SOUP_STATUS_CLASS_REDIRECT, SOUP_HANDLER_POST_BODY, translate_generic_service_redirect_handler, info.session); if (translate_generic_debug_flags & TRANSLATE_GENERIC_DEBUG_LOG_TRANSFERS) translate_generic_service_log_connect(message); soup_session_send_message(info.session, message); g_object_unref(info.session); if (SOUP_STATUS_IS_SUCCESSFUL(message->status_code)) { const char *charset = NULL; if (flags & TRANSFER_CONVERT) { const char *content_type; content_type = translate_generic_service_get_header(message, &info, "Content-Type"); if (content_type) { charset = translate_ascii_strcasestr(content_type, "charset="); if (charset) charset += 8; } } if (charset) response = g_convert(message->response.body, message->response.length, "UTF-8", charset, NULL, NULL, err); else { if ((flags & TRANSFER_CONVERT) && ! g_utf8_validate(message->response.body, message->response.length, NULL)) g_set_error(err, TRANSLATE_GENERIC_SERVICE_ERROR, TRANSLATE_GENERIC_SERVICE_ERROR_TRANSFER, _("invalid UTF-8")); else response = g_strndup(message->response.body, message->response.length); } } else { if (message->status_code == SOUP_STATUS_CANCELLED) g_set_error(err, TRANSLATE_ERROR, TRANSLATE_ERROR_CANCELLED, "%s", message->reason_phrase); else g_set_error(err, TRANSLATE_GENERIC_SERVICE_ERROR, TRANSLATE_GENERIC_SERVICE_ERROR_TRANSFER, "%s", message->reason_phrase); } if (info.html_http_equiv) g_hash_table_destroy(info.html_http_equiv); g_object_unref(message); return response; } static const char * translate_generic_service_get_header (SoupMessage *message, TransferInfo *info, const char *name) { const char *value; g_return_val_if_fail(SOUP_IS_MESSAGE(message), NULL); g_return_val_if_fail(info != NULL, NULL); g_return_val_if_fail(name != NULL, NULL); value = info->html_http_equiv ? g_hash_table_lookup(info->html_http_equiv, name) : NULL; if (! value) value = soup_message_get_header(message->response_headers, name); return value; } static void translate_generic_service_log_connect (SoupMessage *message) { const SoupUri *uri; uri = soup_message_get_uri(message); g_log(G_LOG_DOMAIN, G_LOG_LEVEL_DEBUG, _("connecting to %s:%i"), uri->host, uri->port); } static void translate_generic_service_log_wrote_headers_h (SoupMessage *message, gpointer user_data) { const SoupUri *suri; char *uri; suri = soup_message_get_uri(message); uri = soup_uri_to_string(suri, FALSE); g_log(G_LOG_DOMAIN, G_LOG_LEVEL_DEBUG, "> %s %s", message->method, uri); g_free(uri); soup_message_foreach_header(message->request_headers, (GHFunc) translate_generic_service_log_headers_cb, ">"); } static void translate_generic_service_log_wrote_body_h (SoupMessage *message, gpointer user_data) { if (message->request.body) g_log(G_LOG_DOMAIN, G_LOG_LEVEL_DEBUG, "> %s", message->request.body); } static void translate_generic_service_log_got_headers_h (SoupMessage *message, gpointer user_data) { g_log(G_LOG_DOMAIN, G_LOG_LEVEL_DEBUG, "< %s", soup_status_get_phrase(message->status_code)); soup_message_foreach_header(message->response_headers, (GHFunc) translate_generic_service_log_headers_cb, "<"); if (message->response.body) g_log(G_LOG_DOMAIN, G_LOG_LEVEL_DEBUG, "< %s", message->response.body); } static void translate_generic_service_log_got_body_h (SoupMessage *message, gpointer user_data) { if (message->response.body) g_log(G_LOG_DOMAIN, G_LOG_LEVEL_DEBUG, "< %s", message->response.body); } static void translate_generic_service_log_headers_cb (const char *key, const char *value, gpointer user_data) { const char *prefix = user_data; g_log(G_LOG_DOMAIN, G_LOG_LEVEL_DEBUG, "%s %s: %s", prefix, key, value); } static void translate_generic_service_progress_got_headers_h (SoupMessage *message, gpointer user_data) { TransferInfo *info = user_data; const char *content_length; content_length = soup_message_get_header(message->response_headers, "Content-Length"); info->length = (content_length && *content_length && strspn(content_length, "0123456789") == strlen(content_length)) ? atoi(content_length) : -1; info->received = 0; } static void translate_generic_service_progress_got_chunk_h (SoupMessage *message, gpointer user_data) { TransferInfo *info = user_data; double progress; if (info->length == -1) progress = -1; else { info->received += message->response.length; progress = (double) info->received / info->length; progress = CLAMP(progress, 0.0, 1.0); } if (! info->progress_func(progress, info->user_data)) soup_session_abort(info->session); } static void translate_generic_service_html_got_headers_h (SoupMessage *message, gpointer user_data) { TransferInfo *info = user_data; const char *content_type; content_type = soup_message_get_header(message->response_headers, "Content-Type"); info->parse_html = content_type && (g_str_has_prefix(content_type, "text/html") || g_str_has_prefix(content_type, "application/xhtml+xml") || g_str_has_prefix(content_type, "application/xml") || g_str_has_prefix(content_type, "text/xml")); } static void translate_generic_service_html_got_body_h (SoupMessage *message, gpointer user_data) { TransferInfo *info = user_data; if (info->html_http_equiv) { g_hash_table_destroy(info->html_http_equiv); info->html_http_equiv = NULL; } if (info->parse_html && message->response.length > 0) { char *body; xmlSAXHandler sax_handler = { NULL }; info->html_context = HTML_CONTEXT_PRE_HEAD; info->html_http_equiv = g_hash_table_new_full(translate_ascii_strcase_hash, translate_ascii_strcase_equal, g_free, g_free); sax_handler.startElement = translate_generic_service_html_start_element_cb; sax_handler.endElement = translate_generic_service_html_end_element_cb; body = g_strndup(message->response.body, message->response.length); htmlSAXParseDoc(body, NULL, &sax_handler, user_data); g_free(body); } } static void translate_generic_service_html_start_element_cb (gpointer user_data, const xmlChar *name, const xmlChar **atts) { TransferInfo *info = user_data; if (info->html_context == HTML_CONTEXT_PRE_HEAD) { if (! g_ascii_strcasecmp(name, "head")) info->html_context = HTML_CONTEXT_HEAD; } else if (info->html_context == HTML_CONTEXT_HEAD) { if (! g_ascii_strcasecmp(name, "meta")) { int i; const char *http_equiv = NULL; for (i = 0; atts[i] && atts[i + 1]; i += 2) if (! g_ascii_strcasecmp(atts[i], "http-equiv")) { http_equiv = atts[i + 1]; break; } if (http_equiv) { const char *content = NULL; for (i = 0; atts[i] && atts[i + 1]; i += 2) if (! g_ascii_strcasecmp(atts[i], "content")) { content = atts[i + 1]; break; } if (content) g_hash_table_insert(info->html_http_equiv, g_strdup(http_equiv), g_strdup(content)); } } } } static void translate_generic_service_html_end_element_cb (gpointer user_data, const xmlChar *name) { TransferInfo *info = user_data; if (info->html_context == HTML_CONTEXT_HEAD && ! g_ascii_strcasecmp(name, "head")) info->html_context = HTML_CONTEXT_POST_HEAD; } static void translate_generic_service_refresh_got_body_h (SoupMessage *message, gpointer user_data) { TransferInfo *info = user_data; const char *refresh_uri; SoupUri *new_uri = NULL; refresh_uri = translate_generic_service_get_header(message, info, "Refresh"); if (refresh_uri) { refresh_uri = translate_ascii_strcasestr(refresh_uri, "url="); if (refresh_uri) refresh_uri += 4; } if (refresh_uri) { new_uri = soup_uri_new(refresh_uri); if (! new_uri) { const SoupUri *base_uri; base_uri = soup_message_get_uri(message); new_uri = soup_uri_new_with_base(base_uri, refresh_uri); } } if (new_uri) { soup_message_set_uri(message, new_uri); soup_uri_free(new_uri); if (translate_generic_debug_flags & TRANSLATE_GENERIC_DEBUG_LOG_TRANSFERS) translate_generic_service_log_connect(message); soup_session_requeue_message(info->session, message); } } static void translate_generic_service_redirect_handler (SoupMessage *message, gpointer user_data) { const char *new_location; new_location = soup_message_get_header(message->response_headers, "Location"); if (new_location) { SoupSession *session = user_data; SoupUri *new_uri; new_uri = soup_uri_new(new_location); if (! new_uri) { const SoupUri *base_uri; base_uri = soup_message_get_uri(message); new_uri = soup_uri_new_with_base(base_uri, new_location); if (! new_uri) { soup_message_set_status_full(message, SOUP_STATUS_MALFORMED, _("invalid redirect URL")); return; } } soup_message_set_uri(message, new_uri); soup_uri_free(new_uri); if (translate_generic_debug_flags & TRANSLATE_GENERIC_DEBUG_LOG_TRANSFERS) translate_generic_service_log_connect(message); soup_session_requeue_message(session, message); } } static char * translate_generic_service_translate_text (TranslateService *service, const char *text, const char *from, const char *to, TranslateProgressFunc progress_func, gpointer user_data, GError **err) { TranslateGenericService *generic = TRANSLATE_GENERIC_SERVICE(service); TranslateGenericGroup *group; int group_pos; const char *service_from; const char *service_to; char *warning_prefix; char *url; char *post = NULL; GSList *headers; char *response; GString *answer = NULL; group = translate_generic_service_get_group(generic, from, to, &group_pos); g_return_val_if_fail(group != NULL, NULL); service_from = translate_generic_group_get_service_tag(group, from); service_to = translate_generic_group_get_service_tag(group, to); warning_prefix = MAKE_WARNING_PREFIX(service, group_pos, "url", "text-translation"); url = translate_generic_service_expand(warning_prefix, group->text_location->url, "text", text, "from", service_from, "to", service_to, NULL); g_free(warning_prefix); if (group->text_location->post) { warning_prefix = MAKE_WARNING_PREFIX(service, group_pos, "post", "text-translation"); post = translate_generic_service_expand(warning_prefix, group->text_location->post, "text", text, "from", service_from, "to", service_to, NULL); g_free(warning_prefix); } headers = g_slist_copy(group->http_headers); headers = g_slist_concat(headers, g_slist_copy(group->text_location->http_headers)); response = translate_generic_service_get(url, post, group->text_location->content_type, headers, TRANSFER_FOLLOW_REFRESH | TRANSFER_CONVERT, progress_func, user_data, err); g_free(url); g_free(post); g_slist_free(headers); if (response) { const char *work = response; char *error = NULL; GSList *l; for (l = group->text_error_markers; l != NULL && ! error; l = l->next) { const char *marker = l->data; error = strstr(work, marker); } if (error) g_set_error(err, TRANSLATE_GENERIC_SERVICE_ERROR, TRANSLATE_GENERIC_SERVICE_ERROR_FAILED, _("server failure")); else { char *raw = NULL; for (l = group->text_pre_markers; l != NULL && work; l = l->next) { const char *marker = l->data; work = strstr(work, marker); if (work) work += strlen(marker); } if (work) { if (group->text_post_marker) { char *s; s = strstr(work, group->text_post_marker); if (s) raw = g_strndup(work, s - work); } else raw = g_strdup(response); } if (raw) { char *expanded; const char *s; int len; expanded = translate_sgml_ref_expand(raw); g_free(raw); /* * If the service has removed the leading and/or * trailing whitespace, restore it. */ answer = g_string_new(NULL); for (s = text; *s && g_unichar_isspace(g_utf8_get_char(s)); s = g_utf8_next_char(s)); len = s - text; if (len > 0 && strncmp(expanded, text, len)) g_string_append_len(answer, text, len); g_string_append(answer, expanded); if (*s) { /* there was a middle block, handle trailing spaces */ for (s = g_utf8_find_prev_char(text, strchr(text, 0)); s && g_unichar_isspace(g_utf8_get_char(s)); s = g_utf8_find_prev_char(text, s)); s = s ? g_utf8_next_char(s) : text; if (! g_str_has_suffix(expanded, s)) g_string_append(answer, s); } } else g_set_error(err, TRANSLATE_GENERIC_SERVICE_ERROR, TRANSLATE_GENERIC_SERVICE_ERROR_PARSE, _("unable to parse server data")); } g_free(response); } return answer ? g_string_free(answer, FALSE) : NULL; } char * translate_generic_service_expand (const char *warning_prefix, const char *str, ...) { GHashTable *subs; va_list args; const char *name; GString *result; int i; int dollar = -1; g_return_val_if_fail(warning_prefix != NULL, NULL); g_return_val_if_fail(str != NULL, NULL); va_start(args, str); subs = g_hash_table_new(g_str_hash, g_str_equal); while ((name = va_arg(args, const char *))) { const char *value; value = va_arg(args, const char *); g_return_val_if_fail(value != NULL, NULL); g_hash_table_insert(subs, (gpointer) name, (gpointer) value); } result = g_string_new(NULL); for (i = 0; str[i]; i++) if (dollar >= 0) { if (dollar == i - 1) { if (str[i] == '$') { g_string_append_c(result, '$'); dollar = -1; } else if (str[i] != '{') { g_string_append_len(result, str + (i - 1), 2); dollar = -1; } } else { if (str[i] == '}') { int start; char *variable; char *expanded; start = dollar + 2; variable = g_strndup(str + start, i - start); expanded = translate_generic_service_expand_variable(warning_prefix, variable, subs); g_free(variable); if (expanded) { g_string_append(result, expanded); g_free(expanded); } dollar = -1; } } } else { if (str[i] == '$') dollar = i; else g_string_append_c(result, str[i]); } g_hash_table_destroy(subs); va_end(args); return g_string_free(result, FALSE); } static char * translate_generic_service_expand_variable (const char *warning_prefix, const char *variable, GHashTable *subs) { char *s; char *varname; char **modifiers = NULL; char *expanded = NULL; g_return_val_if_fail(warning_prefix != NULL, NULL); g_return_val_if_fail(variable != NULL, NULL); g_return_val_if_fail(subs != NULL, NULL); s = strchr(variable, ':'); if (s) { varname = g_strndup(variable, s - variable); modifiers = g_strsplit(s + 1, ",", 0); } else varname = g_strdup(variable); if (! strcmp(varname, "time")) { time_t now; now = translate_time(); expanded = g_strdup_printf("%ul", now); } else expanded = g_strdup(g_hash_table_lookup(subs, varname)); if (expanded) { if (modifiers) { int i; for (i = 0; modifiers[i]; i++) { char *mod_name; char *mod_value; char *modified; s = strchr(modifiers[i], '='); if (s) { mod_name = g_strndup(modifiers[i], s - modifiers[i]); mod_value = g_strdup(s + 1); } else { mod_name = g_strdup(modifiers[i]); mod_value = NULL; } modified = translate_generic_service_modify_value(warning_prefix, expanded, mod_name, mod_value); g_free(mod_name); g_free(mod_value); g_free(expanded); expanded = modified; } } } else g_warning(_("%s: unknown variable \"%s\""), warning_prefix, varname); g_free(varname); g_strfreev(modifiers); return expanded; } static char * translate_generic_service_modify_value (const char *warning_prefix, const char *value, const char *modifier_name, const char *modifier_value) { char *modified = NULL; g_return_val_if_fail(warning_prefix != NULL, NULL); g_return_val_if_fail(value != NULL, NULL); g_return_val_if_fail(modifier_name != NULL, NULL); if (! strcmp(modifier_name, "escape")) { if (modifier_value) g_warning(_("%s: value specified for \"escape\" modifier"), warning_prefix); modified = soup_uri_encode(value, NULL); } else if (! strcmp(modifier_name, "charset")) { if (modifier_value) { GError *err = NULL; modified = g_convert(value, -1, modifier_value, "UTF-8", NULL, NULL, &err); if (! modified) { g_warning(_("%s: unable to convert to \"%s\": %s"), warning_prefix, modifier_value, err->message); g_error_free(err); } } else g_warning(_("%s: value of \"charset\" modifier missing"), warning_prefix); } else g_warning(_("%s: unknown modifier \"%s\""), warning_prefix, modifier_name); return modified ? modified : g_strdup(value); } static char * translate_generic_service_translate_web_page (TranslateService *service, const char *url, const char *from, const char *to, TranslateProgressFunc progress_func, gpointer user_data, GError **err) { TranslateGenericService *generic = TRANSLATE_GENERIC_SERVICE(service); TranslateGenericGroup *group; int group_pos; const char *service_from; const char *service_to; char *warning_prefix; char *translation_url; char *post = NULL; GSList *headers; char *response; group = translate_generic_service_get_group(generic, from, to, &group_pos); g_return_val_if_fail(group != NULL, NULL); service_from = translate_generic_group_get_service_tag(group, from); service_to = translate_generic_group_get_service_tag(group, to); warning_prefix = MAKE_WARNING_PREFIX(service, group_pos, "url", "web-page-translation"); translation_url = translate_generic_service_expand(warning_prefix, group->web_page_location->url, "url", url, "from", service_from, "to", service_to, NULL); g_free(warning_prefix); headers = g_slist_copy(group->http_headers); headers = g_slist_concat(headers, g_slist_copy(group->web_page_location->http_headers)); if (group->web_page_location->post) { warning_prefix = MAKE_WARNING_PREFIX(service, group_pos, "post", "web-page-translation"); post = translate_generic_service_expand(warning_prefix, group->web_page_location->post, "url", url, "from", service_from, "to", service_to, NULL); g_free(warning_prefix); } else if (! headers) return translation_url; response = translate_generic_service_get(translation_url, post, group->web_page_location->content_type, headers, 0, progress_func, user_data, err); g_free(translation_url); translation_url = NULL; g_free(post); g_slist_free(headers); if (response) { int fd; char *filename; fd = g_file_open_tmp("libtranslate.XXXXXX", &filename, err); if (fd >= 0) { GIOChannel *channel; channel = g_io_channel_unix_new(fd); if (g_io_channel_set_encoding(channel, NULL, err) && g_io_channel_write_chars(channel, response, -1, NULL, err)) { if (g_io_channel_shutdown(channel, TRUE, err)) translation_url = g_strconcat("file://", filename, NULL); } else g_io_channel_shutdown(channel, FALSE, NULL); g_io_channel_unref(channel); g_free(filename); } g_free(response); } return translation_url; } static SoupSession * translate_generic_service_soup_session_sync_new (void) { char *proxy_text_uri; SoupUri *proxy_uri = NULL; SoupSession *session; TranslateGenericSoupCookieJar *cookie_jar; proxy_text_uri = translate_get_proxy(); if (proxy_text_uri) { proxy_uri = soup_uri_new(proxy_text_uri); if (! proxy_uri) g_warning(_("unable to parse proxy URI \"%s\""), proxy_text_uri); g_free(proxy_text_uri); } session = soup_session_sync_new_with_options(SOUP_SESSION_PROXY_URI, proxy_uri, NULL); if (proxy_uri) soup_uri_free(proxy_uri); cookie_jar = translate_generic_soup_cookie_jar_new(); soup_session_add_filter(session, SOUP_MESSAGE_FILTER(cookie_jar)); g_object_unref(cookie_jar); return session; } TranslateService * translate_generic_service_new (const char *name, const char *nick, unsigned int max_chunk_len, const GSList *groups) { g_return_val_if_fail(name != NULL, NULL); g_return_val_if_fail(nick != NULL, NULL); return g_object_new(TRANSLATE_GENERIC_TYPE_SERVICE, "name", name, "nick", nick, "max-chunk-len", max_chunk_len, "groups", groups, NULL); } GQuark translate_generic_service_error_quark (void) { return g_quark_from_static_string("translate-service-generic-error"); } libtranslate-0.99/src/modules/translate-generic-service.h000644 001750 001750 00000006546 10172765765 025405 0ustar00jylefortjylefort000000 000000 /* * Copyright (C) 2004, 2005 Jean-Yves Lefort * All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in the * documentation and/or other materials provided with the distribution. * 3. Neither the name of Jean-Yves Lefort nor the names of its contributors * may be used to endorse or promote products derived from this software * without specific prior written permission. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND * CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, * INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF * MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE * DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS * BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, * EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED * TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON * ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, * OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY * OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE * POSSIBILITY OF SUCH DAMAGE. */ #ifndef _TRANSLATE_GENERIC_SERVICE_H #define _TRANSLATE_GENERIC_SERVICE_H #include "translate-service.h" #include "translate-generic-parser.h" #define TRANSLATE_GENERIC_TYPE_SERVICE (translate_generic_service_get_type()) #define TRANSLATE_GENERIC_SERVICE(obj) (G_TYPE_CHECK_INSTANCE_CAST((obj), TRANSLATE_GENERIC_TYPE_SERVICE, TranslateGenericService)) #define TRANSLATE_GENERIC_SERVICE_CLASS(klass) (G_TYPE_CHECK_CLASS_CAST((klass), TRANSLATE_GENERIC_TYPE_SERVICE, TranslateGenericServiceClass)) #define TRANSLATE_GENERIC_IS_SERVICE(obj) (G_TYPE_CHECK_INSTANCE_TYPE((obj), TRANSLATE_GENERIC_TYPE_SERVICE)) #define TRANSLATE_GENERIC_IS_SERVICE_CLASS(klass) (G_TYPE_CHECK_CLASS_TYPE((klass), TRANSLATE_GENERIC_TYPE_SERVICE)) #define TRANSLATE_GENERIC_SERVICE_GET_CLASS(obj) (G_TYPE_INSTANCE_GET_CLASS((obj), TRANSLATE_GENERIC_TYPE_SERVICE, TranslateGenericServiceClass)) typedef struct _TranslateGenericService TranslateGenericService; typedef struct _TranslateGenericServiceClass TranslateGenericServiceClass; typedef struct _TranslateGenericServicePrivate TranslateGenericServicePrivate; struct _TranslateGenericService { TranslateService parent; TranslateGenericServicePrivate *priv; }; struct _TranslateGenericServiceClass { TranslateServiceClass parent; }; typedef enum { TRANSLATE_GENERIC_SERVICE_ERROR_TRANSFER, TRANSLATE_GENERIC_SERVICE_ERROR_PARSE, TRANSLATE_GENERIC_SERVICE_ERROR_FAILED } TranslateGenericServiceError; #define TRANSLATE_GENERIC_SERVICE_ERROR translate_generic_service_error_quark() GQuark translate_generic_service_error_quark (void); GType translate_generic_service_get_type (void); TranslateService *translate_generic_service_new (const char *name, const char *nick, unsigned int max_chunk_len, const GSList *groups); #endif /* _TRANSLATE_GENERIC_SERVICE_H */ libtranslate-0.99/src/modules/translate-generic-soup-cookie-jar.c000644 001750 001750 00000012662 10172765775 026744 0ustar00jylefortjylefort000000 000000 /* * Copyright (C) 2004, 2005 Jean-Yves Lefort * All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in the * documentation and/or other materials provided with the distribution. * 3. Neither the name of Jean-Yves Lefort nor the names of its contributors * may be used to endorse or promote products derived from this software * without specific prior written permission. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND * CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, * INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF * MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE * DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS * BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, * EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED * TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON * ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, * OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY * OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE * POSSIBILITY OF SUCH DAMAGE. */ #include #include #include #include "translate-generic-soup-cookie-jar.h" struct _TranslateGenericSoupCookieJarPrivate { GSList *cookies; }; static GObjectClass *parent_class = NULL; static void translate_generic_soup_cookie_jar_register_type (GType *type); static void translate_generic_soup_cookie_jar_class_init (TranslateGenericSoupCookieJarClass *class); static void translate_generic_soup_cookie_jar_init (TranslateGenericSoupCookieJar *jar); static void translate_generic_soup_cookie_jar_filter_init (SoupMessageFilterClass *iface); static void translate_generic_soup_cookie_jar_finalize (GObject *object); static void translate_generic_soup_cookie_jar_setup_message (SoupMessageFilter *filter, SoupMessage *message); GType translate_generic_soup_cookie_jar_get_type (void) { static GType type; static GOnce once = G_ONCE_INIT; g_once(&once, (GThreadFunc) translate_generic_soup_cookie_jar_register_type, &type); return type; } static void translate_generic_soup_cookie_jar_register_type (GType *type) { static const GTypeInfo info = { sizeof(TranslateGenericSoupCookieJarClass), NULL, NULL, (GClassInitFunc) translate_generic_soup_cookie_jar_class_init, NULL, NULL, sizeof(TranslateGenericSoupCookieJar), 0, (GInstanceInitFunc) translate_generic_soup_cookie_jar_init }; static const GInterfaceInfo filter_info = { (GInterfaceInitFunc) translate_generic_soup_cookie_jar_filter_init, NULL, NULL }; *type = g_type_register_static(G_TYPE_OBJECT, "TranslateGenericSoupCookieJar", &info, 0); g_type_add_interface_static(*type, SOUP_TYPE_MESSAGE_FILTER, &filter_info); } static void translate_generic_soup_cookie_jar_class_init (TranslateGenericSoupCookieJarClass *class) { GObjectClass *object_class = G_OBJECT_CLASS(class); g_type_class_add_private(class, sizeof(TranslateGenericSoupCookieJarPrivate)); parent_class = g_type_class_peek_parent(class); object_class->finalize = translate_generic_soup_cookie_jar_finalize; } static void translate_generic_soup_cookie_jar_init (TranslateGenericSoupCookieJar *jar) { jar->priv = G_TYPE_INSTANCE_GET_PRIVATE(jar, TRANSLATE_GENERIC_TYPE_SOUP_COOKIE_JAR, TranslateGenericSoupCookieJarPrivate); } static void translate_generic_soup_cookie_jar_filter_init (SoupMessageFilterClass *iface) { iface->setup_message = translate_generic_soup_cookie_jar_setup_message; } static void translate_generic_soup_cookie_jar_finalize (GObject *object) { TranslateGenericSoupCookieJar *jar = TRANSLATE_GENERIC_SOUP_COOKIE_JAR(object); g_slist_foreach(jar->priv->cookies, (GFunc) g_free, NULL); g_slist_free(jar->priv->cookies); parent_class->finalize(object); } static void translate_generic_soup_cookie_jar_setup_message (SoupMessageFilter *filter, SoupMessage *message) { TranslateGenericSoupCookieJar *jar = TRANSLATE_GENERIC_SOUP_COOKIE_JAR(filter); const GSList *cookies; const GSList *l; /* FIXME: add full RFC 2965 support */ cookies = soup_message_get_header_list(message->response_headers, "Set-Cookie"); for (l = cookies; l != NULL; l = l->next) { const char *cookie = l->data; char *s; s = strchr(cookie, ';'); if (s) jar->priv->cookies = g_slist_append(jar->priv->cookies, g_strndup(cookie, s - cookie)); } if (jar->priv->cookies) { GString *string; string = g_string_new(NULL); for (l = jar->priv->cookies; l != NULL; l = l->next) { const char *cookie = l->data; g_string_append(string, cookie); if (l->next) g_string_append(string, "; "); } soup_message_add_header(message->request_headers, "Cookie", string->str); g_string_free(string, TRUE); } } TranslateGenericSoupCookieJar * translate_generic_soup_cookie_jar_new (void) { return g_object_new(TRANSLATE_GENERIC_TYPE_SOUP_COOKIE_JAR, NULL); } libtranslate-0.99/src/modules/translate-generic-soup-cookie-jar.h000644 001750 001750 00000006156 10172766004 026734 0ustar00jylefortjylefort000000 000000 /* * Copyright (C) 2004, 2005 Jean-Yves Lefort * All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in the * documentation and/or other materials provided with the distribution. * 3. Neither the name of Jean-Yves Lefort nor the names of its contributors * may be used to endorse or promote products derived from this software * without specific prior written permission. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND * CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, * INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF * MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE * DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS * BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, * EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED * TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON * ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, * OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY * OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE * POSSIBILITY OF SUCH DAMAGE. */ #ifndef _TRANSLATE_GENERIC_SOUP_COOKIE_JAR_H #define _TRANSLATE_GENERIC_SOUP_COOKIE_JAR_H #include #define TRANSLATE_GENERIC_TYPE_SOUP_COOKIE_JAR (translate_generic_soup_cookie_jar_get_type()) #define TRANSLATE_GENERIC_SOUP_COOKIE_JAR(obj) (G_TYPE_CHECK_INSTANCE_CAST((obj), TRANSLATE_GENERIC_TYPE_SOUP_COOKIE_JAR, TranslateGenericSoupCookieJar)) #define TRANSLATE_GENERIC_SOUP_COOKIE_JAR_CLASS(klass) (G_TYPE_CHECK_CLASS_CAST((klass), TRANSLATE_GENERIC_TYPE_SOUP_COOKIE_JAR, TranslateGenericSoupCookieJarClass)) #define TRANSLATE_GENERIC_IS_SOUP_COOKIE_JAR(obj) (G_TYPE_CHECK_INSTANCE_TYPE((obj), TRANSLATE_GENERIC_TYPE_SOUP_COOKIE_JAR)) #define TRANSLATE_GENERIC_IS_SOUP_COOKIE_JAR_CLASS(klass) (G_TYPE_CHECK_CLASS_TYPE((klass), TRANSLATE_GENERIC_TYPE_SOUP_COOKIE_JAR)) #define TRANSLATE_GENERIC_SOUP_COOKIE_JAR_GET_CLASS(obj) (G_TYPE_INSTANCE_GET_CLASS((obj), TRANSLATE_GENERIC_TYPE_SOUP_COOKIE_JAR, TranslateGenericSoupCookieJarClass)) typedef struct _TranslateGenericSoupCookieJar TranslateGenericSoupCookieJar; typedef struct _TranslateGenericSoupCookieJarClass TranslateGenericSoupCookieJarClass; typedef struct _TranslateGenericSoupCookieJarPrivate TranslateGenericSoupCookieJarPrivate; struct _TranslateGenericSoupCookieJar { GObject parent; TranslateGenericSoupCookieJarPrivate *priv; }; struct _TranslateGenericSoupCookieJarClass { GObjectClass parent; }; GType translate_generic_soup_cookie_jar_get_type (void); TranslateGenericSoupCookieJar *translate_generic_soup_cookie_jar_new (void); #endif /* _TRANSLATE_GENERIC_SOUP_COOKIE_JAR_H */ libtranslate-0.99/src/modules/translate-talkfilters.c000644 001750 001750 00000015141 10172766011 024622 0ustar00jylefortjylefort000000 000000 /* * Copyright (C) 2004, 2005 Jean-Yves Lefort * All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in the * documentation and/or other materials provided with the distribution. * 3. Neither the name of Jean-Yves Lefort nor the names of its contributors * may be used to endorse or promote products derived from this software * without specific prior written permission. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND * CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, * INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF * MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE * DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS * BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, * EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED * TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON * ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, * OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY * OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE * POSSIBILITY OF SUCH DAMAGE. */ #include "config.h" #include #include #include #include #include "translate.h" #define TAG_FROM_FILTER_NAME(filter_name) (g_strconcat("en-x-", (filter_name), NULL)) #define FILTER_NAME_FROM_TAG(tag) ((tag) + 5) #define TRANSLATE_TALKFILTERS_TYPE_SERVICE (translate_talkfilters_service_get_type()) #define TRANSLATE_TALKFILTERS_SERVICE(obj) (G_TYPE_CHECK_INSTANCE_CAST((obj), TRANSLATE_TALKFILTERS_TYPE_SERVICE, TranslateTalkfiltersService)) #define TRANSLATE_TALKFILTERS_SERVICE_CLASS(klass) (G_TYPE_CHECK_CLASS_CAST((klass), TRANSLATE_TALKFILTERS_TYPE_SERVICE, TranslateTalkfiltersServiceClass)) #define TRANSLATE_TALKFILTERS_IS_SERVICE(obj) (G_TYPE_CHECK_INSTANCE_TYPE((obj), TRANSLATE_TALKFILTERS_TYPE_SERVICE)) #define TRANSLATE_TALKFILTERS_IS_SERVICE_CLASS(klass) (G_TYPE_CHECK_CLASS_TYPE((klass), TRANSLATE_TALKFILTERS_TYPE_SERVICE)) #define TRANSLATE_TALKFILTERS_SERVICE_GET_CLASS(obj) (G_TYPE_INSTANCE_GET_CLASS((obj), TRANSLATE_TALKFILTERS_TYPE_SERVICE, TranslateTalkfiltersServiceClass)) typedef struct _TranslateTalkfiltersService TranslateTalkfiltersService; typedef struct _TranslateTalkfiltersServiceClass TranslateTalkfiltersServiceClass; struct _TranslateTalkfiltersService { TranslateService parent; }; struct _TranslateTalkfiltersServiceClass { TranslateServiceClass parent; }; static GType translate_talkfilters_service_get_type (void); static void translate_talkfilters_service_register_type (GType *type); static void translate_talkfilters_service_class_init (TranslateTalkfiltersServiceClass *class); static gboolean translate_talkfilters_service_get_pairs (TranslateService *service, GSList **pairs, TranslateProgressFunc progress_func, gpointer user_data, GError **err); static char *translate_talkfilters_service_translate_text (TranslateService *service, const char *text, const char *from, const char *to, TranslateProgressFunc progress_func, gpointer user_data, GError **err); static GType translate_talkfilters_service_get_type (void) { static GType type; static GOnce once = G_ONCE_INIT; g_once(&once, (GThreadFunc) translate_talkfilters_service_register_type, &type); return type; } static void translate_talkfilters_service_register_type (GType *type) { static const GTypeInfo info = { sizeof(TranslateTalkfiltersServiceClass), NULL, NULL, (GClassInitFunc) translate_talkfilters_service_class_init, NULL, NULL, sizeof(TranslateTalkfiltersService), 0, NULL }; *type = g_type_register_static(TRANSLATE_TYPE_SERVICE, "TranslateTalkfiltersService", &info, 0); } static void translate_talkfilters_service_class_init (TranslateTalkfiltersServiceClass *class) { TranslateServiceClass *service_class = TRANSLATE_SERVICE_CLASS(class); service_class->get_pairs = translate_talkfilters_service_get_pairs; service_class->translate_text = translate_talkfilters_service_translate_text; } static gboolean translate_talkfilters_service_get_pairs (TranslateService *service, GSList **pairs, TranslateProgressFunc progress_func, gpointer user_data, GError **err) { int n_filters; const gtf_filter_t *f; int i; *pairs = NULL; n_filters = gtf_filter_count(); for (f = gtf_filter_list(), i = 0; i < n_filters; f++, i++) { char *to_tag; to_tag = TAG_FROM_FILTER_NAME(f->name); *pairs = g_slist_append(*pairs, translate_pair_new(TRANSLATE_PAIR_TEXT, "en", to_tag)); g_free(to_tag); } return TRUE; } static char * translate_talkfilters_service_translate_text (TranslateService *service, const char *text, const char *from, const char *to, TranslateProgressFunc progress_func, gpointer user_data, GError **err) { const gtf_filter_t *filter; char *translated; unsigned long len; /* the talkfilters documentation states that filters are not reentrant */ G_LOCK_DEFINE_STATIC(filters); filter = gtf_filter_lookup(FILTER_NAME_FROM_TAG(to)); g_return_val_if_fail(filter != NULL, NULL); len = strlen(text) + 1; translated = g_new(char, len); G_LOCK(filters); while (filter->filter(text, translated, len) == 1) translated = g_renew(char, translated, len += 1024); G_UNLOCK(filters); return translated; } G_MODULE_EXPORT gboolean translate_module_init (GError **err) { int n_filters; const gtf_filter_t *f; int i; TranslateService *service; /* register languages */ n_filters = gtf_filter_count(); for (f = gtf_filter_list(), i = 0; i < n_filters; f++, i++) { char *tag; char *name; tag = TAG_FROM_FILTER_NAME(f->name); name = g_strdup_printf(_("English (%s)"), f->desc); translate_add_language(tag, name); g_free(tag); g_free(name); } /* add service */ service = g_object_new(TRANSLATE_TALKFILTERS_TYPE_SERVICE, "name", "talkfilters", "nick", "GNU Talk Filters", NULL); translate_add_service(service); g_object_unref(service); return TRUE; } libtranslate-0.99/autotools.conf000644 001750 001750 00000000514 10170047570 020576 0ustar00jylefortjylefort000000 000000 export AUTOCONF_VER=259 export AUTOMAKE_VER=19 export LIBTOOL_VER=15 export LIBTOOLIZE="libtoolize$LIBTOOL_VER --automake" export ACLOCAL="aclocal$AUTOMAKE_VER -I m4" export AUTOHEADER="autoheader$AUTOCONF_VER" export AUTOM4TE="autom4te$AUTOCONF_VER" export AUTOCONF="autoconf$AUTOCONF_VER" export AUTOMAKE="automake$AUTOMAKE_VER" libtranslate-0.99/intltool-extract.in000644 001750 001750 00000033143 10165775757 021571 0ustar00jylefortjylefort000000 000000 #!@INTLTOOL_PERL@ -w # -*- Mode: perl; indent-tabs-mode: nil; c-basic-offset: 4 -*- # # The Intltool Message Extractor # # Copyright (C) 2000-2001, 2003 Free Software Foundation. # # Intltool is free software; you can redistribute it and/or # modify it under the terms of the GNU General Public License as # published by the Free Software Foundation; either version 2 of the # License, or (at your option) any later version. # # Intltool is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU # General Public License for more details. # # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. # # As a special exception to the GNU General Public License, if you # distribute this file as part of a program that contains a # configuration script generated by Autoconf, you may include it under # the same distribution terms that you use for the rest of that program. # # Authors: Kenneth Christiansen # Darin Adler # ## Release information my $PROGRAM = "intltool-extract"; my $PACKAGE = "intltool"; my $VERSION = "0.32.1"; ## Loaded modules use strict; use File::Basename; use Getopt::Long; ## Scalars used by the option stuff my $TYPE_ARG = "0"; my $LOCAL_ARG = "0"; my $HELP_ARG = "0"; my $VERSION_ARG = "0"; my $UPDATE_ARG = "0"; my $QUIET_ARG = "0"; my $SRCDIR_ARG = "."; my $FILE; my $OUTFILE; my $gettext_type = ""; my $input; my %messages = (); my %loc = (); my %count = (); my %comments = (); my $strcount = 0; ## Use this instead of \w for XML files to handle more possible characters. my $w = "[-A-Za-z0-9._:]"; ## Always print first $| = 1; ## Handle options GetOptions ( "type=s" => \$TYPE_ARG, "local|l" => \$LOCAL_ARG, "help|h" => \$HELP_ARG, "version|v" => \$VERSION_ARG, "update" => \$UPDATE_ARG, "quiet|q" => \$QUIET_ARG, "srcdir=s" => \$SRCDIR_ARG, ) or &error; &split_on_argument; ## Check for options. ## This section will check for the different options. sub split_on_argument { if ($VERSION_ARG) { &version; } elsif ($HELP_ARG) { &help; } elsif ($LOCAL_ARG) { &place_local; &extract; } elsif ($UPDATE_ARG) { &place_normal; &extract; } elsif (@ARGV > 0) { &place_normal; &message; &extract; } else { &help; } } sub place_normal { $FILE = $ARGV[0]; $OUTFILE = "$FILE.h"; } sub place_local { $OUTFILE = fileparse($FILE, ()); if (!-e "tmp/") { system("mkdir tmp/"); } $OUTFILE = "./tmp/$OUTFILE.h" } sub determine_type { if ($TYPE_ARG =~ /^gettext\/(.*)/) { $gettext_type=$1 } } ## Sub for printing release information sub version{ print <<_EOF_; ${PROGRAM} (${PACKAGE}) $VERSION Copyright (C) 2000, 2003 Free Software Foundation, Inc. Written by Kenneth Christiansen, 2000. This is free software; see the source for copying conditions. There is NO warranty; not even for MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. _EOF_ exit; } ## Sub for printing usage information sub help { print <<_EOF_; Usage: ${PROGRAM} [OPTION]... [FILENAME] Generates a header file from an XML source file. It grabs all strings between <_translatable_node> and its end tag in XML files. Read manpage (man ${PROGRAM}) for more info. --type=TYPE Specify the file type of FILENAME. Currently supports: "gettext/glade", "gettext/ini", "gettext/keys" "gettext/rfc822deb", "gettext/schemas", "gettext/scheme", "gettext/xml" -l, --local Writes output into current working directory (conflicts with --update) --update Writes output into the same directory the source file reside (conflicts with --local) --srcdir Root of the source tree -v, --version Output version information and exit -h, --help Display this help and exit -q, --quiet Quiet mode Report bugs to http://bugzilla.gnome.org/ (product name "$PACKAGE") or send email to . _EOF_ exit; } ## Sub for printing error messages sub error{ print STDERR "Try `${PROGRAM} --help' for more information.\n"; exit; } sub message { print "Generating C format header file for translation.\n" unless $QUIET_ARG; } sub extract { &determine_type; &convert; open OUT, ">$OUTFILE"; &msg_write; close OUT; print "Wrote $OUTFILE\n" unless $QUIET_ARG; } sub convert { ## Reading the file { local (*IN); local $/; #slurp mode open (IN, "<$SRCDIR_ARG/$FILE") || die "can't open $SRCDIR_ARG/$FILE: $!"; $input = ; } &type_ini if $gettext_type eq "ini"; &type_keys if $gettext_type eq "keys"; &type_xml if $gettext_type eq "xml"; &type_glade if $gettext_type eq "glade"; &type_scheme if $gettext_type eq "scheme"; &type_schemas if $gettext_type eq "schemas"; &type_rfc822deb if $gettext_type eq "rfc822deb"; } sub entity_decode_minimal { local ($_) = @_; s/'/'/g; # ' s/"/"/g; # " s/&/&/g; return $_; } sub entity_decode { local ($_) = @_; s/'/'/g; # ' s/"/"/g; # " s/&/&/g; s/<//g; return $_; } sub escape_char { return '\"' if $_ eq '"'; return '\n' if $_ eq "\n"; return '\\' if $_ eq '\\'; return $_; } sub escape { my ($string) = @_; return join "", map &escape_char, split //, $string; } sub type_ini { ### For generic translatable desktop files ### while ($input =~ /^_.*=(.*)$/mg) { $messages{$1} = []; } } sub type_keys { ### For generic translatable mime/keys files ### while ($input =~ /^\s*_\w+=(.*)$/mg) { $messages{$1} = []; } } sub type_xml { ### For generic translatable XML files ### while ($input =~ /(?:[^\n]*\n?[^\n]*)?\s_$w+\s*=\s*\"([^"]+)\"/sg) { # " $messages{entity_decode_minimal($2)} = []; $comments{entity_decode_minimal($2)} = $1 if (defined($1)); } while ($input =~ /(?:\s*)?<_($w+)(?: xml:space="($w+)")?[^>]*>(.+?)<\/_\2>/sg) { $_ = $4; if (!defined($3) || $3 ne "preserve") { s/\s+/ /g; s/^ //; s/ $//; } $messages{$_} = []; $comments{$_} = $1 if (defined($1)); } } sub type_schemas { ### For schemas XML files ### # FIXME: We should handle escaped < (less than) while ($input =~ / \s* (\s*(?:\s*)?(.*?)\s*<\/default>\s*)? (\s*(?:\s*)?(.*?)\s*<\/short>\s*)? (\s*(?:\s*)?(.*?)\s*<\/long>\s*)? <\/locale> /sgx) { my @totranslate = ($3,$6,$9); my @eachcomment = ($2,$5,$8); foreach (@totranslate) { my $currentcomment = shift @eachcomment; next if !$_; s/\s+/ /g; $messages{entity_decode_minimal($_)} = []; $comments{entity_decode_minimal($_)} = $currentcomment if (defined($currentcomment)); } } } sub type_rfc822deb { ### For rfc822-style Debian configuration files ### my $lineno = 1; my $type = ''; while ($input =~ /\G(.*?)(^|\n)(_+)([^:]+):[ \t]*(.*?)(?=\n\S|$)/sg) { my ($pre, $newline, $underscore, $tag, $text) = ($1, $2, $3, $4, $5); while ($pre =~ m/\n/g) { $lineno ++; } $lineno += length($newline); my @str_list = rfc822deb_split(length($underscore), $text); for my $str (@str_list) { $strcount++; $messages{$str} = []; $loc{$str} = $lineno; $count{$str} = $strcount; my $usercomment = ''; while($pre =~ s/(^|\n)#([^\n]*)$//s) { $usercomment = "\n" . $2 . $usercomment; } $comments{$str} = $tag . $usercomment; } $lineno += ($text =~ s/\n//g); } } sub rfc822deb_split { # Debian defines a special way to deal with rfc822-style files: # when a value contain newlines, it consists of # 1. a short form (first line) # 2. a long description, all lines begin with a space, # and paragraphs are separated by a single dot on a line # This routine returns an array of all paragraphs, and reformat # them. # When first argument is 2, the string is a comma separated list of # values. my $type = shift; my $text = shift; $text =~ s/^[ \t]//mg; return (split(/, */, $text, 0)) if $type ne 1; return ($text) if $text !~ /\n/; $text =~ s/([^\n]*)\n//; my @list = ($1); my $str = ''; for my $line (split (/\n/, $text)) { chomp $line; if ($line =~ /^\.\s*$/) { # New paragraph $str =~ s/\s*$//; push(@list, $str); $str = ''; } elsif ($line =~ /^\s/) { # Line which must not be reformatted $str .= "\n" if length ($str) && $str !~ /\n$/; $line =~ s/\s+$//; $str .= $line."\n"; } else { # Continuation line, remove newline $str .= " " if length ($str) && $str !~ /\n$/; $str .= $line; } } $str =~ s/\s*$//; push(@list, $str) if length ($str); return @list; } sub type_glade { ### For translatable Glade XML files ### my $tags = "label|title|text|format|copyright|comments|preview_text|tooltip|message"; while ($input =~ /<($tags)>([^<]+)<\/($tags)>/sg) { # Glade sometimes uses tags that normally mark translatable things for # little bits of non-translatable content. We work around this by not # translating strings that only includes something like label4 or window1. $messages{entity_decode($2)} = [] unless $2 =~ /^(window|label|dialog)[0-9]+$/; } while ($input =~ /(..[^<]*)<\/items>/sg) { for my $item (split (/\n/, $1)) { $messages{entity_decode($item)} = []; } } ## handle new glade files while ($input =~ /<(property|atkproperty)\s+[^>]*translatable\s*=\s*"yes"(?:\s+[^>]*comments\s*=\s*"([^"]*)")?[^>]*>([^<]+)<\/\1>/sg) { $messages{entity_decode($3)} = [] unless $3 =~ /^(window|label)[0-9]+$/; if (defined($2) and !($3 =~ /^(window|label)[0-9]+$/)) { $comments{entity_decode($3)} = entity_decode($2) ; } } while ($input =~ /]*)"\s+description="([^>]+)"\/>/sg) { $messages{entity_decode_minimal($2)} = []; } } sub type_scheme { my ($line, $i, $state, $str, $trcomment, $char); for $line (split(/\n/, $input)) { $i = 0; $state = 0; # 0 - nothing, 1 - string, 2 - translatable string while ($i < length($line)) { if (substr($line,$i,1) eq "\"") { if ($state == 2) { $comments{$str} = $trcomment if ($trcomment); $messages{$str} = []; $str = ''; $state = 0; $trcomment = ""; } elsif ($state == 1) { $str = ''; $state = 0; $trcomment = ""; } else { $state = 1; $str = ''; if ($i>0 && substr($line,$i-1,1) eq '_') { $state = 2; } } } elsif (!$state) { if (substr($line,$i,1) eq ";") { $trcomment = substr($line,$i+1); $trcomment =~ s/^;*\s*//; $i = length($line); } elsif ($trcomment && substr($line,$i,1) !~ /\s|\(|\)|_/) { $trcomment = ""; } } else { if (substr($line,$i,1) eq "\\") { $char = substr($line,$i+1,1); if ($char ne "\"" && $char ne "\\") { $str = $str . "\\"; } $i++; } $str = $str . substr($line,$i,1); } $i++; } } } sub msg_write { my @msgids; if (%count) { @msgids = sort { $count{$a} <=> $count{$b} } keys %count; } else { @msgids = sort keys %messages; } for my $message (@msgids) { my $offsetlines = 1; $offsetlines++ if $message =~ /%/; if (defined ($comments{$message})) { while ($comments{$message} =~ m/\n/g) { $offsetlines++; } } print OUT "# ".($loc{$message} - $offsetlines). " \"$FILE\"\n" if defined $loc{$message}; print OUT "/* ".$comments{$message}." */\n" if defined $comments{$message}; print OUT "/* xgettext:no-c-format */\n" if $message =~ /%/; my @lines = split (/\n/, $message, -1); for (my $n = 0; $n < @lines; $n++) { if ($n == 0) { print OUT "char *s = N_(\""; } else { print OUT " \""; } print OUT escape($lines[$n]); if ($n < @lines - 1) { print OUT "\\n\"\n"; } else { print OUT "\");\n"; } } } } libtranslate-0.99/intltool-merge.in000644 001750 001750 00000075760 10165775762 021225 0ustar00jylefortjylefort000000 000000 #!@INTLTOOL_PERL@ -w # -*- Mode: perl; indent-tabs-mode: nil; c-basic-offset: 4 -*- # # The Intltool Message Merger # # Copyright (C) 2000, 2003 Free Software Foundation. # Copyright (C) 2000, 2001 Eazel, Inc # # Intltool is free software; you can redistribute it and/or # modify it under the terms of the GNU General Public License # version 2 published by the Free Software Foundation. # # Intltool is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU # General Public License for more details. # # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. # # As a special exception to the GNU General Public License, if you # distribute this file as part of a program that contains a # configuration script generated by Autoconf, you may include it under # the same distribution terms that you use for the rest of that program. # # Authors: Maciej Stachowiak # Kenneth Christiansen # Darin Adler # # Proper XML UTF-8'ification written by Cyrille Chepelov # ## Release information my $PROGRAM = "intltool-merge"; my $PACKAGE = "intltool"; my $VERSION = "0.32.1"; ## Loaded modules use strict; use Getopt::Long; use Text::Wrap; use File::Basename; my $must_end_tag = -1; my $last_depth = -1; my $translation_depth = -1; my @tag_stack = (); my @entered_tag = (); my @translation_strings = (); my $leading_space = ""; ## Scalars used by the option stuff my $HELP_ARG = 0; my $VERSION_ARG = 0; my $BA_STYLE_ARG = 0; my $XML_STYLE_ARG = 0; my $KEYS_STYLE_ARG = 0; my $DESKTOP_STYLE_ARG = 0; my $SCHEMAS_STYLE_ARG = 0; my $RFC822DEB_STYLE_ARG = 0; my $QUIET_ARG = 0; my $PASS_THROUGH_ARG = 0; my $UTF8_ARG = 0; my $MULTIPLE_OUTPUT = 0; my $cache_file; ## Handle options GetOptions ( "help" => \$HELP_ARG, "version" => \$VERSION_ARG, "quiet|q" => \$QUIET_ARG, "oaf-style|o" => \$BA_STYLE_ARG, ## for compatibility "ba-style|b" => \$BA_STYLE_ARG, "xml-style|x" => \$XML_STYLE_ARG, "keys-style|k" => \$KEYS_STYLE_ARG, "desktop-style|d" => \$DESKTOP_STYLE_ARG, "schemas-style|s" => \$SCHEMAS_STYLE_ARG, "rfc822deb-style|r" => \$RFC822DEB_STYLE_ARG, "pass-through|p" => \$PASS_THROUGH_ARG, "utf8|u" => \$UTF8_ARG, "multiple-output|m" => \$MULTIPLE_OUTPUT, "cache|c=s" => \$cache_file ) or &error; my $PO_DIR; my $FILE; my $OUTFILE; my %po_files_by_lang = (); my %translations = (); my $iconv = $ENV{"ICONV"} || $ENV{"INTLTOOL_ICONV"} || "@INTLTOOL_ICONV@"; # Use this instead of \w for XML files to handle more possible characters. my $w = "[-A-Za-z0-9._:]"; # XML quoted string contents my $q = "[^\\\"]*"; ## Check for options. if ($VERSION_ARG) { &print_version; } elsif ($HELP_ARG) { &print_help; } elsif ($BA_STYLE_ARG && @ARGV > 2) { &utf8_sanity_check; &preparation; &print_message; &ba_merge_translations; &finalize; } elsif ($XML_STYLE_ARG && @ARGV > 2) { &utf8_sanity_check; &preparation; &print_message; &xml_merge_output; &finalize; } elsif ($KEYS_STYLE_ARG && @ARGV > 2) { &utf8_sanity_check; &preparation; &print_message; &keys_merge_translations; &finalize; } elsif ($DESKTOP_STYLE_ARG && @ARGV > 2) { &utf8_sanity_check; &preparation; &print_message; &desktop_merge_translations; &finalize; } elsif ($SCHEMAS_STYLE_ARG && @ARGV > 2) { &utf8_sanity_check; &preparation; &print_message; &schemas_merge_translations; &finalize; } elsif ($RFC822DEB_STYLE_ARG && @ARGV > 2) { &preparation; &print_message; &rfc822deb_merge_translations; &finalize; } else { &print_help; } exit; ## Sub for printing release information sub print_version { print <<_EOF_; ${PROGRAM} (${PACKAGE}) ${VERSION} Written by Maciej Stachowiak, Darin Adler and Kenneth Christiansen. Copyright (C) 2000-2003 Free Software Foundation, Inc. Copyright (C) 2000-2001 Eazel, Inc. This is free software; see the source for copying conditions. There is NO warranty; not even for MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. _EOF_ exit; } ## Sub for printing usage information sub print_help { print <<_EOF_; Usage: ${PROGRAM} [OPTION]... PO_DIRECTORY FILENAME OUTPUT_FILE Generates an output file that includes some localized attributes from an untranslated source file. Mandatory options: (exactly one must be specified) -b, --ba-style includes translations in the bonobo-activation style -d, --desktop-style includes translations in the desktop style -k, --keys-style includes translations in the keys style -s, --schemas-style includes translations in the schemas style -r, --rfc822deb-style includes translations in the RFC822 style -x, --xml-style includes translations in the standard xml style Other options: -u, --utf8 convert all strings to UTF-8 before merging (default for everything except RFC822 style) -p, --pass-through deprecated, does nothing and issues a warning -m, --multiple-output output one localized file per locale, instead of a single file containing all localized elements -c, --cache=FILE specify cache file name (usually \$top_builddir/po/.intltool-merge-cache) -q, --quiet suppress most messages --help display this help and exit --version output version information and exit Report bugs to http://bugzilla.gnome.org/ (product name "$PACKAGE") or send email to . _EOF_ exit; } ## Sub for printing error messages sub print_error { print STDERR "Try `${PROGRAM} --help' for more information.\n"; exit; } sub print_message { print "Merging translations into $OUTFILE.\n" unless $QUIET_ARG; } sub preparation { $PO_DIR = $ARGV[0]; $FILE = $ARGV[1]; $OUTFILE = $ARGV[2]; &gather_po_files; &get_translation_database; } # General-purpose code for looking up translations in .po files sub po_file2lang { my ($tmp) = @_; $tmp =~ s/^.*\/(.*)\.po$/$1/; return $tmp; } sub gather_po_files { for my $po_file (glob "$PO_DIR/*.po") { $po_files_by_lang{po_file2lang($po_file)} = $po_file; } } sub get_local_charset { my ($encoding) = @_; my $alias_file = $ENV{"G_CHARSET_ALIAS"} || "/usr/local/libdata/charset.alias"; # seek character encoding aliases in charset.alias (glib) if (open CHARSET_ALIAS, $alias_file) { while () { next if /^\#/; return $1 if (/^\s*([-._a-zA-Z0-9]+)\s+$encoding\b/i) } close CHARSET_ALIAS; } # if not found, return input string return $encoding; } sub get_po_encoding { my ($in_po_file) = @_; my $encoding = ""; open IN_PO_FILE, $in_po_file or die; while () { ## example: "Content-Type: text/plain; charset=ISO-8859-1\n" if (/Content-Type\:.*charset=([-a-zA-Z0-9]+)\\n/) { $encoding = $1; last; } } close IN_PO_FILE; if (!$encoding) { print STDERR "Warning: no encoding found in $in_po_file. Assuming ISO-8859-1\n" unless $QUIET_ARG; $encoding = "ISO-8859-1"; } system ("$iconv -f $encoding -t UTF-8 /dev/null"); if ($?) { $encoding = get_local_charset($encoding); } return $encoding } sub utf8_sanity_check { print STDERR "Warning: option --pass-through has been removed.\n" if $PASS_THROUGH_ARG; $UTF8_ARG = 1; } sub get_translation_database { if ($cache_file) { &get_cached_translation_database; } else { &create_translation_database; } } sub get_newest_po_age { my $newest_age; foreach my $file (values %po_files_by_lang) { my $file_age = -M $file; $newest_age = $file_age if !$newest_age || $file_age < $newest_age; } $newest_age = 0 if !$newest_age; return $newest_age; } sub create_cache { print "Generating and caching the translation database\n" unless $QUIET_ARG; &create_translation_database; open CACHE, ">$cache_file" || die; print CACHE join "\x01", %translations; close CACHE; } sub load_cache { print "Found cached translation database\n" unless $QUIET_ARG; my $contents; open CACHE, "<$cache_file" || die; { local $/; $contents = ; } close CACHE; %translations = split "\x01", $contents; } sub get_cached_translation_database { my $cache_file_age = -M $cache_file; if (defined $cache_file_age) { if ($cache_file_age <= &get_newest_po_age) { &load_cache; return; } print "Found too-old cached translation database\n" unless $QUIET_ARG; } &create_cache; } sub create_translation_database { for my $lang (keys %po_files_by_lang) { my $po_file = $po_files_by_lang{$lang}; if ($UTF8_ARG) { my $encoding = get_po_encoding ($po_file); if (lc $encoding eq "utf-8") { open PO_FILE, "<$po_file"; } else { print STDERR "WARNING: $po_file is not in UTF-8 but $encoding, converting...\n" unless $QUIET_ARG;; open PO_FILE, "$iconv -f $encoding -t UTF-8 $po_file|"; } } else { open PO_FILE, "<$po_file"; } my $nextfuzzy = 0; my $inmsgid = 0; my $inmsgstr = 0; my $msgid = ""; my $msgstr = ""; while () { $nextfuzzy = 1 if /^#, fuzzy/; if (/^msgid "((\\.|[^\\])*)"/ ) { $translations{$lang, $msgid} = $msgstr if $inmsgstr && $msgid && $msgstr; $msgid = ""; $msgstr = ""; if ($nextfuzzy) { $inmsgid = 0; } else { $msgid = unescape_po_string($1); $inmsgid = 1; } $inmsgstr = 0; $nextfuzzy = 0; } if (/^msgstr "((\\.|[^\\])*)"/) { $msgstr = unescape_po_string($1); $inmsgstr = 1; $inmsgid = 0; } if (/^"((\\.|[^\\])*)"/) { $msgid .= unescape_po_string($1) if $inmsgid; $msgstr .= unescape_po_string($1) if $inmsgstr; } } $translations{$lang, $msgid} = $msgstr if $inmsgstr && $msgid && $msgstr; } } sub finalize { } sub unescape_one_sequence { my ($sequence) = @_; return "\\" if $sequence eq "\\\\"; return "\"" if $sequence eq "\\\""; return "\n" if $sequence eq "\\n"; return "\r" if $sequence eq "\\r"; return "\t" if $sequence eq "\\t"; return "\b" if $sequence eq "\\b"; return "\f" if $sequence eq "\\f"; return "\a" if $sequence eq "\\a"; return chr(11) if $sequence eq "\\v"; # vertical tab, see ascii(7) return chr(hex($1)) if ($sequence =~ /\\x([0-9a-fA-F]{2})/); return chr(oct($1)) if ($sequence =~ /\\([0-7]{3})/); # FIXME: Is \0 supported as well? Kenneth and Rodney don't want it, see bug #48489 return $sequence; } sub unescape_po_string { my ($string) = @_; $string =~ s/(\\x[0-9a-fA-F]{2}|\\[0-7]{3}|\\.)/unescape_one_sequence($1)/eg; return $string; } ## NOTE: deal with < - < but not > - > because it seems its ok to have ## > in the entity. For further info please look at #84738. sub entity_decode { local ($_) = @_; s/'/'/g; # ' s/"/"/g; # " s/&/&/g; s/</; close INPUT; } open OUTPUT, ">$OUTFILE" or die "can't open $OUTFILE: $!"; while ($source =~ s|^(.*?)([ \t]*<\s*$w+\s+($w+\s*=\s*"$q"\s*)+/?>)([ \t]*\n)?||s) { print OUTPUT $1; my $node = $2 . "\n"; my @strings = (); $_ = $node; while (s/(\s)_($w+\s*=\s*"($q)")/$1$2/s) { push @strings, entity_decode($3); } print OUTPUT; my %langs; for my $string (@strings) { for my $lang (keys %po_files_by_lang) { $langs{$lang} = 1 if $translations{$lang, $string}; } } for my $lang (sort keys %langs) { $_ = $node; s/(\sname\s*=\s*)"($q)"/$1"$2-$lang"/s; s/(\s)_($w+\s*=\s*")($q)"/$1 . $2 . entity_encoded_translation($lang, $3) . '"'/seg; print OUTPUT; } } print OUTPUT $source; close OUTPUT; } ## XML (non-bonobo-activation) merge code # Process tag attributes # Only parameter is a HASH containing attributes -> values mapping sub getAttributeString { my $sub = shift; my $do_translate = shift || 0; my $language = shift || ""; my $result = ""; my $translate = shift; foreach my $e (reverse(sort(keys %{ $sub }))) { my $key = $e; my $string = $sub->{$e}; my $quote = '"'; $string =~ s/^[\s]+//; $string =~ s/[\s]+$//; if ($string =~ /^'.*'$/) { $quote = "'"; } $string =~ s/^['"]//g; $string =~ s/['"]$//g; if ($do_translate && $key =~ /^_/) { $key =~ s|^_||g; if ($language) { # Handle translation # my $decode_string = entity_decode($string); my $translation = $translations{$language, $decode_string}; if ($translation) { $translation = entity_encode($translation); $string = $translation; $$translate = 2; } } else { $$translate = 1 if ($translate && (!$$translate)); # watch not to "overwrite" if $translate == 2 } } $result .= " $key=$quote$string$quote"; } return $result; } # Returns a translatable string from XML node, it works on contents of every node in XML::Parser tree # doesn't support nesting of translatable tags (i.e. <_blah>this <_doh>doesn't work -- besides # can you define the correct semantics for this?) # sub getXMLstring { my $ref = shift; my @list = @{ $ref }; my $result = ""; my $count = scalar(@list); my $attrs = $list[0]; my $index = 1; while ($index < $count) { my $type = $list[$index]; my $content = $list[$index+1]; if (! $type ) { # We've got CDATA if ($content) { # lets strip the whitespace here, and *ONLY* here $content =~ s/\s+/ /gs if (!((exists $attrs->{"xml:space"}) && ($attrs->{"xml:space"} =~ /^["']?preserve["']?$/))); $result .= ($content); } else { #print "no cdata content when expected it\n"; # is this possible, is this ok? # what to do if this happens? # Did I mention that I hate XML::Parser tree style? } } else { # We've got another element $result .= "<$type"; $result .= getAttributeString(@{$content}[0], 0); # no nested translatable elements if ($content) { my $subresult = getXMLstring($content); if ($subresult) { $result .= ">".$subresult . ""; } else { $result .= "/>"; } } else { $result .= "/>"; } } $index += 2; } return $result; } sub traverse { my $fh = shift; my $nodename = shift; my $content = shift; my $language = shift || ""; if (!$nodename) { if ($content =~ /^[\s]*$/) { $leading_space .= $content; } print $fh $content; } else { # element my @all = @{ $content }; my $attrs = shift @all; my $translate = 0; my $outattr = getAttributeString($attrs, 1, $language, \$translate); if ($nodename =~ /^_/) { $translate = 1; $nodename =~ s/^_//; } my $lookup = ''; print $fh "<$nodename", $outattr; if ($translate) { $lookup = getXMLstring($content); if (!((exists $attrs->{"xml:space"}) && ($attrs->{"xml:space"} =~ /^["']?preserve["']?$/))) { $lookup =~ s/^\s+//s; $lookup =~ s/\s+$//s; } if ($lookup || $translate == 2) { my $translation = $translations{$language, $lookup}; if ($MULTIPLE_OUTPUT && ($translation || $translate == 2)) { $translation = $lookup if (!$translation); print $fh " xml:lang=\"", $language, "\""; print $fh ">", $translation, ""; return; # this means there will be no same translation with xml:lang="$language"... # if we want them both, just remove this "return" } else { print $fh ">$lookup"; } } else { print $fh "/>"; } for my $lang (sort keys %po_files_by_lang) { if ($MULTIPLE_OUTPUT && $lang ne "$language") { next; } if ($lang) { # Handle translation # my $translate = 0; my $localattrs = getAttributeString($attrs, 1, $lang, \$translate); my $translation = $translations{$lang, $lookup}; if ($translate && !$translation) { $translation = $lookup; } if ($translation || $translate) { $translation = ($translation); print $fh "\n"; $leading_space =~ s/.*\n//g; print $fh $leading_space; print $fh "<", $nodename, " xml:lang=\"", $lang, "\"", $localattrs; print $fh ">", $translation , ""; } } } } else { my $count = scalar(@all); if ($count > 0) { print $fh ">"; } else { print $fh "/>"; } my $index = 0; while ($index < $count) { my $type = $all[$index]; my $rest = $all[$index+1]; traverse($fh, $type, $rest, $language); $index += 2; } if ($count > 0) { print $fh ""; } } } } sub intltool_tree_char { my $expat = shift; my $text = shift; my $clist = $expat->{Curlist}; my $pos = $#$clist; # Use original_string so that we retain escaped entities # in CDATA sections. # if ($pos > 0 and $clist->[$pos - 1] eq '0') { $clist->[$pos] .= $expat->original_string(); } else { push @$clist, 0 => $expat->original_string(); } } sub intltool_tree_start { my $expat = shift; my $tag = shift; my @origlist = (); # Use original_string so that we retain escaped entities # in attribute values. We must convert the string to an # @origlist array to conform to the structure of the Tree # Style. # my @original_array = split /\x/, $expat->original_string(); my $source = $expat->original_string(); # Remove leading tag. # $source =~ s|^\s*<\s*(\S+)||s; # Grab attribute key/value pairs and push onto @origlist array. # while ($source) { if ($source =~ /^\s*([\w:-]+)\s*[=]\s*["]/) { $source =~ s|^\s*([\w:-]+)\s*[=]\s*["]([^"]*)["]||s; push @origlist, $1; push @origlist, '"' . $2 . '"'; } elsif ($source =~ /^\s*([\w:-]+)\s*[=]\s*[']/) { $source =~ s|^\s*([\w:-]+)\s*[=]\s*[']([^']*)[']||s; push @origlist, $1; push @origlist, "'" . $2 . "'"; } else { last; } } my $ol = [ { @origlist } ]; push @{ $expat->{Lists} }, $expat->{Curlist}; push @{ $expat->{Curlist} }, $tag => $ol; $expat->{Curlist} = $ol; } sub readXml { my $filename = shift || return; if(!-f $filename) { die "ERROR Cannot find filename: $filename\n"; } my $ret = eval 'require XML::Parser'; if(!$ret) { die "You must have XML::Parser installed to run $0\n\n"; } my $xp = new XML::Parser(Style => 'Tree'); $xp->setHandlers(Char => \&intltool_tree_char); $xp->setHandlers(Start => \&intltool_tree_start); my $tree = $xp->parsefile($filename); # Hello thereHowdydo # would be: # [foo, [{}, head, [{id => "a"}, 0, "Hello ", em, [{}, 0, "there"]], bar, [{}, # 0, "Howdy", ref, [{}]], 0, "do" ] ] return $tree; } sub print_header { my $infile = shift; my $fh = shift; my $source; if(!-f $infile) { die "ERROR Cannot find filename: $infile\n"; } print $fh qq{\n}; { local $/; open DOCINPUT, "<${FILE}" or die; $source = ; close DOCINPUT; } if ($source =~ /()/s) { print $fh "$1\n"; } elsif ($source =~ /(]*>)/s) { print $fh "$1\n"; } } sub parseTree { my $fh = shift; my $ref = shift; my $language = shift || ""; my $name = shift @{ $ref }; my $cont = shift @{ $ref }; traverse($fh, $name, $cont, $language); } sub xml_merge_output { my $source; if ($MULTIPLE_OUTPUT) { for my $lang (sort keys %po_files_by_lang) { if ( ! -e $lang ) { mkdir $lang, 0777 or die "Cannot create subdirectory $lang: $!\n"; } open OUTPUT, ">$lang/$OUTFILE" or die "Cannot open $lang/$OUTFILE: $!\n"; my $tree = readXml($FILE); print_header($FILE, \*OUTPUT); parseTree(\*OUTPUT, $tree, $lang); close OUTPUT; print "CREATED $lang/$OUTFILE\n" unless $QUIET_ARG; } } open OUTPUT, ">$OUTFILE" or die "Cannot open $OUTFILE: $!\n"; my $tree = readXml($FILE); print_header($FILE, \*OUTPUT); parseTree(\*OUTPUT, $tree); close OUTPUT; print "CREATED $OUTFILE\n" unless $QUIET_ARG; } sub keys_merge_translations { open INPUT, "<${FILE}" or die; open OUTPUT, ">${OUTFILE}" or die; while () { if (s/^(\s*)_(\w+=(.*))/$1$2/) { my $string = $3; print OUTPUT; my $non_translated_line = $_; for my $lang (sort keys %po_files_by_lang) { my $translation = $translations{$lang, $string}; next if !$translation; $_ = $non_translated_line; s/(\w+)=.*/[$lang]$1=$translation/; print OUTPUT; } } else { print OUTPUT; } } close OUTPUT; close INPUT; } sub desktop_merge_translations { open INPUT, "<${FILE}" or die; open OUTPUT, ">${OUTFILE}" or die; while () { if (s/^(\s*)_(\w+=(.*))/$1$2/) { my $string = $3; print OUTPUT; my $non_translated_line = $_; for my $lang (sort keys %po_files_by_lang) { my $translation = $translations{$lang, $string}; next if !$translation; $_ = $non_translated_line; s/(\w+)=.*/${1}[$lang]=$translation/; print OUTPUT; } } else { print OUTPUT; } } close OUTPUT; close INPUT; } sub schemas_merge_translations { my $source; { local $/; # slurp mode open INPUT, "<$FILE" or die "can't open $FILE: $!"; $source = ; close INPUT; } open OUTPUT, ">$OUTFILE" or die; # FIXME: support attribute translations # Empty nodes never need translation, so unmark all of them. # For example, <_foo/> is just replaced by . $source =~ s|<\s*_($w+)\s*/>|<$1/>|g; while ($source =~ s/ (.*?) (\s+)((\s*) (\s*(?:\s*)?(.*?)\s*<\/default>)?(\s*) (\s*(?:\s*)?(.*?)\s*<\/short>)?(\s*) (\s*(?:\s*)?(.*?)\s*<\/long>)?(\s*) <\/locale>) //sx) { print OUTPUT $1; my $locale_start_spaces = $2 ? $2 : ''; my $default_spaces = $4 ? $4 : ''; my $short_spaces = $7 ? $7 : ''; my $long_spaces = $10 ? $10 : ''; my $locale_end_spaces = $13 ? $13 : ''; my $c_default_block = $3 ? $3 : ''; my $default_string = $6 ? $6 : ''; my $short_string = $9 ? $9 : ''; my $long_string = $12 ? $12 : ''; print OUTPUT "$locale_start_spaces$c_default_block"; $default_string =~ s/\s+/ /g; $default_string = entity_decode($default_string); $short_string =~ s/\s+/ /g; $short_string = entity_decode($short_string); $long_string =~ s/\s+/ /g; $long_string = entity_decode($long_string); for my $lang (sort keys %po_files_by_lang) { my $default_translation = $translations{$lang, $default_string}; my $short_translation = $translations{$lang, $short_string}; my $long_translation = $translations{$lang, $long_string}; next if (!$default_translation && !$short_translation && !$long_translation); print OUTPUT "\n$locale_start_spaces"; print OUTPUT "$default_spaces"; if ($default_translation) { $default_translation = entity_encode($default_translation); print OUTPUT "$default_translation"; } print OUTPUT "$short_spaces"; if ($short_translation) { $short_translation = entity_encode($short_translation); print OUTPUT "$short_translation"; } print OUTPUT "$long_spaces"; if ($long_translation) { $long_translation = entity_encode($long_translation); print OUTPUT "$long_translation"; } print OUTPUT "$locale_end_spaces"; } } print OUTPUT $source; close OUTPUT; } sub rfc822deb_merge_translations { my %encodings = (); for my $lang (keys %po_files_by_lang) { $encodings{$lang} = ($UTF8_ARG ? 'UTF-8' : get_po_encoding($po_files_by_lang{$lang})); } my $source; $Text::Wrap::huge = 'overflow'; $Text::Wrap::break = qr/\n|\s(?=\S)/; { local $/; # slurp mode open INPUT, "<$FILE" or die "can't open $FILE: $!"; $source = ; close INPUT; } open OUTPUT, ">${OUTFILE}" or die; while ($source =~ /(^|\n+)(_*)([^:\s]+)(:[ \t]*)(.*?)(?=\n[\S\n]|$)/sg) { my $sep = $1; my $non_translated_line = $3.$4; my $string = $5; my $underscore = length($2); next if $underscore eq 0 && $non_translated_line =~ /^#/; # Remove [] dummy strings my $stripped = $string; $stripped =~ s/\[\s[^\[\]]*\],/,/g if $underscore eq 2; $stripped =~ s/\[\s[^\[\]]*\]$//; $non_translated_line .= $stripped; print OUTPUT $sep.$non_translated_line; if ($underscore) { my @str_list = rfc822deb_split($underscore, $string); for my $lang (sort keys %po_files_by_lang) { my $is_translated = 1; my $str_translated = ''; my $first = 1; for my $str (@str_list) { my $translation = $translations{$lang, $str}; if (!$translation) { $is_translated = 0; last; } # $translation may also contain [] dummy # strings, mostly to indicate an empty string $translation =~ s/\[\s[^\[\]]*\]$//; if ($first) { if ($underscore eq 2) { $str_translated .= $translation; } else { $str_translated .= Text::Tabs::expand($translation) . "\n"; } } else { if ($underscore eq 2) { $str_translated .= ', ' . $translation; } else { $str_translated .= Text::Tabs::expand( Text::Wrap::wrap(' ', ' ', $translation)) . "\n .\n"; } } $first = 0; # To fix some problems with Text::Wrap::wrap $str_translated =~ s/(\n )+\n/\n .\n/g; } next unless $is_translated; $str_translated =~ s/\n \.\n$//; $str_translated =~ s/\s+$//; $_ = $non_translated_line; s/^(\w+):\s*.*/$sep${1}-$lang.$encodings{$lang}: $str_translated/s; print OUTPUT; } } } print OUTPUT "\n"; close OUTPUT; close INPUT; } sub rfc822deb_split { # Debian defines a special way to deal with rfc822-style files: # when a value contain newlines, it consists of # 1. a short form (first line) # 2. a long description, all lines begin with a space, # and paragraphs are separated by a single dot on a line # This routine returns an array of all paragraphs, and reformat # them. # When first argument is 2, the string is a comma separated list of # values. my $type = shift; my $text = shift; $text =~ s/^[ \t]//mg; return (split(/, */, $text, 0)) if $type ne 1; return ($text) if $text !~ /\n/; $text =~ s/([^\n]*)\n//; my @list = ($1); my $str = ''; for my $line (split (/\n/, $text)) { chomp $line; if ($line =~ /^\.\s*$/) { # New paragraph $str =~ s/\s*$//; push(@list, $str); $str = ''; } elsif ($line =~ /^\s/) { # Line which must not be reformatted $str .= "\n" if length ($str) && $str !~ /\n$/; $line =~ s/\s+$//; $str .= $line."\n"; } else { # Continuation line, remove newline $str .= " " if length ($str) && $str !~ /\n$/; $str .= $line; } } $str =~ s/\s*$//; push(@list, $str) if length ($str); return @list; } libtranslate-0.99/intltool-update.in000644 001750 001750 00000064161 10165775765 021404 0ustar00jylefortjylefort000000 000000 #!@INTLTOOL_PERL@ -w # -*- Mode: perl; indent-tabs-mode: nil; c-basic-offset: 4 -*- # # The Intltool Message Updater # # Copyright (C) 2000-2003 Free Software Foundation. # # Intltool is free software; you can redistribute it and/or # modify it under the terms of the GNU General Public License # version 2 published by the Free Software Foundation. # # Intltool is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU # General Public License for more details. # # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. # # As a special exception to the GNU General Public License, if you # distribute this file as part of a program that contains a # configuration script generated by Autoconf, you may include it under # the same distribution terms that you use for the rest of that program. # # Authors: Kenneth Christiansen # Maciej Stachowiak # Darin Adler ## Release information my $PROGRAM = "intltool-update"; my $VERSION = "0.32.1"; my $PACKAGE = "intltool"; ## Loaded modules use strict; use Getopt::Long; use Cwd; use File::Copy; use File::Find; ## Scalars used by the option stuff my $HELP_ARG = 0; my $VERSION_ARG = 0; my $DIST_ARG = 0; my $POT_ARG = 0; my $HEADERS_ARG = 0; my $MAINTAIN_ARG = 0; my $REPORT_ARG = 0; my $VERBOSE = 0; my $GETTEXT_PACKAGE = ""; my $OUTPUT_FILE = ""; my @languages; my %varhash = (); my %po_files_by_lang = (); # Regular expressions to categorize file types. # FIXME: Please check if the following is correct my $xml_support = "xml(?:\\.in)*|". # http://www.w3.org/XML/ (Note: .in is not required) "ui|". # Bonobo specific - User Interface desc. files "lang|". # ? "glade2?(?:\\.in)*|". # Glade specific - User Interface desc. files (Note: .in is not required) "scm(?:\\.in)*|". # ? (Note: .in is not required) "oaf(?:\\.in)+|". # DEPRECATED: Replaces by Bonobo .server files "etspec|". # ? "server(?:\\.in)+|". # Bonobo specific "sheet(?:\\.in)+|". # ? "schemas(?:\\.in)+|". # GConf specific "pong(?:\\.in)+|". # DEPRECATED: PONG is not used [by GNOME] any longer. "kbd(?:\\.in)+"; # GOK specific. my $ini_support = "icon(?:\\.in)+|". # http://www.freedesktop.org/Standards/icon-theme-spec "desktop(?:\\.in)+|". # http://www.freedesktop.org/Standards/menu-spec "caves(?:\\.in)+|". # GNOME Games specific "directory(?:\\.in)+|". # http://www.freedesktop.org/Standards/menu-spec "soundlist(?:\\.in)+|". # GNOME specific "keys(?:\\.in)+|". # GNOME Mime database specific "theme(?:\\.in)+"; # http://www.freedesktop.org/Standards/icon-theme-spec my $buildin_gettext_support = "c|y|cs|cc|cpp|c\\+\\+|h|hh|gob|py"; ## Always flush buffer when printing $| = 1; ## Sometimes the source tree will be rooted somewhere else. my $SRCDIR = "."; my $POTFILES_in; $SRCDIR = $ENV{"srcdir"} if $ENV{"srcdir"}; $POTFILES_in = "<$SRCDIR/POTFILES.in"; ## Handle options GetOptions ( "help" => \$HELP_ARG, "version" => \$VERSION_ARG, "dist|d" => \$DIST_ARG, "pot|p" => \$POT_ARG, "headers|s" => \$HEADERS_ARG, "maintain|m" => \$MAINTAIN_ARG, "report|r" => \$REPORT_ARG, "verbose|x" => \$VERBOSE, "gettext-package|g=s" => \$GETTEXT_PACKAGE, "output-file|o=s" => \$OUTPUT_FILE, ) or &Console_WriteError_InvalidOption; &Console_Write_IntltoolHelp if $HELP_ARG; &Console_Write_IntltoolVersion if $VERSION_ARG; my $arg_count = ($DIST_ARG > 0) + ($POT_ARG > 0) + ($HEADERS_ARG > 0) + ($MAINTAIN_ARG > 0) + ($REPORT_ARG > 0); &Console_Write_IntltoolHelp if $arg_count > 1; # --version and --help don't require a module name my $MODULE = $GETTEXT_PACKAGE || &FindPackageName; if ($POT_ARG) { &GenerateHeaders; &GeneratePOTemplate; } elsif ($HEADERS_ARG) { &GenerateHeaders; } elsif ($MAINTAIN_ARG) { &FindLeftoutFiles; } elsif ($REPORT_ARG) { &GenerateHeaders; &GeneratePOTemplate; &Console_Write_CoverageReport; } elsif ((defined $ARGV[0]) && $ARGV[0] =~ /^[a-z]/) { my $lang = $ARGV[0]; ## Report error if the language file supplied ## to the command line is non-existent &Console_WriteError_NotExisting("$lang.po") if ! -s "$lang.po"; if (!$DIST_ARG) { print "Working, please wait..." if $VERBOSE; &GenerateHeaders; &GeneratePOTemplate; } &POFile_Update ($lang, $OUTPUT_FILE); &Console_Write_TranslationStatus ($lang, $OUTPUT_FILE); } else { &Console_Write_IntltoolHelp; } exit; ######### sub Console_Write_IntltoolVersion { print <<_EOF_; ${PROGRAM} (${PACKAGE}) $VERSION Written by Kenneth Christiansen, Maciej Stachowiak, and Darin Adler. Copyright (C) 2000-2003 Free Software Foundation, Inc. This is free software; see the source for copying conditions. There is NO warranty; not even for MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. _EOF_ exit; } sub Console_Write_IntltoolHelp { print <<_EOF_; Usage: ${PROGRAM} [OPTION]... LANGCODE Updates PO template files and merge them with the translations. Mode of operation (only one is allowed): -p, --pot generate the PO template only -s, --headers generate the header files in POTFILES.in -m, --maintain search for left out files from POTFILES.in -r, --report display a status report for the module -d, --dist merge LANGCODE.po with existing PO template Extra options: -g, --gettext-package=NAME override PO template name, useful with --pot -o, --output-file=FILE write merged translation to FILE -x, --verbose display lots of feedback --help display this help and exit --version output version information and exit Examples of use: ${PROGRAM} --pot just create a new PO template ${PROGRAM} xy create new PO template and merge xy.po with it Report bugs to http://bugzilla.gnome.org/ (product name "$PACKAGE") or send email to . _EOF_ exit; } sub POFile_DetermineType ($) { my $type = $_; my $gettext_type; my $xml_regex = "(?:" . $xml_support . ")"; my $ini_regex = "(?:" . $ini_support . ")"; my $buildin_regex = "(?:" . $buildin_gettext_support . ")"; if ($type =~ /\[type: gettext\/([^\]].*)]/) { $gettext_type=$1; } elsif ($type =~ /schemas(\.in)+$/) { $gettext_type="schemas"; } elsif ($type =~ /glade2?(\.in)*$/) { $gettext_type="glade"; } elsif ($type =~ /scm(\.in)*$/) { $gettext_type="scheme"; } elsif ($type =~ /keys(\.in)+$/) { $gettext_type="keys"; } # bucket types elsif ($type =~ /$xml_regex$/) { $gettext_type="xml"; } elsif ($type =~ /$ini_regex$/) { $gettext_type="ini"; } elsif ($type =~ /$buildin_regex$/) { $gettext_type="buildin"; } else { $gettext_type="unknown"; } return "gettext\/$gettext_type"; } sub TextFile_DetermineEncoding ($) { my $gettext_code="ASCII"; # All files are ASCII by default my $filetype=`file $_ | cut -d ' ' -f 2`; if ($? eq "0") { if ($filetype =~ /^(ISO|UTF)/) { chomp ($gettext_code = $filetype); } elsif ($filetype =~ /^XML/) { $gettext_code="UTF-8"; # We asume that .glade and other .xml files are UTF-8 } } return $gettext_code; } sub isNotValidMissing { my ($file) = @_; return if $file =~ /^\{arch\}\/.*$/; return if $file =~ /^$varhash{"PACKAGE"}-$varhash{"VERSION"}\/.*$/; } sub FindLeftoutFiles { my (@buf_i18n_plain, @buf_i18n_xml, @buf_i18n_xml_unmarked, @buf_i18n_ini, @buf_potfiles, @buf_potfiles_ignore, @buf_allfiles, @buf_allfiles_sorted, @buf_potfiles_sorted ); ## Search and find all translatable files find sub { push @buf_i18n_plain, "$File::Find::name" if /\.($buildin_gettext_support)$/; push @buf_i18n_xml, "$File::Find::name" if /\.($xml_support)$/; push @buf_i18n_ini, "$File::Find::name" if /\.($ini_support)$/; push @buf_i18n_xml_unmarked, "$File::Find::name" if /\.(schemas(\.in)+)$/; }, ".."; open POTFILES, $POTFILES_in or die "$PROGRAM: there's no POTFILES.in!\n"; @buf_potfiles = grep !/^(#|\s*$)/, ; close POTFILES; foreach (@buf_potfiles) { s/^\[.*]\s*//; } print "Searching for missing translatable files...\n" if $VERBOSE; ## Check if we should ignore some found files, when ## comparing with POTFILES.in foreach my $ignore ("POTFILES.skip", "POTFILES.ignore") { (-s $ignore) or next; if ("$ignore" eq "POTFILES.ignore") { print "The usage of POTFILES.ignore is deprecated. Please consider moving the\n". "content of this file to POTFILES.skip.\n"; } print "Found $ignore: Ignoring files...\n" if $VERBOSE; open FILE, "<$ignore" or die "ERROR: Failed to open $ignore!\n"; while () { push @buf_potfiles_ignore, $_ unless /^(#|\s*$)/; } close FILE; @buf_potfiles = (@buf_potfiles_ignore, @buf_potfiles); } foreach my $file (@buf_i18n_plain) { my $in_comment = 0; my $in_macro = 0; open FILE, "<$file"; while () { # Handle continued multi-line comment. if ($in_comment) { next unless s-.*\*/--; $in_comment = 0; } # Handle continued macro. if ($in_macro) { $in_macro = 0 unless /\\$/; next; } # Handle start of macro (or any preprocessor directive). if (/^\s*\#/) { $in_macro = 1 if /^([^\\]|\\.)*\\$/; next; } # Handle comments and quoted text. while (m-(/\*|//|\'|\")-) # \' and \" keep emacs perl mode happy { my $match = $1; if ($match eq "/*") { if (!s-/\*.*?\*/--) { s-/\*.*--; $in_comment = 1; } } elsif ($match eq "//") { s-//.*--; } else # ' or " { if (!s-$match([^\\]|\\.)*?$match-QUOTEDTEXT-) { warn "mismatched quotes at line $. in $file\n"; s-$match.*--; } } } if (/\.GetString ?\(QUOTEDTEXT/) { if (defined isNotValidMissing (unpack("x3 A*", $file))) { ## Remove the first 3 chars and add newline push @buf_allfiles, unpack("x3 A*", $file) . "\n"; } last; } if (/_\(QUOTEDTEXT/) { if (defined isNotValidMissing (unpack("x3 A*", $file))) { ## Remove the first 3 chars and add newline push @buf_allfiles, unpack("x3 A*", $file) . "\n"; } last; } } close FILE; } foreach my $file (@buf_i18n_xml) { open FILE, "<$file"; while () { # FIXME: share the pattern matching code with intltool-extract if (/\s_(.*)=\"/ || /<_[^>]+>/ || /translatable=\"yes\"/) { if (defined isNotValidMissing (unpack("x3 A*", $file))) { push @buf_allfiles, unpack("x3 A*", $file) . "\n"; } last; } } close FILE; } foreach my $file (@buf_i18n_ini) { open FILE, "<$file"; while () { if (/_(.*)=/) { if (defined isNotValidMissing (unpack("x3 A*", $file))) { push @buf_allfiles, unpack("x3 A*", $file) . "\n"; } last; } } close FILE; } foreach my $file (@buf_i18n_xml_unmarked) { if (defined isNotValidMissing (unpack("x3 A*", $file))) { push @buf_allfiles, unpack("x3 A*", $file) . "\n"; } } @buf_allfiles_sorted = sort (@buf_allfiles); @buf_potfiles_sorted = sort (@buf_potfiles); my %in2; foreach (@buf_potfiles_sorted) { $in2{$_} = 1; } my @result; foreach (@buf_allfiles_sorted) { if (!exists($in2{$_})) { push @result, $_ } } my @buf_potfiles_notexist; foreach (@buf_potfiles_sorted) { chomp (my $dummy = $_); if ("$dummy" ne "" and ! -f "../$dummy") { push @buf_potfiles_notexist, $_; } } ## Save file with information about the files missing ## if any, and give information about this procedure. if (@result + @buf_potfiles_notexist > 0) { if (@result) { print "\n" if $VERBOSE; unlink "missing"; open OUT, ">missing"; print OUT @result; close OUT; warn "\e[1mThe following files contain translations and are currently not in use. Please\e[0m\n". "\e[1mconsider adding these to the POTFILES.in file, located in the po/ directory.\e[0m\n\n"; print STDERR @result, "\n"; warn "If some of these files are left out on purpose then please add them to\n". "POTFILES.skip instead of POTFILES.in. A file \e[1m'missing'\e[0m containing this list\n". "of left out files has been written in the current directory.\n"; } if (@buf_potfiles_notexist) { unlink "notexist"; open OUT, ">notexist"; print OUT @buf_potfiles_notexist; close OUT; warn "\n" if ($VERBOSE or @result); warn "\e[1mThe following files do not exist anymore:\e[0m\n\n"; warn @buf_potfiles_notexist, "\n"; warn "Please remove them from POTFILES.in or POTFILES.skip. A file \e[1m'notexist'\e[0m\n". "containing this list of absent files has been written in the current directory.\n"; } } ## If there is nothing to complain about, notify the user else { print "\nAll files containing translations are present in POTFILES.in.\n" if $VERBOSE; } } sub Console_WriteError_InvalidOption { ## Handle invalid arguments print STDERR "Try `${PROGRAM} --help' for more information.\n"; exit 1; } sub GenerateHeaders { my $EXTRACT = "@INTLTOOL_EXTRACT@"; chomp $EXTRACT; $EXTRACT = $ENV{"INTLTOOL_EXTRACT"} if $ENV{"INTLTOOL_EXTRACT"}; ## Generate the .h header files, so we can allow glade and ## xml translation support if (! -x "$EXTRACT") { print STDERR "\n *** The intltool-extract script wasn't found!" ."\n *** Without it, intltool-update can not generate files.\n"; exit; } else { open (FILE, $POTFILES_in) or die "$PROGRAM: POTFILES.in not found.\n"; while () { chomp; next if /^\[\s*encoding/; ## Find xml files in POTFILES.in and generate the ## files with help from the extract script my $gettext_type= &POFile_DetermineType ($1); if (/\.($xml_support|$ini_support)$/ || /^\[/) { s/^\[[^\[].*]\s*//; my $filename = "../$_"; if ($VERBOSE) { system ($EXTRACT, "--update", "--srcdir=$SRCDIR", "--type=$gettext_type", $filename); } else { system ($EXTRACT, "--update", "--type=$gettext_type", "--srcdir=$SRCDIR", "--quiet", $filename); } } } close FILE; } } # # Generate .pot file from POTFILES.in # sub GeneratePOTemplate { my $XGETTEXT = $ENV{"XGETTEXT"} || "@INTLTOOL_XGETTEXT@"; my $XGETTEXT_ARGS = $ENV{"XGETTEXT_ARGS"} || ''; chomp $XGETTEXT; if (! -x $XGETTEXT) { print STDERR " *** xgettext is not found on this system!\n". " *** Without it, intltool-update can not extract strings.\n"; exit; } print "Building $MODULE.pot...\n" if $VERBOSE; open INFILE, $POTFILES_in; unlink "POTFILES.in.temp"; open OUTFILE, ">POTFILES.in.temp" or die("Cannot open POTFILES.in.temp for writing"); my $gettext_support_nonascii = 0; # checks for GNU gettext >= 0.12 my $dummy = `$XGETTEXT --version --from-code=UTF-8 >/dev/null 2>/dev/null`; if ($? == 0) { $gettext_support_nonascii = 1; } else { # urge everybody to upgrade gettext print STDERR "WARNING: This version of gettext does not support extracting non-ASCII\n". " strings. That means you should install a version of gettext\n". " that supports non-ASCII strings (such as GNU gettext >= 0.12),\n". " or have to let non-ASCII strings untranslated. (If there is any)\n"; } my $encoding = "ASCII"; my $forced_gettext_code; my @temp_headers; my $encoding_problem_is_reported = 0; while () { next if (/^#/ or /^\s*$/); chomp; my $gettext_code; if (/^\[\s*encoding:\s*(.*)\s*\]/) { $forced_gettext_code=$1; } elsif (/\.($xml_support|$ini_support)$/ || /^\[/) { s/^\[.*]\s*//; print OUTFILE "$_.h\n"; push @temp_headers, "../$_.h"; $gettext_code = &TextFile_DetermineEncoding ("../$_.h") if ($gettext_support_nonascii and not defined $forced_gettext_code); } else { if ($SRCDIR eq ".") { print OUTFILE "$_\n"; } else { print OUTFILE "$SRCDIR/../$_\n"; } $gettext_code = &TextFile_DetermineEncoding ("../$_") if ($gettext_support_nonascii and not defined $forced_gettext_code); } next if (! $gettext_support_nonascii); if (defined $forced_gettext_code) { $encoding=$forced_gettext_code; } elsif (defined $gettext_code and "$encoding" ne "$gettext_code") { if ($encoding eq "ASCII") { $encoding=$gettext_code; } elsif ($gettext_code ne "ASCII") { # Only report once because the message is quite long if (! $encoding_problem_is_reported) { print STDERR "WARNING: You should use the same file encoding for all your project files,\n". " but $PROGRAM thinks that most of the source files are in\n". " $encoding encoding, while \"$_\" is (likely) in\n". " $gettext_code encoding. If you are sure that all translatable strings\n". " are in same encoding (say UTF-8), please \e[1m*prepend*\e[0m the following\n". " line to POTFILES.in:\n\n". " [encoding: UTF-8]\n\n". " and make sure that configure.in/ac checks for $PACKAGE >= 0.27 .\n". "(such warning message will only be reported once.)\n"; $encoding_problem_is_reported = 1; } } } } close OUTFILE; close INFILE; unlink "$MODULE.pot"; my @xgettext_argument=("$XGETTEXT", "--add-comments", "--directory\=\.\.", "--output\=$MODULE\.pot", "--files-from\=\.\/POTFILES\.in\.temp"); my $XGETTEXT_KEYWORDS = &FindPOTKeywords; push @xgettext_argument, $XGETTEXT_KEYWORDS; push @xgettext_argument, "--from-code\=$encoding" if ($gettext_support_nonascii); push @xgettext_argument, $XGETTEXT_ARGS if $XGETTEXT_ARGS; my $xgettext_command = join ' ', @xgettext_argument; # intercept xgettext error message print "Running $xgettext_command\n" if $VERBOSE; my $xgettext_error_msg = `$xgettext_command 2>\&1`; my $command_failed = $?; unlink "POTFILES.in.temp"; print "Removing generated header (.h) files..." if $VERBOSE; unlink foreach (@temp_headers); print "done.\n" if $VERBOSE; if (! $command_failed) { if (! -e "$MODULE.pot") { print "None of the files in POTFILES.in contain strings marked for translation.\n" if $VERBOSE; } else { print "Wrote $MODULE.pot\n" if $VERBOSE; } } else { if ($xgettext_error_msg =~ /--from-code/) { # replace non-ASCII error message with a more useful one. print STDERR "ERROR: xgettext failed to generate PO template file because there is non-ASCII\n". " string marked for translation. Please make sure that all strings marked\n". " for translation are in uniform encoding (say UTF-8), then \e[1m*prepend*\e[0m the\n". " following line to POTFILES.in and rerun $PROGRAM:\n\n". " [encoding: UTF-8]\n\n"; } else { print STDERR "$xgettext_error_msg"; if (-e "$MODULE.pot") { # is this possible? print STDERR "ERROR: xgettext failed but still managed to generate PO template file.\n". " Please consult error message above if there is any.\n"; } else { print STDERR "ERROR: xgettext failed to generate PO template file. Please consult\n". " error message above if there is any.\n"; } } exit (1); } } sub POFile_Update { -f "$MODULE.pot" or die "$PROGRAM: $MODULE.pot does not exist.\n"; my $MSGMERGE = $ENV{"MSGMERGE"} || "@INTLTOOL_MSGMERGE@"; my ($lang, $outfile) = @_; print "Merging $lang.po with $MODULE.pot..." if $VERBOSE; my $infile = "$lang.po"; $outfile = "$lang.po" if ($outfile eq ""); # I think msgmerge won't overwrite old file if merge is not successful system ("$MSGMERGE", "-o", $outfile, $infile, "$MODULE.pot"); } sub Console_WriteError_NotExisting { my ($file) = @_; ## Report error if supplied language file is non-existing print STDERR "$PROGRAM: $file does not exist!\n"; print STDERR "Try '$PROGRAM --help' for more information.\n"; exit; } sub GatherPOFiles { my @po_files = glob ("./*.po"); @languages = map (&POFile_GetLanguage, @po_files); foreach my $lang (@languages) { $po_files_by_lang{$lang} = shift (@po_files); } } sub POFile_GetLanguage ($) { s/^(.*\/)?(.+)\.po$/$2/; return $_; } sub Console_Write_TranslationStatus { my ($lang, $output_file) = @_; my $MSGFMT = $ENV{"MSGFMT"} || "@INTLTOOL_MSGFMT@"; $output_file = "$lang.po" if ($output_file eq ""); system ("$MSGFMT", "-o", "/dev/null", "--statistics", $output_file); } sub Console_Write_CoverageReport { my $MSGFMT = $ENV{"MSGFMT"} || "@INTLTOOL_MSGFMT@"; &GatherPOFiles; foreach my $lang (@languages) { print "$lang: "; &POFile_Update ($lang, ""); } print "\n\n * Current translation support in $MODULE \n\n"; foreach my $lang (@languages) { print "$lang: "; system ("$MSGFMT", "-o", "/dev/null", "--statistics", "$lang.po"); } } sub SubstituteVariable { my ($str) = @_; # always need to rewind file whenever it has been accessed seek (CONF, 0, 0); # cache each variable. varhash is global to we can add # variables elsewhere. while () { if (/^(\w+)=(.*)$/) { ($varhash{$1} = $2) =~ s/^["'](.*)["']$/$1/; } } if ($str =~ /^(.*)\${?([A-Z_]+)}?(.*)$/) { my $rest = $3; my $untouched = $1; my $sub = $varhash{$2}; return SubstituteVariable ("$untouched$sub$rest"); } # We're using Perl backticks ` and "echo -n" here in order to # expand any shell escapes (such as backticks themselves) in every variable return `echo -n "$str"`; } sub CONF_Handle_Open { my $base_dirname = getcwd(); $base_dirname =~ s@.*/@@; my ($conf_in, $src_dir); if ($base_dirname =~ /^po(-.+)?$/) { if (-f "Makevars") { my $makefile_source; local (*IN); open (IN, ") { if (/^top_builddir[ \t]*=/) { $src_dir = $_; $src_dir =~ s/^top_builddir[ \t]*=[ \t]*([^ \t\n\r]*)/$1/; chomp $src_dir; if (-f "$src_dir" . "/configure.ac") { $conf_in = "$src_dir" . "/configure.ac" . "\n"; } else { $conf_in = "$src_dir" . "/configure.in" . "\n"; } last; } } close IN; $conf_in || die "Cannot find top_builddir in Makevars."; } elsif (-f "../configure.ac") { $conf_in = "../configure.ac"; } elsif (-f "../configure.in") { $conf_in = "../configure.in"; } else { my $makefile_source; local (*IN); open (IN, ") { if (/^top_srcdir[ \t]*=/) { $src_dir = $_; $src_dir =~ s/^top_srcdir[ \t]*=[ \t]*([^ \t\n\r]*)/$1/; chomp $src_dir; $conf_in = "$src_dir" . "/configure.in" . "\n"; last; } } close IN; $conf_in || die "Cannot find top_srcdir in Makefile."; } open (CONF, "<$conf_in"); } else { print STDERR "$PROGRAM: Unable to proceed.\n" . "Make sure to run this script inside the po directory.\n"; exit; } } sub FindPackageName { my $version; my $domain = &FindMakevarsDomain; my $name = $domain || "untitled"; &CONF_Handle_Open; my $conf_source; { local (*IN); open (IN, "<&CONF") || return $name; seek (IN, 0, 0); local $/; # slurp mode $conf_source = ; close IN; } # priority for getting package name: # 1. GETTEXT_PACKAGE # 2. first argument of AC_INIT (with >= 2 arguments) # 3. first argument of AM_INIT_AUTOMAKE (with >= 2 argument) # /^AM_INIT_AUTOMAKE\([\s\[]*([^,\)\s\]]+)/m # the \s makes this not work, why? if ($conf_source =~ /^AM_INIT_AUTOMAKE\(([^,\)]+),([^,\)]+)/m) { ($name, $version) = ($1, $2); $name =~ s/[\[\]\s]//g; $version =~ s/[\[\]\s]//g; $varhash{"AC_PACKAGE_NAME"} = $name; $varhash{"PACKAGE"} = $name; $varhash{"AC_PACKAGE_VERSION"} = $version; $varhash{"VERSION"} = $version; } if ($conf_source =~ /^AC_INIT\(([^,\)]+),([^,\)]+)/m) { ($name, $version) = ($1, $2); $name =~ s/[\[\]\s]//g; $version =~ s/[\[\]\s]//g; $varhash{"AC_PACKAGE_NAME"} = $name; $varhash{"PACKAGE"} = $name; $varhash{"AC_PACKAGE_VERSION"} = $version; $varhash{"VERSION"} = $version; } # \s makes this not work, why? $name = $1 if $conf_source =~ /^GETTEXT_PACKAGE=\[?([^\n\]]+)/m; # prepend '$' to auto* internal variables, usually they are # used in configure.in/ac without the '$' $name =~ s/AC_/\$AC_/g; $name =~ s/\$\$/\$/g; $name = $domain if $domain; $name = SubstituteVariable ($name); $name =~ s/^["'](.*)["']$/$1/; return $name if $name; } sub FindPOTKeywords { my $keywords = "--keyword\=\_ --keyword\=N\_ --keyword\=U\_ --keyword\=Q\_"; my $varname = "XGETTEXT_OPTIONS"; my $make_source; { local (*IN); open (IN, "; close IN; } $keywords = $1 if $make_source =~ /^$varname[ ]*=\[?([^\n\]]+)/m; return $keywords; } sub FindMakevarsDomain { my $domain = ""; my $makevars_source; { local (*IN); open (IN, "; close IN; } $domain = $1 if $makevars_source =~ /^DOMAIN[ ]*=\[?([^\n\]\$]+)/m; $domain =~ s/^\s+//; $domain =~ s/\s+$//; return $domain; } libtranslate-0.99/common.make000644 001750 001750 00000000131 10163543376 020027 0ustar00jylefortjylefort000000 000000 modulesdir = $(pkglibdir)/modules TRANSLATE_CFLAGS = $(GLIB_CFLAGS) -I$(top_srcdir)/src