pax_global_header00006660000000000000000000000064151674132730014523gustar00rootroot0000000000000052 comment=d8278f9f4f8c49fc353b580b7d0d7bc8b1b4e384 PDB-REDO-dssp-ca06797/000077500000000000000000000000001516741327300141705ustar00rootroot00000000000000PDB-REDO-dssp-ca06797/.clang-format000066400000000000000000000011101516741327300165340ustar00rootroot00000000000000BasedOnStyle: LLVM UseTab: AlignWithSpaces IndentWidth: 4 TabWidth: 4 BreakBeforeBraces: Allman ColumnLimit: 0 NamespaceIndentation: Inner FixNamespaceComments: true AccessModifierOffset: -2 AllowShortCaseLabelsOnASingleLine: true IndentCaseLabels: true BreakConstructorInitializers: BeforeComma BraceWrapping: BeforeLambdaBody: false AlignAfterOpenBracket: DontAlign Cpp11BracedListStyle: false IncludeBlocks: Regroup LambdaBodyIndentation: Signature AllowShortLambdasOnASingleLine: Inline EmptyLineBeforeAccessModifier: LogicalBlock IndentPPDirectives: AfterHash PPIndentWidth: 1 PDB-REDO-dssp-ca06797/.clang-tidy000066400000000000000000000011361516741327300162250ustar00rootroot00000000000000Checks: '-*, bugprone-*, -bugprone-easily-swappable-parameters, cert-*, modernize*, -modernize-use-trailing-return-type, -modernize-avoid-c-arrays, -modernize-use-designated-initializers, performance ' # HeaderFilterRegex: '.*' ExcludeHeaderFilterRegex: 'Eigen|Eigen/Eigenvalues|eigen3/Eigen/Eigenvalues|sqlite3.h' CheckOptions: - key: bugprone-narrowing-conversions.WarnOnIntegerNarrowingConversion value: false - key: bugprone-narrowing-conversions.WarnOnIntegerToFloatingPointNarrowingConversion value: false PDB-REDO-dssp-ca06797/.dockerignore000066400000000000000000000000421516741327300166400ustar00rootroot00000000000000Dockerfile .dockerignore README.mdPDB-REDO-dssp-ca06797/.github/000077500000000000000000000000001516741327300155305ustar00rootroot00000000000000PDB-REDO-dssp-ca06797/.github/workflows/000077500000000000000000000000001516741327300175655ustar00rootroot00000000000000PDB-REDO-dssp-ca06797/.github/workflows/cmake-multi-platform.yml000066400000000000000000000047361516741327300243540ustar00rootroot00000000000000name: multi platform test on: push: branches: [ "trunk", "develop" ] pull_request: branches: [ "trunk" ] env: # Customize the CMake build type here (Release, Debug, RelWithDebInfo, etc.) BUILD_TYPE: Release jobs: build: runs-on: ${{ matrix.os }} strategy: fail-fast: false matrix: os: [ubuntu-latest, windows-latest, macos-latest] python-version: [ 3.13 ] include: - os: windows-latest cpp_compiler: cl try_python: OFF - os: ubuntu-latest cpp_compiler: g++ try_python: ON - os: macos-latest cpp_compiler: clang++ try_python: OFF steps: - uses: actions/checkout@v6 - name: Set reusable strings id: strings shell: bash run: echo "build-output-dir=${{ github.workspace }}/build" >> "$GITHUB_OUTPUT" - name: Install Catch2 Ubuntu if: matrix.os == 'ubuntu-latest' run: > sudo apt-get update && sudo apt-get install catch2 libpython3-all-dev - name: setup python if: matrix.os == 'ubuntu-latest' uses: actions/setup-python@v6 with: python-version: ${{ matrix.python-version }} pip-install: numpy - name: Install Catch2 macOS if: matrix.os == 'macos-latest' run: > brew install catch2 fast_float brew install catch2 fast_float - name: Install dependencies Windows if: matrix.os == 'windows-latest' run: ./tools/depends.cmd shell: cmd - name: Install boost if: matrix.os == 'ubuntu-latest' uses: MarkusJx/install-boost@v2 id: install-boost with: boost_version: 1.86.0 - name: Configure CMake run: > cmake -B ${{ steps.strings.outputs.build-output-dir }} -DCMAKE_CXX_COMPILER=${{ matrix.cpp_compiler }} -DCMAKE_BUILD_TYPE=Release -DBUILD_TESTING=ON -DBUILD_PYTHON_MODULE=${{ matrix.try_python }} -S ${{ github.workspace }} -DCMAKE_INSTALL_PREFIX=${{github.workspace}}/local -DCMAKE_PREFIX_PATH=${{ steps.install-boost.outputs.BOOST_ROOT }} - name: Build run: cmake --build ${{ steps.strings.outputs.build-output-dir }} --config Release - name: Test working-directory: ${{ steps.strings.outputs.build-output-dir }} run: ctest --build-config Release --output-on-failure env: LIBCIFPP_DATA_DIR: ${{ steps.strings.outputs.build-output-dir }}/_deps/cifpp-src/rsrc PDB-REDO-dssp-ca06797/.gitignore000066400000000000000000000001661516741327300161630ustar00rootroot00000000000000.vscode/ .vs/ build/ .gdb_history **/*.dssp src/revision.hpp libdssp/src/revision.hpp python-module/mkdssp.so .cache/ PDB-REDO-dssp-ca06797/.gitmodules000066400000000000000000000005211516741327300163430ustar00rootroot00000000000000[submodule "libconfig"] path = libconfig url = https://github.com/mhekkel/libconfig.git [submodule "date"] path = date url = https://github.com/HowardHinnant/date.git [submodule "libcifpp"] path = libcifpp url = https://github.com/PDB-REDO/libcifpp.git [submodule "gxrio"] path = gxrio url = https://github.com/mhekkel/gxrio.git PDB-REDO-dssp-ca06797/CMakeLists.txt000066400000000000000000000153461516741327300167410ustar00rootroot00000000000000# SPDX-License-Identifier: BSD-2-Clause # Copyright (c) 2021 NKI/AVL, Netherlands Cancer Institute # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions are met: # 1. Redistributions of source code must retain the above copyright notice, this # list of conditions and the following disclaimer # 2. Redistributions in binary form must reproduce the above copyright notice, # this list of conditions and the following disclaimer in the documentation # and/or other materials provided with the distribution. # THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS "AS IS" AND # ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED # WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE # DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS BE LIABLE FOR # ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES # (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; # LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND # ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS # SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. cmake_minimum_required(VERSION 3.23) file(READ libdssp/VERSION VER_FILE_CONTENT) string(STRIP ${VER_FILE_CONTENT} VER_FILE_CONTENT) project(mkdssp VERSION ${VER_FILE_CONTENT} LANGUAGES CXX) list(APPEND CMAKE_MODULE_PATH "${CMAKE_CURRENT_SOURCE_DIR}/cmake") include(CPM) include(CTest) include(VersionString) # The default build type must be set before project() if(CMAKE_SOURCE_DIR STREQUAL CMAKE_CURRENT_SOURCE_DIR AND NOT CMAKE_BUILD_TYPE AND NOT CMAKE_CONFIGURATION_TYPES) set(CMAKE_BUILD_TYPE Release CACHE STRING "Build type" FORCE) set_property(CACHE CMAKE_BUILD_TYPE PROPERTY STRINGS "Debug" "Release" "MinSizeRel" "RelWithDebInfo") endif() if("${CMAKE_CXX_COMPILER_ID}" STREQUAL "GNU") set(CMAKE_CXX_FLAGS "${CMAKE_CXX_FLAGS} -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers") elseif(MSVC) set(CMAKE_CXX_FLAGS "${CMAKE_CXX_FLAGS} /W4") endif() # Optionally build a version to be installed inside CCP4 option(BUILD_FOR_CCP4 "Build a version to be installed in CCP4" OFF) option(BUILD_DOCUMENTATION "Generate the documentation files using pandoc" OFF) option(BUILD_PYTHON_MODULE "Build an experimental Python module" OFF) option(INSTALL_LIBRARY "Install the libdssp library" OFF) if(BUILD_FOR_CCP4) if("$ENV{CCP4}" STREQUAL "" OR NOT EXISTS $ENV{CCP4}) message(FATAL_ERROR "dssp: A CCP4 built was requested but CCP4 was not sourced") else() list(APPEND CMAKE_MODULE_PATH "$ENV{CCP4}") list(APPEND CMAKE_PREFIX_PATH "$ENV{CCP4}") set(CMAKE_INSTALL_PREFIX "$ENV{CCP4}") if(WIN32) set(BUILD_SHARED_LIBS ON) endif() endif() endif() if(WIN32) if(${CMAKE_SYSTEM_VERSION} GREATER_EQUAL 10) # Windows 10 add_definitions(-D _WIN32_WINNT=0x0A00) elseif(${CMAKE_SYSTEM_VERSION} EQUAL 6.3) # Windows 8.1 add_definitions(-D _WIN32_WINNT=0x0603) elseif(${CMAKE_SYSTEM_VERSION} EQUAL 6.2) # Windows 8 add_definitions(-D _WIN32_WINNT=0x0602) elseif(${CMAKE_SYSTEM_VERSION} EQUAL 6.1) # Windows 7 add_definitions(-D _WIN32_WINNT=0x0601) elseif(${CMAKE_SYSTEM_VERSION} EQUAL 6.0) # Windows Vista add_definitions(-D _WIN32_WINNT=0x0600) else() # Windows XP (5.1) add_definitions(-D _WIN32_WINNT=0x0501) endif() # Man, this is 2024 we're living in... add_definitions(-DNOMINMAX) # We do not want to write an export file for all our symbols... set(CMAKE_WINDOWS_EXPORT_ALL_SYMBOLS ON) endif() if(MSVC) # make msvc standards compliant... add_compile_options(/permissive- /bigobj) add_link_options(/NODEFAULTLIB:library) endif() # Create a revision file, containing the current git version info write_version_header("${CMAKE_CURRENT_SOURCE_DIR}/src") # Optionally use mrc to create resources find_package(mrc QUIET) if(MRC_FOUND) option(USE_RSRC "Use mrc to create resources" ON) else() message(STATUS "dssp: Not using resources since mrc was not found") endif() set(CMAKE_THREAD_PREFER_PTHREAD) set(THREADS_PREFER_PTHREAD_FLAG) find_package(Threads) CPMFindPackage( NAME mcfp GIT_REPOSITORY https://github.com/mhekkel/libmcfp GIT_TAG v1.4.2 EXCLUDE_FROM_ALL YES) # No longer using CPM for libcifpp. It is now simply required to install it first. find_package(cifpp 10.0.2 QUIET) if(NOT (cifpp_FOUND OR TARGET cifpp)) # message(FATAL_ERROR "Could not find libcifpp. Please make sure you install libcifpp first, code can be found at https://github.com/PDB-REDO/libcifpp") CPMAddPackage( NAME cifpp GIT_REPOSITORY "https://github.com/PDB-REDO/libcifpp" GIT_TAG v10.0.2 EXCLUDE_FROM_ALL YES) endif() if(TARGET cifpp) get_target_property(CIFPP_SOURCE_DIR cifpp SOURCE_DIR) set(CIFPP_SHARE_DIR share/libcifpp) set(CIFPP_DATA_DIR ${CIFPP_SOURCE_DIR}/rsrc) elseif(DEFINED CIFPP_SHARE_DIR) set(CIFPP_DATA_DIR ${CIFPP_SHARE_DIR}) else() message(FATAL_ERROR "dssp: The CIFPP_SHARE_DIR variable is not found in the cifpp configuration files") endif() if(INSTALL_LIBRARY) add_subdirectory(libdssp) else() add_subdirectory(libdssp EXCLUDE_FROM_ALL) endif() add_executable(mkdssp ${CMAKE_CURRENT_SOURCE_DIR}/src/mkdssp.cpp) target_link_libraries(mkdssp PRIVATE mcfp::mcfp dssp::dssp) if(USE_RSRC) mrc_target_resources(mkdssp ${CIFPP_DATA_DIR}/mmcif_pdbx.dic ${CMAKE_CURRENT_SOURCE_DIR}/libdssp/mmcif_pdbx/dssp-extension.dic) else() get_target_property(LIBDSSP_SOURCE_DIR dssp SOURCE_DIR) install(FILES ${CMAKE_CURRENT_SOURCE_DIR}/libdssp/mmcif_pdbx/dssp-extension.dic DESTINATION ${CIFPP_SHARE_DIR}) if(TARGET cifpp) install(FILES ${CIFPP_DATA_DIR}/mmcif_pdbx.dic DESTINATION ${CIFPP_SHARE_DIR}) endif() endif() # Install rules install(TARGETS ${PROJECT_NAME} RUNTIME DESTINATION bin ) if(BUILD_DOCUMENTATION) add_subdirectory(doc) endif() if(UNIX) install(FILES doc/mkdssp.1 DESTINATION share/man/man1) endif() if(EXISTS "${CCP4}/html") install(FILES doc/mkdssp.html DESTINATION ${CCP4}/html) endif() # test if(BUILD_TESTING AND PROJECT_IS_TOP_LEVEL) add_subdirectory(test) endif() # Python if(BUILD_PYTHON_MODULE) add_subdirectory(python-module) endif() include(InstallRequiredSystemLibraries) set(CPACK_RESOURCE_FILE_LICENSE "${CMAKE_CURRENT_SOURCE_DIR}/LICENSE") # Tarball generation set(CPACK_SOURCE_TGZ ON) set(CPACK_SOURCE_TBZ2 OFF) set(CPACK_SOURCE_TXZ OFF) set(CPACK_SOURCE_TZ OFF) set(CPACK_SOURCE_IGNORE_FILES "/data/components.cif;/build;/.vscode;/.git") set(CPACK_PACKAGE_FILE_NAME "${PROJECT_NAME}-${PROJECT_VERSION}") set(CPACK_SOURCE_PACKAGE_FILE_NAME ${CPACK_PACKAGE_FILE_NAME}) # NSIS options set(CPACK_NSIS_MODIFY_PATH ON) # configuration done, include CPack include(CPack) PDB-REDO-dssp-ca06797/Dockerfile000066400000000000000000000012211516741327300161560ustar00rootroot00000000000000FROM ubuntu:24.04 ENV TZ="Europe/Amsterdam" RUN apt-get update && \ apt-get install -yq tzdata && \ ln -fs /usr/share/zoneinfo/Europe/Amsterdam /etc/localtime && \ dpkg-reconfigure -f noninteractive tzdata && \ apt install -y build-essential cmake zlib1g-dev git libeigen3-dev libpcre2-dev WORKDIR /build # Build and install dssp COPY . /src RUN cd /src && \ rm -rf build && \ mkdir build && \ cmake -S . -B build -DCMAKE_BUILD_TYPE=Release -DBUILD_TESTING=OFF && \ cmake --build build -j $(nproc) && \ cmake --install build && \ echo "dssp installed" && \ rm -rf /src /build WORKDIR /data ENTRYPOINT ["mkdssp"] PDB-REDO-dssp-ca06797/LICENSE000066400000000000000000000024771516741327300152070ustar00rootroot00000000000000BSD-2-Clause License Copyright (c) 2020 NKI/AVL, Netherlands Cancer Institute All rights reserved. Redistribution and use in source and binary forms, with or without modification, are permitted provided that the following conditions are met: 1. Redistributions of source code must retain the above copyright notice, this list of conditions and the following disclaimer 2. Redistributions in binary form must reproduce the above copyright notice, this list of conditions and the following disclaimer in the documentation and/or other materials provided with the distribution. THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. PDB-REDO-dssp-ca06797/README.md000066400000000000000000000044231516741327300154520ustar00rootroot00000000000000[![github CI](https://github.com/pdb-redo/dssp/actions/workflows/cmake-multi-platform.yml/badge.svg)](https://github.com/pdb-redo/dssp/actions) [![GitHub License](https://img.shields.io/github/license/pdb-redo/dssp)](https://github.com/pdb-redo/dssp/LICENSE) DSSP 4.6 ======== This is a rewrite of DSSP, now offering full mmCIF support. The difference with previous releases of DSSP is that it now writes out an annotated mmCIF file by default, storing the secondary structure information in the `_struct_conf` category. Another new feature in this version of DSSP is that it now defines Poly-Proline helices as well. The DSSP program was designed by _Wolfgang Kabsch_ and _Chris Sander_ to standardize secondary structure assignment. DSSP is a database of secondary structure assignments (and much more) for all protein entries in the Protein Data Bank (PDB). DSSP is also the program that calculates DSSP entries from PDB entries. DSSP does **not** predict secondary structure. Requirements ------------ A good, modern compiler is needed to build the mkdssp program since it uses many new C++20 features. Building -------- The new makefile for dssp will take care of downloading and building all requirements automatically. So in theory, building is as simple as: ```console git clone https://github.com/PDB-REDO/dssp.git cd dssp cmake -S . -B build cmake --build build cmake --install build ``` Python module ------------- Since version 4.5.2 it is possible to build a Python module to directy work with DSSP info inside your Python scripts. To build and install the Python module use the following commands instead: ```console git clone https://github.com/PDB-REDO/dssp.git cd dssp cmake -S . -B build -DBUILD_PYTHON_MODULE=ON cmake --build build sudo cmake --install build ``` After that you can use dssp in a python script, like this: ```python from mkdssp import dssp import os import gzip file_path = os.path.join("..", "test", "1cbs.cif.gz") with gzip.open(file_path, "rt") as f: file_content = f.read() dssp = dssp(file_content) print("residues: ", dssp.statistics.residues) for res in dssp: print(res.asym_id, res.seq_id, res.compound_id, res.type) ``` Usage ----- See [manual page](doc/mkdssp.md) for more info. Or even better, see the [DSSP website](https://pdb-redo.eu/dssp). PDB-REDO-dssp-ca06797/changelog000066400000000000000000000064041516741327300160460ustar00rootroot00000000000000Version 4.6.1 - Using libcifpp 10.0.2 - Fix tests Version 4.6.0 - Using new libcifpp version 10.0 Version 4.5.8 - Using newer version of Boost for the python plugin, this was needed to be able to use Numpy >= 2.x Version 4.5.7 - Fix for unit-test in Debian repository Version 4.5.6 - Using libcifpp version 9.0.0 Version 4.5.5 - Clean up old DSSP data before writing new - Regression: check for pdbx_poly_seq_scheme and if missing use the repair mode to read the file. (i.e. cif::pdb::read) Version 4.5.4 - Update reference information - Better fix for locating/installing dictionary files Version 4.5.3 - Fix makefile to locate dictionary files Version 4.5.2 - Use find_package before fetching libraries, again - Added Python module Version 4.5.1 - Only use reconstructing load option when needed to save lots of time on large structures - Fixes in writing the audit_conform category - Fix dictionary location Version 4.5 - Based on new libcifpp version 8 - Fixed Dockerfile Version 4.4.11 - Write proper audit_conform records - Updated dssp-extension.dic file to include version info Version 4.4.10 - Support for installing in environments that do not use resources, this time for real. Version 4.4.9 - Support for installing in environments that do not use resources Version 4.4.8 - Fix writing version numbers Version 4.4.7 - Fix cmakefile to use system installed libraries by default Version 4.4.6 - Update dependency on libcifpp to version 7 Version 4.4.5 - Changes required for building on Windows Version 4.4.4 - Fix unit test Version 4.4.3 - Split the code in a sub project for libdssp and the main code for the executable. - New version string code. Version 4.4.2 - Fix unit test Version 4.4.1 - Generate documentation only when requested Version 4.4.0 - Packaging (split out the web server again) - Added markdown doc file, all doc files are now created from mkdssp.1 using pandoc, if that is installed. - small changes in output category item names (range_1 renamed to range_id_1) Version 4.3.1.1 - Check to see if data will fit in old format before starting calculations Version 4.3.1 - Optimised for speed - Fix in sheet numbering (mmCIF output) Version 4.3 - Write new output by default - Fix some issues with this new output, typo e.g. - Added web service implementation - Added mmcif_pdbx dictionary extension Version 4.2.2.1 - Fixed dependency on libcifpp Version 4.2.2 - Building for CCP4 - Fix is_cis Version 4.2.1 - The previous version was a bit overly strict - Introduce a --quiet flag. Version 4.2.0 - Changes for packaging - New mmCIF DSSP output, added several categories Version 4.1.0 - Based on new libcifpp version 5 Version 4.0.6 - Prevent heap buffer overflow writing annotated mmCIF file. Version 4.0.5 - The options for loading custom dictionary files and the like are now visible in the help again. Version 4.0.4 - New version string logic - Improved makefile Version 4.0.3 - Fixed makefile Version 4.0.2 - Dropped support for reading bzip2 files directly. gzipped is still supported Version 4.0.1 - Switch from GNU configure to cmake as the build environment Version 4.0.0 - Write the secondary structure information as an annotation to an mmCIF file (old format is still available as an option) - Added the recognition of Poly-Proline helices PDB-REDO-dssp-ca06797/cmake/000077500000000000000000000000001516741327300152505ustar00rootroot00000000000000PDB-REDO-dssp-ca06797/cmake/CPM.cmake000066400000000000000000001225111516741327300166730ustar00rootroot00000000000000# CPM.cmake - CMake's missing package manager # =========================================== # See https://github.com/cpm-cmake/CPM.cmake for usage and update instructions. # # MIT License # ----------- #[[ Copyright (c) 2019-2023 Lars Melchior and contributors Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the "Software"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions: The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software. THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. ]] cmake_minimum_required(VERSION 3.14 FATAL_ERROR) # Initialize logging prefix if(NOT CPM_INDENT) set(CPM_INDENT "CPM:" CACHE INTERNAL "" ) endif() if(NOT COMMAND cpm_message) function(cpm_message) message(${ARGV}) endfunction() endif() if(DEFINED EXTRACTED_CPM_VERSION) set(CURRENT_CPM_VERSION "${EXTRACTED_CPM_VERSION}${CPM_DEVELOPMENT}") else() set(CURRENT_CPM_VERSION 0.40.8) endif() get_filename_component(CPM_CURRENT_DIRECTORY "${CMAKE_CURRENT_LIST_DIR}" REALPATH) if(CPM_DIRECTORY) if(NOT CPM_DIRECTORY STREQUAL CPM_CURRENT_DIRECTORY) if(CPM_VERSION VERSION_LESS CURRENT_CPM_VERSION) message( AUTHOR_WARNING "${CPM_INDENT} \ A dependency is using a more recent CPM version (${CURRENT_CPM_VERSION}) than the current project (${CPM_VERSION}). \ It is recommended to upgrade CPM to the most recent version. \ See https://github.com/cpm-cmake/CPM.cmake for more information." ) endif() if(${CMAKE_VERSION} VERSION_LESS "3.17.0") include(FetchContent) endif() return() endif() get_property( CPM_INITIALIZED GLOBAL "" PROPERTY CPM_INITIALIZED SET ) if(CPM_INITIALIZED) return() endif() endif() if(CURRENT_CPM_VERSION MATCHES "development-version") message( WARNING "${CPM_INDENT} Your project is using an unstable development version of CPM.cmake. \ Please update to a recent release if possible. \ See https://github.com/cpm-cmake/CPM.cmake for details." ) endif() set_property(GLOBAL PROPERTY CPM_INITIALIZED true) macro(cpm_set_policies) # the policy allows us to change options without caching cmake_policy(SET CMP0077 NEW) set(CMAKE_POLICY_DEFAULT_CMP0077 NEW) # the policy allows us to change set(CACHE) without caching if(POLICY CMP0126) cmake_policy(SET CMP0126 NEW) set(CMAKE_POLICY_DEFAULT_CMP0126 NEW) endif() # The policy uses the download time for timestamp, instead of the timestamp in the archive. This # allows for proper rebuilds when a projects url changes if(POLICY CMP0135) cmake_policy(SET CMP0135 NEW) set(CMAKE_POLICY_DEFAULT_CMP0135 NEW) endif() # treat relative git repository paths as being relative to the parent project's remote if(POLICY CMP0150) cmake_policy(SET CMP0150 NEW) set(CMAKE_POLICY_DEFAULT_CMP0150 NEW) endif() endmacro() cpm_set_policies() option(CPM_USE_LOCAL_PACKAGES "Always try to use `find_package` to get dependencies" $ENV{CPM_USE_LOCAL_PACKAGES} ) option(CPM_LOCAL_PACKAGES_ONLY "Only use `find_package` to get dependencies" $ENV{CPM_LOCAL_PACKAGES_ONLY} ) option(CPM_DOWNLOAD_ALL "Always download dependencies from source" $ENV{CPM_DOWNLOAD_ALL}) option(CPM_DONT_UPDATE_MODULE_PATH "Don't update the module path to allow using find_package" $ENV{CPM_DONT_UPDATE_MODULE_PATH} ) option(CPM_DONT_CREATE_PACKAGE_LOCK "Don't create a package lock file in the binary path" $ENV{CPM_DONT_CREATE_PACKAGE_LOCK} ) option(CPM_INCLUDE_ALL_IN_PACKAGE_LOCK "Add all packages added through CPM.cmake to the package lock" $ENV{CPM_INCLUDE_ALL_IN_PACKAGE_LOCK} ) option(CPM_USE_NAMED_CACHE_DIRECTORIES "Use additional directory of package name in cache on the most nested level." $ENV{CPM_USE_NAMED_CACHE_DIRECTORIES} ) set(CPM_VERSION ${CURRENT_CPM_VERSION} CACHE INTERNAL "" ) set(CPM_DIRECTORY ${CPM_CURRENT_DIRECTORY} CACHE INTERNAL "" ) set(CPM_FILE ${CMAKE_CURRENT_LIST_FILE} CACHE INTERNAL "" ) set(CPM_PACKAGES "" CACHE INTERNAL "" ) set(CPM_DRY_RUN OFF CACHE INTERNAL "Don't download or configure dependencies (for testing)" ) if(DEFINED ENV{CPM_SOURCE_CACHE}) set(CPM_SOURCE_CACHE_DEFAULT $ENV{CPM_SOURCE_CACHE}) else() set(CPM_SOURCE_CACHE_DEFAULT OFF) endif() set(CPM_SOURCE_CACHE ${CPM_SOURCE_CACHE_DEFAULT} CACHE PATH "Directory to download CPM dependencies" ) if(NOT CPM_DONT_UPDATE_MODULE_PATH AND NOT DEFINED CMAKE_FIND_PACKAGE_REDIRECTS_DIR) set(CPM_MODULE_PATH "${CMAKE_BINARY_DIR}/CPM_modules" CACHE INTERNAL "" ) # remove old modules file(REMOVE_RECURSE ${CPM_MODULE_PATH}) file(MAKE_DIRECTORY ${CPM_MODULE_PATH}) # locally added CPM modules should override global packages set(CMAKE_MODULE_PATH "${CPM_MODULE_PATH};${CMAKE_MODULE_PATH}") endif() if(NOT CPM_DONT_CREATE_PACKAGE_LOCK) set(CPM_PACKAGE_LOCK_FILE "${CMAKE_BINARY_DIR}/cpm-package-lock.cmake" CACHE INTERNAL "" ) file(WRITE ${CPM_PACKAGE_LOCK_FILE} "# CPM Package Lock\n# This file should be committed to version control\n\n" ) endif() include(FetchContent) # Try to infer package name from git repository uri (path or url) function(cpm_package_name_from_git_uri URI RESULT) if("${URI}" MATCHES "([^/:]+)/?.git/?$") set(${RESULT} ${CMAKE_MATCH_1} PARENT_SCOPE ) else() unset(${RESULT} PARENT_SCOPE) endif() endfunction() # Try to infer package name and version from a url function(cpm_package_name_and_ver_from_url url outName outVer) if(url MATCHES "[/\\?]([a-zA-Z0-9_\\.-]+)\\.(tar|tar\\.gz|tar\\.bz2|zip|ZIP)(\\?|/|$)") # We matched an archive set(filename "${CMAKE_MATCH_1}") if(filename MATCHES "([a-zA-Z0-9_\\.-]+)[_-]v?(([0-9]+\\.)*[0-9]+[a-zA-Z0-9]*)") # We matched - (ie foo-1.2.3) set(${outName} "${CMAKE_MATCH_1}" PARENT_SCOPE ) set(${outVer} "${CMAKE_MATCH_2}" PARENT_SCOPE ) elseif(filename MATCHES "(([0-9]+\\.)+[0-9]+[a-zA-Z0-9]*)") # We couldn't find a name, but we found a version # # In many cases (which we don't handle here) the url would look something like # `irrelevant/ACTUAL_PACKAGE_NAME/irrelevant/1.2.3.zip`. In such a case we can't possibly # distinguish the package name from the irrelevant bits. Moreover if we try to match the # package name from the filename, we'd get bogus at best. unset(${outName} PARENT_SCOPE) set(${outVer} "${CMAKE_MATCH_1}" PARENT_SCOPE ) else() # Boldly assume that the file name is the package name. # # Yes, something like `irrelevant/ACTUAL_NAME/irrelevant/download.zip` will ruin our day, but # such cases should be quite rare. No popular service does this... we think. set(${outName} "${filename}" PARENT_SCOPE ) unset(${outVer} PARENT_SCOPE) endif() else() # No ideas yet what to do with non-archives unset(${outName} PARENT_SCOPE) unset(${outVer} PARENT_SCOPE) endif() endfunction() function(cpm_find_package NAME VERSION) string(REPLACE " " ";" EXTRA_ARGS "${ARGN}") find_package(${NAME} ${VERSION} ${EXTRA_ARGS} QUIET) if(${CPM_ARGS_NAME}_FOUND) if(DEFINED ${CPM_ARGS_NAME}_VERSION) set(VERSION ${${CPM_ARGS_NAME}_VERSION}) endif() cpm_message(STATUS "${CPM_INDENT} Using local package ${CPM_ARGS_NAME}@${VERSION}") CPMRegisterPackage(${CPM_ARGS_NAME} "${VERSION}") set(CPM_PACKAGE_FOUND YES PARENT_SCOPE ) else() set(CPM_PACKAGE_FOUND NO PARENT_SCOPE ) endif() endfunction() # Create a custom FindXXX.cmake module for a CPM package This prevents `find_package(NAME)` from # finding the system library function(cpm_create_module_file Name) if(NOT CPM_DONT_UPDATE_MODULE_PATH) if(DEFINED CMAKE_FIND_PACKAGE_REDIRECTS_DIR) # Redirect find_package calls to the CPM package. This is what FetchContent does when you set # OVERRIDE_FIND_PACKAGE. The CMAKE_FIND_PACKAGE_REDIRECTS_DIR works for find_package in CONFIG # mode, unlike the Find${Name}.cmake fallback. CMAKE_FIND_PACKAGE_REDIRECTS_DIR is not defined # in script mode, or in CMake < 3.24. # https://cmake.org/cmake/help/latest/module/FetchContent.html#fetchcontent-find-package-integration-examples string(TOLOWER ${Name} NameLower) file(WRITE ${CMAKE_FIND_PACKAGE_REDIRECTS_DIR}/${NameLower}-config.cmake "include(\"\${CMAKE_CURRENT_LIST_DIR}/${NameLower}-extra.cmake\" OPTIONAL)\n" "include(\"\${CMAKE_CURRENT_LIST_DIR}/${Name}Extra.cmake\" OPTIONAL)\n" ) file(WRITE ${CMAKE_FIND_PACKAGE_REDIRECTS_DIR}/${NameLower}-config-version.cmake "set(PACKAGE_VERSION_COMPATIBLE TRUE)\n" "set(PACKAGE_VERSION_EXACT TRUE)\n" ) else() file(WRITE ${CPM_MODULE_PATH}/Find${Name}.cmake "include(\"${CPM_FILE}\")\n${ARGN}\nset(${Name}_FOUND TRUE)" ) endif() endif() endfunction() # Find a package locally or fallback to CPMAddPackage function(CPMFindPackage) set(oneValueArgs NAME VERSION GIT_TAG FIND_PACKAGE_ARGUMENTS) cmake_parse_arguments(CPM_ARGS "" "${oneValueArgs}" "" ${ARGN}) if(NOT DEFINED CPM_ARGS_VERSION) if(DEFINED CPM_ARGS_GIT_TAG) cpm_get_version_from_git_tag("${CPM_ARGS_GIT_TAG}" CPM_ARGS_VERSION) endif() endif() set(downloadPackage ${CPM_DOWNLOAD_ALL}) if(DEFINED CPM_DOWNLOAD_${CPM_ARGS_NAME}) set(downloadPackage ${CPM_DOWNLOAD_${CPM_ARGS_NAME}}) elseif(DEFINED ENV{CPM_DOWNLOAD_${CPM_ARGS_NAME}}) set(downloadPackage $ENV{CPM_DOWNLOAD_${CPM_ARGS_NAME}}) endif() if(downloadPackage) CPMAddPackage(${ARGN}) cpm_export_variables(${CPM_ARGS_NAME}) return() endif() cpm_find_package(${CPM_ARGS_NAME} "${CPM_ARGS_VERSION}" ${CPM_ARGS_FIND_PACKAGE_ARGUMENTS}) if(NOT CPM_PACKAGE_FOUND) CPMAddPackage(${ARGN}) cpm_export_variables(${CPM_ARGS_NAME}) endif() endfunction() # checks if a package has been added before function(cpm_check_if_package_already_added CPM_ARGS_NAME CPM_ARGS_VERSION) if("${CPM_ARGS_NAME}" IN_LIST CPM_PACKAGES) CPMGetPackageVersion(${CPM_ARGS_NAME} CPM_PACKAGE_VERSION) if("${CPM_PACKAGE_VERSION}" VERSION_LESS "${CPM_ARGS_VERSION}") message( WARNING "${CPM_INDENT} Requires a newer version of ${CPM_ARGS_NAME} (${CPM_ARGS_VERSION}) than currently included (${CPM_PACKAGE_VERSION})." ) endif() cpm_get_fetch_properties(${CPM_ARGS_NAME}) set(${CPM_ARGS_NAME}_ADDED NO) set(CPM_PACKAGE_ALREADY_ADDED YES PARENT_SCOPE ) cpm_export_variables(${CPM_ARGS_NAME}) else() set(CPM_PACKAGE_ALREADY_ADDED NO PARENT_SCOPE ) endif() endfunction() # Parse the argument of CPMAddPackage in case a single one was provided and convert it to a list of # arguments which can then be parsed idiomatically. For example gh:foo/bar@1.2.3 will be converted # to: GITHUB_REPOSITORY;foo/bar;VERSION;1.2.3 function(cpm_parse_add_package_single_arg arg outArgs) # Look for a scheme if("${arg}" MATCHES "^([a-zA-Z]+):(.+)$") string(TOLOWER "${CMAKE_MATCH_1}" scheme) set(uri "${CMAKE_MATCH_2}") # Check for CPM-specific schemes if(scheme STREQUAL "gh") set(out "GITHUB_REPOSITORY;${uri}") set(packageType "git") elseif(scheme STREQUAL "gl") set(out "GITLAB_REPOSITORY;${uri}") set(packageType "git") elseif(scheme STREQUAL "bb") set(out "BITBUCKET_REPOSITORY;${uri}") set(packageType "git") # A CPM-specific scheme was not found. Looks like this is a generic URL so try to determine # type elseif(arg MATCHES ".git/?(@|#|$)") set(out "GIT_REPOSITORY;${arg}") set(packageType "git") else() # Fall back to a URL set(out "URL;${arg}") set(packageType "archive") # We could also check for SVN since FetchContent supports it, but SVN is so rare these days. # We just won't bother with the additional complexity it will induce in this function. SVN is # done by multi-arg endif() else() if(arg MATCHES ".git/?(@|#|$)") set(out "GIT_REPOSITORY;${arg}") set(packageType "git") else() # Give up message(FATAL_ERROR "${CPM_INDENT} Can't determine package type of '${arg}'") endif() endif() # For all packages we interpret @... as version. Only replace the last occurrence. Thus URIs # containing '@' can be used string(REGEX REPLACE "@([^@]+)$" ";VERSION;\\1" out "${out}") # Parse the rest according to package type if(packageType STREQUAL "git") # For git repos we interpret #... as a tag or branch or commit hash string(REGEX REPLACE "#([^#]+)$" ";GIT_TAG;\\1" out "${out}") elseif(packageType STREQUAL "archive") # For archives we interpret #... as a URL hash. string(REGEX REPLACE "#([^#]+)$" ";URL_HASH;\\1" out "${out}") # We don't try to parse the version if it's not provided explicitly. cpm_get_version_from_url # should do this at a later point else() # We should never get here. This is an assertion and hitting it means there's a problem with the # code above. A packageType was set, but not handled by this if-else. message(FATAL_ERROR "${CPM_INDENT} Unsupported package type '${packageType}' of '${arg}'") endif() set(${outArgs} ${out} PARENT_SCOPE ) endfunction() # Check that the working directory for a git repo is clean function(cpm_check_git_working_dir_is_clean repoPath gitTag isClean) find_package(Git REQUIRED) if(NOT GIT_EXECUTABLE) # No git executable, assume directory is clean set(${isClean} TRUE PARENT_SCOPE ) return() endif() # check for uncommitted changes execute_process( COMMAND ${GIT_EXECUTABLE} status --porcelain RESULT_VARIABLE resultGitStatus OUTPUT_VARIABLE repoStatus OUTPUT_STRIP_TRAILING_WHITESPACE ERROR_QUIET WORKING_DIRECTORY ${repoPath} ) if(resultGitStatus) # not supposed to happen, assume clean anyway message(WARNING "${CPM_INDENT} Calling git status on folder ${repoPath} failed") set(${isClean} TRUE PARENT_SCOPE ) return() endif() if(NOT "${repoStatus}" STREQUAL "") set(${isClean} FALSE PARENT_SCOPE ) return() endif() # check for committed changes execute_process( COMMAND ${GIT_EXECUTABLE} diff -s --exit-code ${gitTag} RESULT_VARIABLE resultGitDiff OUTPUT_STRIP_TRAILING_WHITESPACE OUTPUT_QUIET WORKING_DIRECTORY ${repoPath} ) if(${resultGitDiff} EQUAL 0) set(${isClean} TRUE PARENT_SCOPE ) else() set(${isClean} FALSE PARENT_SCOPE ) endif() endfunction() # Add PATCH_COMMAND to CPM_ARGS_UNPARSED_ARGUMENTS. This method consumes a list of files in ARGN # then generates a `PATCH_COMMAND` appropriate for `ExternalProject_Add()`. This command is appended # to the parent scope's `CPM_ARGS_UNPARSED_ARGUMENTS`. function(cpm_add_patches) # Return if no patch files are supplied. if(NOT ARGN) return() endif() # Find the patch program. find_program(PATCH_EXECUTABLE patch) if(CMAKE_HOST_WIN32 AND NOT PATCH_EXECUTABLE) # The Windows git executable is distributed with patch.exe. Find the path to the executable, if # it exists, then search `../usr/bin` and `../../usr/bin` for patch.exe. find_package(Git QUIET) if(GIT_EXECUTABLE) get_filename_component(extra_search_path ${GIT_EXECUTABLE} DIRECTORY) get_filename_component(extra_search_path_1up ${extra_search_path} DIRECTORY) get_filename_component(extra_search_path_2up ${extra_search_path_1up} DIRECTORY) find_program( PATCH_EXECUTABLE patch HINTS "${extra_search_path_1up}/usr/bin" "${extra_search_path_2up}/usr/bin" ) endif() endif() if(NOT PATCH_EXECUTABLE) message(FATAL_ERROR "Couldn't find `patch` executable to use with PATCHES keyword.") endif() # Create a temporary set(temp_list ${CPM_ARGS_UNPARSED_ARGUMENTS}) # Ensure each file exists (or error out) and add it to the list. set(first_item True) foreach(PATCH_FILE ${ARGN}) # Make sure the patch file exists, if we can't find it, try again in the current directory. if(NOT EXISTS "${PATCH_FILE}") if(NOT EXISTS "${CMAKE_CURRENT_LIST_DIR}/${PATCH_FILE}") message(FATAL_ERROR "Couldn't find patch file: '${PATCH_FILE}'") endif() set(PATCH_FILE "${CMAKE_CURRENT_LIST_DIR}/${PATCH_FILE}") endif() # Convert to absolute path for use with patch file command. get_filename_component(PATCH_FILE "${PATCH_FILE}" ABSOLUTE) # The first patch entry must be preceded by "PATCH_COMMAND" while the following items are # preceded by "&&". if(first_item) set(first_item False) list(APPEND temp_list "PATCH_COMMAND") else() list(APPEND temp_list "&&") endif() # Add the patch command to the list list(APPEND temp_list "${PATCH_EXECUTABLE}" "-p1" "<" "${PATCH_FILE}") endforeach() # Move temp out into parent scope. set(CPM_ARGS_UNPARSED_ARGUMENTS ${temp_list} PARENT_SCOPE ) endfunction() # method to overwrite internal FetchContent properties, to allow using CPM.cmake to overload # FetchContent calls. As these are internal cmake properties, this method should be used carefully # and may need modification in future CMake versions. Source: # https://github.com/Kitware/CMake/blob/dc3d0b5a0a7d26d43d6cfeb511e224533b5d188f/Modules/FetchContent.cmake#L1152 function(cpm_override_fetchcontent contentName) cmake_parse_arguments(PARSE_ARGV 1 arg "" "SOURCE_DIR;BINARY_DIR" "") if(NOT "${arg_UNPARSED_ARGUMENTS}" STREQUAL "") message(FATAL_ERROR "${CPM_INDENT} Unsupported arguments: ${arg_UNPARSED_ARGUMENTS}") endif() string(TOLOWER ${contentName} contentNameLower) set(prefix "_FetchContent_${contentNameLower}") set(propertyName "${prefix}_sourceDir") define_property( GLOBAL PROPERTY ${propertyName} BRIEF_DOCS "Internal implementation detail of FetchContent_Populate()" FULL_DOCS "Details used by FetchContent_Populate() for ${contentName}" ) set_property(GLOBAL PROPERTY ${propertyName} "${arg_SOURCE_DIR}") set(propertyName "${prefix}_binaryDir") define_property( GLOBAL PROPERTY ${propertyName} BRIEF_DOCS "Internal implementation detail of FetchContent_Populate()" FULL_DOCS "Details used by FetchContent_Populate() for ${contentName}" ) set_property(GLOBAL PROPERTY ${propertyName} "${arg_BINARY_DIR}") set(propertyName "${prefix}_populated") define_property( GLOBAL PROPERTY ${propertyName} BRIEF_DOCS "Internal implementation detail of FetchContent_Populate()" FULL_DOCS "Details used by FetchContent_Populate() for ${contentName}" ) set_property(GLOBAL PROPERTY ${propertyName} TRUE) endfunction() # Download and add a package from source function(CPMAddPackage) cpm_set_policies() list(LENGTH ARGN argnLength) if(argnLength EQUAL 1) cpm_parse_add_package_single_arg("${ARGN}" ARGN) # The shorthand syntax implies EXCLUDE_FROM_ALL and SYSTEM set(ARGN "${ARGN};EXCLUDE_FROM_ALL;YES;SYSTEM;YES;") endif() set(oneValueArgs NAME FORCE VERSION GIT_TAG DOWNLOAD_ONLY GITHUB_REPOSITORY GITLAB_REPOSITORY BITBUCKET_REPOSITORY GIT_REPOSITORY SOURCE_DIR FIND_PACKAGE_ARGUMENTS NO_CACHE SYSTEM GIT_SHALLOW EXCLUDE_FROM_ALL SOURCE_SUBDIR CUSTOM_CACHE_KEY ) set(multiValueArgs URL OPTIONS DOWNLOAD_COMMAND PATCHES) cmake_parse_arguments(CPM_ARGS "" "${oneValueArgs}" "${multiValueArgs}" "${ARGN}") # Set default values for arguments if(NOT DEFINED CPM_ARGS_VERSION) if(DEFINED CPM_ARGS_GIT_TAG) cpm_get_version_from_git_tag("${CPM_ARGS_GIT_TAG}" CPM_ARGS_VERSION) endif() endif() if(CPM_ARGS_DOWNLOAD_ONLY) set(DOWNLOAD_ONLY ${CPM_ARGS_DOWNLOAD_ONLY}) else() set(DOWNLOAD_ONLY NO) endif() if(DEFINED CPM_ARGS_GITHUB_REPOSITORY) set(CPM_ARGS_GIT_REPOSITORY "https://github.com/${CPM_ARGS_GITHUB_REPOSITORY}.git") elseif(DEFINED CPM_ARGS_GITLAB_REPOSITORY) set(CPM_ARGS_GIT_REPOSITORY "https://gitlab.com/${CPM_ARGS_GITLAB_REPOSITORY}.git") elseif(DEFINED CPM_ARGS_BITBUCKET_REPOSITORY) set(CPM_ARGS_GIT_REPOSITORY "https://bitbucket.org/${CPM_ARGS_BITBUCKET_REPOSITORY}.git") endif() if(DEFINED CPM_ARGS_GIT_REPOSITORY) list(APPEND CPM_ARGS_UNPARSED_ARGUMENTS GIT_REPOSITORY ${CPM_ARGS_GIT_REPOSITORY}) if(NOT DEFINED CPM_ARGS_GIT_TAG) set(CPM_ARGS_GIT_TAG v${CPM_ARGS_VERSION}) endif() # If a name wasn't provided, try to infer it from the git repo if(NOT DEFINED CPM_ARGS_NAME) cpm_package_name_from_git_uri(${CPM_ARGS_GIT_REPOSITORY} CPM_ARGS_NAME) endif() endif() set(CPM_SKIP_FETCH FALSE) if(DEFINED CPM_ARGS_GIT_TAG) list(APPEND CPM_ARGS_UNPARSED_ARGUMENTS GIT_TAG ${CPM_ARGS_GIT_TAG}) # If GIT_SHALLOW is explicitly specified, honor the value. if(DEFINED CPM_ARGS_GIT_SHALLOW) list(APPEND CPM_ARGS_UNPARSED_ARGUMENTS GIT_SHALLOW ${CPM_ARGS_GIT_SHALLOW}) endif() endif() if(DEFINED CPM_ARGS_URL) # If a name or version aren't provided, try to infer them from the URL list(GET CPM_ARGS_URL 0 firstUrl) cpm_package_name_and_ver_from_url(${firstUrl} nameFromUrl verFromUrl) # If we fail to obtain name and version from the first URL, we could try other URLs if any. # However multiple URLs are expected to be quite rare, so for now we won't bother. # If the caller provided their own name and version, they trump the inferred ones. if(NOT DEFINED CPM_ARGS_NAME) set(CPM_ARGS_NAME ${nameFromUrl}) endif() if(NOT DEFINED CPM_ARGS_VERSION) set(CPM_ARGS_VERSION ${verFromUrl}) endif() list(APPEND CPM_ARGS_UNPARSED_ARGUMENTS URL "${CPM_ARGS_URL}") endif() # Check for required arguments if(NOT DEFINED CPM_ARGS_NAME) message( FATAL_ERROR "${CPM_INDENT} 'NAME' was not provided and couldn't be automatically inferred for package added with arguments: '${ARGN}'" ) endif() # Check if package has been added before cpm_check_if_package_already_added(${CPM_ARGS_NAME} "${CPM_ARGS_VERSION}") if(CPM_PACKAGE_ALREADY_ADDED) cpm_export_variables(${CPM_ARGS_NAME}) return() endif() # Check for manual overrides if(NOT CPM_ARGS_FORCE AND NOT "${CPM_${CPM_ARGS_NAME}_SOURCE}" STREQUAL "") set(PACKAGE_SOURCE ${CPM_${CPM_ARGS_NAME}_SOURCE}) set(CPM_${CPM_ARGS_NAME}_SOURCE "") CPMAddPackage( NAME "${CPM_ARGS_NAME}" SOURCE_DIR "${PACKAGE_SOURCE}" EXCLUDE_FROM_ALL "${CPM_ARGS_EXCLUDE_FROM_ALL}" SYSTEM "${CPM_ARGS_SYSTEM}" PATCHES "${CPM_ARGS_PATCHES}" OPTIONS "${CPM_ARGS_OPTIONS}" SOURCE_SUBDIR "${CPM_ARGS_SOURCE_SUBDIR}" DOWNLOAD_ONLY "${DOWNLOAD_ONLY}" FORCE True ) cpm_export_variables(${CPM_ARGS_NAME}) return() endif() # Check for available declaration if(NOT CPM_ARGS_FORCE AND NOT "${CPM_DECLARATION_${CPM_ARGS_NAME}}" STREQUAL "") set(declaration ${CPM_DECLARATION_${CPM_ARGS_NAME}}) set(CPM_DECLARATION_${CPM_ARGS_NAME} "") CPMAddPackage(${declaration}) cpm_export_variables(${CPM_ARGS_NAME}) # checking again to ensure version and option compatibility cpm_check_if_package_already_added(${CPM_ARGS_NAME} "${CPM_ARGS_VERSION}") return() endif() if(NOT CPM_ARGS_FORCE) if(CPM_USE_LOCAL_PACKAGES OR CPM_LOCAL_PACKAGES_ONLY) cpm_find_package(${CPM_ARGS_NAME} "${CPM_ARGS_VERSION}" ${CPM_ARGS_FIND_PACKAGE_ARGUMENTS}) if(CPM_PACKAGE_FOUND) cpm_export_variables(${CPM_ARGS_NAME}) return() endif() if(CPM_LOCAL_PACKAGES_ONLY) message( SEND_ERROR "${CPM_INDENT} ${CPM_ARGS_NAME} not found via find_package(${CPM_ARGS_NAME} ${CPM_ARGS_VERSION})" ) endif() endif() endif() CPMRegisterPackage("${CPM_ARGS_NAME}" "${CPM_ARGS_VERSION}") if(DEFINED CPM_ARGS_GIT_TAG) set(PACKAGE_INFO "${CPM_ARGS_GIT_TAG}") elseif(DEFINED CPM_ARGS_SOURCE_DIR) set(PACKAGE_INFO "${CPM_ARGS_SOURCE_DIR}") else() set(PACKAGE_INFO "${CPM_ARGS_VERSION}") endif() if(DEFINED FETCHCONTENT_BASE_DIR) # respect user's FETCHCONTENT_BASE_DIR if set set(CPM_FETCHCONTENT_BASE_DIR ${FETCHCONTENT_BASE_DIR}) else() set(CPM_FETCHCONTENT_BASE_DIR ${CMAKE_BINARY_DIR}/_deps) endif() cpm_add_patches(${CPM_ARGS_PATCHES}) if(DEFINED CPM_ARGS_DOWNLOAD_COMMAND) list(APPEND CPM_ARGS_UNPARSED_ARGUMENTS DOWNLOAD_COMMAND ${CPM_ARGS_DOWNLOAD_COMMAND}) elseif(DEFINED CPM_ARGS_SOURCE_DIR) list(APPEND CPM_ARGS_UNPARSED_ARGUMENTS SOURCE_DIR ${CPM_ARGS_SOURCE_DIR}) if(NOT IS_ABSOLUTE ${CPM_ARGS_SOURCE_DIR}) # Expand `CPM_ARGS_SOURCE_DIR` relative path. This is important because EXISTS doesn't work # for relative paths. get_filename_component( source_directory ${CPM_ARGS_SOURCE_DIR} REALPATH BASE_DIR ${CMAKE_CURRENT_BINARY_DIR} ) else() set(source_directory ${CPM_ARGS_SOURCE_DIR}) endif() if(NOT EXISTS ${source_directory}) string(TOLOWER ${CPM_ARGS_NAME} lower_case_name) # remove timestamps so CMake will re-download the dependency file(REMOVE_RECURSE "${CPM_FETCHCONTENT_BASE_DIR}/${lower_case_name}-subbuild") endif() elseif(CPM_SOURCE_CACHE AND NOT CPM_ARGS_NO_CACHE) string(TOLOWER ${CPM_ARGS_NAME} lower_case_name) set(origin_parameters ${CPM_ARGS_UNPARSED_ARGUMENTS}) list(SORT origin_parameters) if(CPM_ARGS_CUSTOM_CACHE_KEY) # Application set a custom unique directory name set(download_directory ${CPM_SOURCE_CACHE}/${lower_case_name}/${CPM_ARGS_CUSTOM_CACHE_KEY}) elseif(CPM_USE_NAMED_CACHE_DIRECTORIES) string(SHA1 origin_hash "${origin_parameters};NEW_CACHE_STRUCTURE_TAG") set(download_directory ${CPM_SOURCE_CACHE}/${lower_case_name}/${origin_hash}/${CPM_ARGS_NAME}) else() string(SHA1 origin_hash "${origin_parameters}") set(download_directory ${CPM_SOURCE_CACHE}/${lower_case_name}/${origin_hash}) endif() # Expand `download_directory` relative path. This is important because EXISTS doesn't work for # relative paths. get_filename_component(download_directory ${download_directory} ABSOLUTE) list(APPEND CPM_ARGS_UNPARSED_ARGUMENTS SOURCE_DIR ${download_directory}) if(CPM_SOURCE_CACHE) file(LOCK ${download_directory}/../cmake.lock) endif() if(EXISTS ${download_directory}) if(CPM_SOURCE_CACHE) file(LOCK ${download_directory}/../cmake.lock RELEASE) endif() cpm_store_fetch_properties( ${CPM_ARGS_NAME} "${download_directory}" "${CPM_FETCHCONTENT_BASE_DIR}/${lower_case_name}-build" ) cpm_get_fetch_properties("${CPM_ARGS_NAME}") if(DEFINED CPM_ARGS_GIT_TAG AND NOT (PATCH_COMMAND IN_LIST CPM_ARGS_UNPARSED_ARGUMENTS)) # warn if cache has been changed since checkout cpm_check_git_working_dir_is_clean(${download_directory} ${CPM_ARGS_GIT_TAG} IS_CLEAN) if(NOT ${IS_CLEAN}) message( WARNING "${CPM_INDENT} Cache for ${CPM_ARGS_NAME} (${download_directory}) is dirty" ) endif() endif() cpm_add_subdirectory( "${CPM_ARGS_NAME}" "${DOWNLOAD_ONLY}" "${${CPM_ARGS_NAME}_SOURCE_DIR}/${CPM_ARGS_SOURCE_SUBDIR}" "${${CPM_ARGS_NAME}_BINARY_DIR}" "${CPM_ARGS_EXCLUDE_FROM_ALL}" "${CPM_ARGS_SYSTEM}" "${CPM_ARGS_OPTIONS}" ) set(PACKAGE_INFO "${PACKAGE_INFO} at ${download_directory}") # As the source dir is already cached/populated, we override the call to FetchContent. set(CPM_SKIP_FETCH TRUE) cpm_override_fetchcontent( "${lower_case_name}" SOURCE_DIR "${${CPM_ARGS_NAME}_SOURCE_DIR}/${CPM_ARGS_SOURCE_SUBDIR}" BINARY_DIR "${${CPM_ARGS_NAME}_BINARY_DIR}" ) else() # Enable shallow clone when GIT_TAG is not a commit hash. Our guess may not be accurate, but # it should guarantee no commit hash get mis-detected. if(NOT DEFINED CPM_ARGS_GIT_SHALLOW) cpm_is_git_tag_commit_hash("${CPM_ARGS_GIT_TAG}" IS_HASH) if(NOT ${IS_HASH}) list(APPEND CPM_ARGS_UNPARSED_ARGUMENTS GIT_SHALLOW TRUE) endif() endif() # remove timestamps so CMake will re-download the dependency file(REMOVE_RECURSE ${CPM_FETCHCONTENT_BASE_DIR}/${lower_case_name}-subbuild) set(PACKAGE_INFO "${PACKAGE_INFO} to ${download_directory}") endif() endif() if(NOT "${DOWNLOAD_ONLY}") cpm_create_module_file(${CPM_ARGS_NAME} "CPMAddPackage(\"${ARGN}\")") endif() if(CPM_PACKAGE_LOCK_ENABLED) if((CPM_ARGS_VERSION AND NOT CPM_ARGS_SOURCE_DIR) OR CPM_INCLUDE_ALL_IN_PACKAGE_LOCK) cpm_add_to_package_lock(${CPM_ARGS_NAME} "${ARGN}") elseif(CPM_ARGS_SOURCE_DIR) cpm_add_comment_to_package_lock(${CPM_ARGS_NAME} "local directory") else() cpm_add_comment_to_package_lock(${CPM_ARGS_NAME} "${ARGN}") endif() endif() cpm_message( STATUS "${CPM_INDENT} Adding package ${CPM_ARGS_NAME}@${CPM_ARGS_VERSION} (${PACKAGE_INFO})" ) if(NOT CPM_SKIP_FETCH) # CMake 3.28 added EXCLUDE, SYSTEM (3.25), and SOURCE_SUBDIR (3.18) to FetchContent_Declare. # Calling FetchContent_MakeAvailable will then internally forward these options to # add_subdirectory. Up until these changes, we had to call FetchContent_Populate and # add_subdirectory separately, which is no longer necessary and has been deprecated as of 3.30. # A Bug in CMake prevents us to use the non-deprecated functions until 3.30.3. set(fetchContentDeclareExtraArgs "") if(${CMAKE_VERSION} VERSION_GREATER_EQUAL "3.30.3") if(${CPM_ARGS_EXCLUDE_FROM_ALL}) list(APPEND fetchContentDeclareExtraArgs EXCLUDE_FROM_ALL) endif() if(${CPM_ARGS_SYSTEM}) list(APPEND fetchContentDeclareExtraArgs SYSTEM) endif() if(DEFINED CPM_ARGS_SOURCE_SUBDIR) list(APPEND fetchContentDeclareExtraArgs SOURCE_SUBDIR ${CPM_ARGS_SOURCE_SUBDIR}) endif() # For CMake version <3.28 OPTIONS are parsed in cpm_add_subdirectory if(CPM_ARGS_OPTIONS AND NOT DOWNLOAD_ONLY) foreach(OPTION ${CPM_ARGS_OPTIONS}) cpm_parse_option("${OPTION}") set(${OPTION_KEY} "${OPTION_VALUE}") endforeach() endif() endif() cpm_declare_fetch( "${CPM_ARGS_NAME}" ${fetchContentDeclareExtraArgs} "${CPM_ARGS_UNPARSED_ARGUMENTS}" ) cpm_fetch_package("${CPM_ARGS_NAME}" ${DOWNLOAD_ONLY} populated ${CPM_ARGS_UNPARSED_ARGUMENTS}) if(CPM_SOURCE_CACHE AND download_directory) file(LOCK ${download_directory}/../cmake.lock RELEASE) endif() if(${populated} AND ${CMAKE_VERSION} VERSION_LESS "3.30.3") cpm_add_subdirectory( "${CPM_ARGS_NAME}" "${DOWNLOAD_ONLY}" "${${CPM_ARGS_NAME}_SOURCE_DIR}/${CPM_ARGS_SOURCE_SUBDIR}" "${${CPM_ARGS_NAME}_BINARY_DIR}" "${CPM_ARGS_EXCLUDE_FROM_ALL}" "${CPM_ARGS_SYSTEM}" "${CPM_ARGS_OPTIONS}" ) endif() cpm_get_fetch_properties("${CPM_ARGS_NAME}") endif() set(${CPM_ARGS_NAME}_ADDED YES) cpm_export_variables("${CPM_ARGS_NAME}") endfunction() # Fetch a previously declared package macro(CPMGetPackage Name) if(DEFINED "CPM_DECLARATION_${Name}") CPMAddPackage(NAME ${Name}) else() message(SEND_ERROR "${CPM_INDENT} Cannot retrieve package ${Name}: no declaration available") endif() endmacro() # export variables available to the caller to the parent scope expects ${CPM_ARGS_NAME} to be set macro(cpm_export_variables name) set(${name}_SOURCE_DIR "${${name}_SOURCE_DIR}" PARENT_SCOPE ) set(${name}_BINARY_DIR "${${name}_BINARY_DIR}" PARENT_SCOPE ) set(${name}_ADDED "${${name}_ADDED}" PARENT_SCOPE ) set(CPM_LAST_PACKAGE_NAME "${name}" PARENT_SCOPE ) endmacro() # declares a package, so that any call to CPMAddPackage for the package name will use these # arguments instead. Previous declarations will not be overridden. macro(CPMDeclarePackage Name) if(NOT DEFINED "CPM_DECLARATION_${Name}") set("CPM_DECLARATION_${Name}" "${ARGN}") endif() endmacro() function(cpm_add_to_package_lock Name) if(NOT CPM_DONT_CREATE_PACKAGE_LOCK) cpm_prettify_package_arguments(PRETTY_ARGN false ${ARGN}) file(APPEND ${CPM_PACKAGE_LOCK_FILE} "# ${Name}\nCPMDeclarePackage(${Name}\n${PRETTY_ARGN})\n") endif() endfunction() function(cpm_add_comment_to_package_lock Name) if(NOT CPM_DONT_CREATE_PACKAGE_LOCK) cpm_prettify_package_arguments(PRETTY_ARGN true ${ARGN}) file(APPEND ${CPM_PACKAGE_LOCK_FILE} "# ${Name} (unversioned)\n# CPMDeclarePackage(${Name}\n${PRETTY_ARGN}#)\n" ) endif() endfunction() # includes the package lock file if it exists and creates a target `cpm-update-package-lock` to # update it macro(CPMUsePackageLock file) if(NOT CPM_DONT_CREATE_PACKAGE_LOCK) get_filename_component(CPM_ABSOLUTE_PACKAGE_LOCK_PATH ${file} ABSOLUTE) if(EXISTS ${CPM_ABSOLUTE_PACKAGE_LOCK_PATH}) include(${CPM_ABSOLUTE_PACKAGE_LOCK_PATH}) endif() if(NOT TARGET cpm-update-package-lock) add_custom_target( cpm-update-package-lock COMMAND ${CMAKE_COMMAND} -E copy ${CPM_PACKAGE_LOCK_FILE} ${CPM_ABSOLUTE_PACKAGE_LOCK_PATH} ) endif() set(CPM_PACKAGE_LOCK_ENABLED true) endif() endmacro() # registers a package that has been added to CPM function(CPMRegisterPackage PACKAGE VERSION) list(APPEND CPM_PACKAGES ${PACKAGE}) set(CPM_PACKAGES ${CPM_PACKAGES} CACHE INTERNAL "" ) set("CPM_PACKAGE_${PACKAGE}_VERSION" ${VERSION} CACHE INTERNAL "" ) endfunction() # retrieve the current version of the package to ${OUTPUT} function(CPMGetPackageVersion PACKAGE OUTPUT) set(${OUTPUT} "${CPM_PACKAGE_${PACKAGE}_VERSION}" PARENT_SCOPE ) endfunction() # declares a package in FetchContent_Declare function(cpm_declare_fetch PACKAGE) if(${CPM_DRY_RUN}) cpm_message(STATUS "${CPM_INDENT} Package not declared (dry run)") return() endif() FetchContent_Declare(${PACKAGE} ${ARGN}) endfunction() # returns properties for a package previously defined by cpm_declare_fetch function(cpm_get_fetch_properties PACKAGE) if(${CPM_DRY_RUN}) return() endif() set(${PACKAGE}_SOURCE_DIR "${CPM_PACKAGE_${PACKAGE}_SOURCE_DIR}" PARENT_SCOPE ) set(${PACKAGE}_BINARY_DIR "${CPM_PACKAGE_${PACKAGE}_BINARY_DIR}" PARENT_SCOPE ) endfunction() function(cpm_store_fetch_properties PACKAGE source_dir binary_dir) if(${CPM_DRY_RUN}) return() endif() set(CPM_PACKAGE_${PACKAGE}_SOURCE_DIR "${source_dir}" CACHE INTERNAL "" ) set(CPM_PACKAGE_${PACKAGE}_BINARY_DIR "${binary_dir}" CACHE INTERNAL "" ) endfunction() # adds a package as a subdirectory if viable, according to provided options function( cpm_add_subdirectory PACKAGE DOWNLOAD_ONLY SOURCE_DIR BINARY_DIR EXCLUDE SYSTEM OPTIONS ) if(NOT DOWNLOAD_ONLY AND EXISTS ${SOURCE_DIR}/CMakeLists.txt) set(addSubdirectoryExtraArgs "") if(EXCLUDE) list(APPEND addSubdirectoryExtraArgs EXCLUDE_FROM_ALL) endif() if("${SYSTEM}" AND "${CMAKE_VERSION}" VERSION_GREATER_EQUAL "3.25") # https://cmake.org/cmake/help/latest/prop_dir/SYSTEM.html#prop_dir:SYSTEM list(APPEND addSubdirectoryExtraArgs SYSTEM) endif() if(OPTIONS) foreach(OPTION ${OPTIONS}) cpm_parse_option("${OPTION}") set(${OPTION_KEY} "${OPTION_VALUE}") endforeach() endif() set(CPM_OLD_INDENT "${CPM_INDENT}") set(CPM_INDENT "${CPM_INDENT} ${PACKAGE}:") add_subdirectory(${SOURCE_DIR} ${BINARY_DIR} ${addSubdirectoryExtraArgs}) set(CPM_INDENT "${CPM_OLD_INDENT}") endif() endfunction() # downloads a previously declared package via FetchContent and exports the variables # `${PACKAGE}_SOURCE_DIR` and `${PACKAGE}_BINARY_DIR` to the parent scope function(cpm_fetch_package PACKAGE DOWNLOAD_ONLY populated) set(${populated} FALSE PARENT_SCOPE ) if(${CPM_DRY_RUN}) cpm_message(STATUS "${CPM_INDENT} Package ${PACKAGE} not fetched (dry run)") return() endif() FetchContent_GetProperties(${PACKAGE}) string(TOLOWER "${PACKAGE}" lower_case_name) if(NOT ${lower_case_name}_POPULATED) if(${CMAKE_VERSION} VERSION_GREATER_EQUAL "3.30.3") if(DOWNLOAD_ONLY) # MakeAvailable will call add_subdirectory internally which is not what we want when # DOWNLOAD_ONLY is set. Populate will only download the dependency without adding it to the # build FetchContent_Populate( ${PACKAGE} SOURCE_DIR "${CPM_FETCHCONTENT_BASE_DIR}/${lower_case_name}-src" BINARY_DIR "${CPM_FETCHCONTENT_BASE_DIR}/${lower_case_name}-build" SUBBUILD_DIR "${CPM_FETCHCONTENT_BASE_DIR}/${lower_case_name}-subbuild" ${ARGN} ) else() FetchContent_MakeAvailable(${PACKAGE}) endif() else() FetchContent_Populate(${PACKAGE}) endif() set(${populated} TRUE PARENT_SCOPE ) endif() cpm_store_fetch_properties( ${CPM_ARGS_NAME} ${${lower_case_name}_SOURCE_DIR} ${${lower_case_name}_BINARY_DIR} ) set(${PACKAGE}_SOURCE_DIR ${${lower_case_name}_SOURCE_DIR} PARENT_SCOPE ) set(${PACKAGE}_BINARY_DIR ${${lower_case_name}_BINARY_DIR} PARENT_SCOPE ) endfunction() # splits a package option function(cpm_parse_option OPTION) string(REGEX MATCH "^[^ ]+" OPTION_KEY "${OPTION}") string(LENGTH "${OPTION}" OPTION_LENGTH) string(LENGTH "${OPTION_KEY}" OPTION_KEY_LENGTH) if(OPTION_KEY_LENGTH STREQUAL OPTION_LENGTH) # no value for key provided, assume user wants to set option to "ON" set(OPTION_VALUE "ON") else() math(EXPR OPTION_KEY_LENGTH "${OPTION_KEY_LENGTH}+1") string(SUBSTRING "${OPTION}" "${OPTION_KEY_LENGTH}" "-1" OPTION_VALUE) endif() set(OPTION_KEY "${OPTION_KEY}" PARENT_SCOPE ) set(OPTION_VALUE "${OPTION_VALUE}" PARENT_SCOPE ) endfunction() # guesses the package version from a git tag function(cpm_get_version_from_git_tag GIT_TAG RESULT) string(LENGTH ${GIT_TAG} length) if(length EQUAL 40) # GIT_TAG is probably a git hash set(${RESULT} 0 PARENT_SCOPE ) else() string(REGEX MATCH "v?([0123456789.]*).*" _ ${GIT_TAG}) set(${RESULT} ${CMAKE_MATCH_1} PARENT_SCOPE ) endif() endfunction() # guesses if the git tag is a commit hash or an actual tag or a branch name. function(cpm_is_git_tag_commit_hash GIT_TAG RESULT) string(LENGTH "${GIT_TAG}" length) # full hash has 40 characters, and short hash has at least 7 characters. if(length LESS 7 OR length GREATER 40) set(${RESULT} 0 PARENT_SCOPE ) else() if(${GIT_TAG} MATCHES "^[a-fA-F0-9]+$") set(${RESULT} 1 PARENT_SCOPE ) else() set(${RESULT} 0 PARENT_SCOPE ) endif() endif() endfunction() function(cpm_prettify_package_arguments OUT_VAR IS_IN_COMMENT) set(oneValueArgs NAME FORCE VERSION GIT_TAG DOWNLOAD_ONLY GITHUB_REPOSITORY GITLAB_REPOSITORY BITBUCKET_REPOSITORY GIT_REPOSITORY SOURCE_DIR FIND_PACKAGE_ARGUMENTS NO_CACHE SYSTEM GIT_SHALLOW EXCLUDE_FROM_ALL SOURCE_SUBDIR ) set(multiValueArgs URL OPTIONS DOWNLOAD_COMMAND) cmake_parse_arguments(CPM_ARGS "" "${oneValueArgs}" "${multiValueArgs}" ${ARGN}) foreach(oneArgName ${oneValueArgs}) if(DEFINED CPM_ARGS_${oneArgName}) if(${IS_IN_COMMENT}) string(APPEND PRETTY_OUT_VAR "#") endif() if(${oneArgName} STREQUAL "SOURCE_DIR") string(REPLACE ${CMAKE_SOURCE_DIR} "\${CMAKE_SOURCE_DIR}" CPM_ARGS_${oneArgName} ${CPM_ARGS_${oneArgName}} ) endif() string(APPEND PRETTY_OUT_VAR " ${oneArgName} ${CPM_ARGS_${oneArgName}}\n") endif() endforeach() foreach(multiArgName ${multiValueArgs}) if(DEFINED CPM_ARGS_${multiArgName}) if(${IS_IN_COMMENT}) string(APPEND PRETTY_OUT_VAR "#") endif() string(APPEND PRETTY_OUT_VAR " ${multiArgName}\n") foreach(singleOption ${CPM_ARGS_${multiArgName}}) if(${IS_IN_COMMENT}) string(APPEND PRETTY_OUT_VAR "#") endif() string(APPEND PRETTY_OUT_VAR " \"${singleOption}\"\n") endforeach() endif() endforeach() if(NOT "${CPM_ARGS_UNPARSED_ARGUMENTS}" STREQUAL "") if(${IS_IN_COMMENT}) string(APPEND PRETTY_OUT_VAR "#") endif() string(APPEND PRETTY_OUT_VAR " ") foreach(CPM_ARGS_UNPARSED_ARGUMENT ${CPM_ARGS_UNPARSED_ARGUMENTS}) string(APPEND PRETTY_OUT_VAR " ${CPM_ARGS_UNPARSED_ARGUMENT}") endforeach() string(APPEND PRETTY_OUT_VAR "\n") endif() set(${OUT_VAR} ${PRETTY_OUT_VAR} PARENT_SCOPE ) endfunction() PDB-REDO-dssp-ca06797/cmake/VersionString.cmake000066400000000000000000000231451516741327300210730ustar00rootroot00000000000000# SPDX-License-Identifier: BSD-2-Clause # Copyright (c) 2021-2023 Maarten L. Hekkelman # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions are met: # 1. Redistributions of source code must retain the above copyright notice, this # list of conditions and the following disclaimer # 2. Redistributions in binary form must reproduce the above copyright notice, # this list of conditions and the following disclaimer in the documentation # and/or other materials provided with the distribution. # THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS "AS IS" AND # ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED # WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE # DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS BE LIABLE FOR # ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES # (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; # LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND # ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS # SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # This cmake extension writes out a revision.hpp file in a specified directory. # The file will contain a C++ inline function that can be used to write out # version information. cmake_minimum_required(VERSION 3.15) # We want the revision.hpp file to be updated whenever the status of the # git repository changes. Use the same technique as in GetGitRevisionDescription.cmake # from https://github.com/rpavlik/cmake-modules #[=======================================================================[.rst: .. command:: write_version_header Write a file named revision.hpp containing version info:: write_version_header( [FILE_NAME ] [LIB_NAME ] ) This command will generate the code to write a file name revision.hpp in the directory ````. ``FILE_NAME`` Specify the name of the file to create, default is ``revision.hpp``. ``LIB_NAME`` Specify the library name which will be used as a prefix part for the variables contained in the revision file. #]=======================================================================] # Record the location of this module now, not at the time the CMakeLists.txt # is being processed get_filename_component(_current_cmake_module_dir ${CMAKE_CURRENT_LIST_FILE} PATH) # First locate a .git file or directory. function(_get_git_dir _start_dir _variable) set(cur_dir "${_start_dir}") set(git_dir "${_start_dir}/.git") while(NOT EXISTS "${git_dir}") # .git dir not found, search parent directories set(prev_dir "${cur_dir}") get_filename_component(cur_dir "${cur_dir}" DIRECTORY) if(cur_dir STREQUAL prev_dir OR cur_dir STREQUAL ${_start_dir}) # we are not in git since we either hit root or # the ${_start_dir} which should be the top set(${_variable} "" PARENT_SCOPE) return() endif() set(git_dir "${cur_dir}/.git") endwhile() set(${_variable} "${git_dir}" PARENT_SCOPE) endfunction() # Locate the git refspec hash and load the hash # This code locates the file containing the git refspec/hash # and loads it. Doing it this way assures that each time the git # repository changes the revision.hpp file gets out of date. function(_get_git_hash _data_dir _variable) # Be pessimistic set(_variable "" PARENT_SCOPE) # Load git package if needed if(NOT GIT_FOUND) find_package(Git QUIET) endif() # And fail if not found if(NOT GIT_FOUND) return() endif() # Locate the nearest .git file or directory _get_git_dir(${CMAKE_CURRENT_SOURCE_DIR} GIT_DIR) # And fail if not found if("${GIT_DIR}" STREQUAL "") return() endif() # Check if the current source dir is a git submodule or a worktree. # In both cases .git is a file instead of a directory. # if(IS_DIRECTORY ${GIT_DIR}) set(HEAD_SOURCE_FILE "${GIT_DIR}/HEAD") else() # The following git command will return a non empty string that # points to the super project working tree if the current # source dir is inside a git submodule. # Otherwise the command will return an empty string. # execute_process( COMMAND "${GIT_EXECUTABLE}" rev-parse --show-superproject-working-tree WORKING_DIRECTORY "${CMAKE_CURRENT_SOURCE_DIR}" OUTPUT_VARIABLE out ERROR_QUIET OUTPUT_STRIP_TRAILING_WHITESPACE) if(NOT "${out}" STREQUAL "") # If out is not empty, GIT_DIR/CMAKE_CURRENT_SOURCE_DIR is in a submodule file(READ ${GIT_DIR} submodule) string(REGEX REPLACE "gitdir: (.*)$" "\\1" GIT_DIR_RELATIVE ${submodule}) string(STRIP ${GIT_DIR_RELATIVE} GIT_DIR_RELATIVE) get_filename_component(SUBMODULE_DIR ${GIT_DIR} PATH) get_filename_component(GIT_DIR ${SUBMODULE_DIR}/${GIT_DIR_RELATIVE} ABSOLUTE) set(HEAD_SOURCE_FILE "${GIT_DIR}/HEAD") else() # GIT_DIR/CMAKE_CURRENT_SOURCE_DIR is in a worktree file(READ ${GIT_DIR} worktree_ref) # The .git directory contains a path to the worktree information directory # inside the parent git repo of the worktree. # string(REGEX REPLACE "gitdir: (.*)$" "\\1" git_worktree_dir ${worktree_ref}) string(STRIP ${git_worktree_dir} git_worktree_dir) _get_git_dir("${git_worktree_dir}" GIT_DIR) set(HEAD_SOURCE_FILE "${git_worktree_dir}/HEAD") endif() endif() # Fail if the 'head' file was not found if(NOT EXISTS "${HEAD_SOURCE_FILE}") return() endif() # Make a copy of the head file set(HEAD_FILE "${_data_dir}/HEAD") configure_file("${HEAD_SOURCE_FILE}" "${HEAD_FILE}" COPYONLY) # Now we create a cmake file that will read the contents of this # head file in the appropriate way file(WRITE "${_data_dir}/grab-ref.cmake.in" [[ set(HEAD_HASH) file(READ "@HEAD_FILE@" HEAD_CONTENTS LIMIT 1024) string(STRIP "${HEAD_CONTENTS}" HEAD_CONTENTS) if(HEAD_CONTENTS MATCHES "ref") # named branch string(REPLACE "ref: " "" HEAD_REF "${HEAD_CONTENTS}") if(EXISTS "@GIT_DIR@/${HEAD_REF}") configure_file("@GIT_DIR@/${HEAD_REF}" "@VERSION_STRING_DATA@/head-ref" COPYONLY) else() configure_file("@GIT_DIR@/packed-refs" "@VERSION_STRING_DATA@/packed-refs" COPYONLY) file(READ "@VERSION_STRING_DATA@/packed-refs" PACKED_REFS) if(${PACKED_REFS} MATCHES "([0-9a-z]*) ${HEAD_REF}") set(HEAD_HASH "${CMAKE_MATCH_1}") endif() endif() else() # detached HEAD configure_file("@GIT_DIR@/HEAD" "@VERSION_STRING_DATA@/head-ref" COPYONLY) endif() if(NOT HEAD_HASH) file(READ "@VERSION_STRING_DATA@/head-ref" HEAD_HASH LIMIT 1024) string(STRIP "${HEAD_HASH}" HEAD_HASH) endif() ]]) configure_file("${VERSION_STRING_DATA}/grab-ref.cmake.in" "${VERSION_STRING_DATA}/grab-ref.cmake" @ONLY) # Include the aforementioned file, this will define # the HEAD_HASH variable we're looking for include("${VERSION_STRING_DATA}/grab-ref.cmake") set(${_variable} "${HEAD_HASH}" PARENT_SCOPE) endfunction() # Create a revision file, containing the current git version info, if any function(write_version_header dir) set(flags ) set(options LIB_NAME FILE_NAME) set(sources ) cmake_parse_arguments(VERSION_STRING_OPTION "${flags}" "${options}" "${sources}" ${ARGN}) # parameter check if(NOT IS_DIRECTORY ${dir}) message(FATAL_ERROR "First parameter to write_version_header should be a directory where the final revision.hpp file will be placed") endif() if(VERSION_STRING_OPTION_FILE_NAME) set(file_name "${VERSION_STRING_OPTION_FILE_NAME}") else() set(file_name "revision.hpp") endif() # Where to store intermediate files set(VERSION_STRING_DATA "${CMAKE_CURRENT_BINARY_DIR}/CMakeFiles/VersionString") if(NOT EXISTS "${VERSION_STRING_DATA}") file(MAKE_DIRECTORY "${VERSION_STRING_DATA}") endif() # Load the git hash using the wizzard-like code above. _get_git_hash("${VERSION_STRING_DATA}" GIT_HASH) # If git was found, fetch the git description string if(GIT_HASH) execute_process( COMMAND "${GIT_EXECUTABLE}" describe --dirty --match=build WORKING_DIRECTORY "${CMAKE_CURRENT_SOURCE_DIR}" RESULT_VARIABLE res OUTPUT_VARIABLE out ERROR_QUIET OUTPUT_STRIP_TRAILING_WHITESPACE) if(res EQUAL 0) set(REVISION_STRING "${out}") else() message(STATUS "Git hash not found, does this project has a 'build' tag?") endif() else() message(STATUS "Git hash not found") endif() # Check the revision string, if it matches we fill in the required info if(REVISION_STRING MATCHES "build-([0-9]+)-g([0-9a-f]+)(-dirty)?") set(BUILD_NUMBER ${CMAKE_MATCH_1}) if(CMAKE_MATCH_3) set(REVISION_GIT_TAGREF "${CMAKE_MATCH_2}*") else() set(REVISION_GIT_TAGREF "${CMAKE_MATCH_2}") endif() string(TIMESTAMP REVISION_DATE_TIME "%Y-%m-%dT%H:%M:%SZ" UTC) else() set(REVISION_GIT_TAGREF "") set(BUILD_NUMBER 0) set(REVISION_DATE_TIME "") endif() if(VERSION_STRING_OPTION_LIB_NAME) set(VAR_PREFIX "${VERSION_STRING_OPTION_LIB_NAME}") set(IDENT_PREFIX "${VERSION_STRING_OPTION_LIB_NAME}_") set(BOOL_IS_MAIN "false") else() set(VAR_PREFIX "") set(IDENT_PREFIX "") set(BOOL_IS_MAIN "true") endif() configure_file("${_current_cmake_module_dir}/revision.hpp.in" "${dir}/${file_name}" @ONLY) endfunction() PDB-REDO-dssp-ca06797/cmake/revision.hpp.in000066400000000000000000000056731516741327300202370ustar00rootroot00000000000000// This file was generated by VersionString.cmake #pragma once #include constexpr const char k@VAR_PREFIX@ProjectName[] = "@PROJECT_NAME@"; constexpr const char k@VAR_PREFIX@VersionNumber[] = "@PROJECT_VERSION@"; constexpr int k@VAR_PREFIX@BuildNumber = @BUILD_NUMBER@; constexpr const char k@VAR_PREFIX@RevisionGitTag[] = "@REVISION_GIT_TAGREF@"; constexpr const char k@VAR_PREFIX@RevisionDate[] = "@REVISION_DATE_TIME@"; #ifndef VERSION_INFO_DEFINED #define VERSION_INFO_DEFINED 1 namespace version_info_v1_1 { class version_info_base { public: static void write_version_string(std::ostream &os, bool verbose) { auto s_main = registered_main(); if (s_main != nullptr) s_main->write(os, verbose); if (verbose) { for (auto lib = registered_libraries(); lib != nullptr; lib = lib->m_next) { os << "-\n"; lib->write(os, verbose); } } } protected: version_info_base(const char *name, const char *version, int build_number, const char *git_tag, const char *revision_date, bool is_main) : m_name(name) , m_version(version) , m_build_number(build_number) , m_git_tag(git_tag) , m_revision_date(revision_date) { if (is_main) registered_main() = this; else { auto &s_head = registered_libraries(); m_next = s_head; s_head = this; } } void write(std::ostream &os, bool verbose) { os << m_name << " version " << m_version << '\n'; if (verbose) { if (m_build_number != 0) { os << "build: " << m_build_number << ' ' << m_revision_date << '\n'; if (m_git_tag[0] != 0) os << "git tag: " << m_git_tag << '\n'; } } } using version_info_ptr = version_info_base *; static version_info_ptr ®istered_main() { static version_info_ptr s_main = nullptr; return s_main; } static version_info_ptr ®istered_libraries() { static version_info_ptr s_head = nullptr; return s_head; } const char *m_name; const char *m_version; int m_build_number; const char *m_git_tag; const char *m_revision_date; version_info_base *m_next = nullptr; }; template class version_info : public version_info_base { public: using implementation_type = T; // NOLINTNEXTLINE version_info(const char *name, const char *version, int build_number, const char *git_tag, const char *revision_date, bool is_main) : version_info_base(name, version, build_number, git_tag, revision_date, is_main) { } }; } // namespace version_info_v1_1 inline void write_version_string(std::ostream &os, bool verbose) { version_info_v1_1::version_info_base::write_version_string(os, verbose); } #endif const class version_info_@IDENT_PREFIX@impl : public version_info_v1_1::version_info { public: version_info_@IDENT_PREFIX@impl() : version_info(k@VAR_PREFIX@ProjectName, k@VAR_PREFIX@VersionNumber, k@VAR_PREFIX@BuildNumber, k@VAR_PREFIX@RevisionGitTag, k@VAR_PREFIX@RevisionDate, @BOOL_IS_MAIN@) { } } s_version_info_@IDENT_PREFIX@instance; // NOLINT PDB-REDO-dssp-ca06797/doc/000077500000000000000000000000001516741327300147355ustar00rootroot00000000000000PDB-REDO-dssp-ca06797/doc/CMakeLists.txt000066400000000000000000000024241516741327300174770ustar00rootroot00000000000000# manual find_program(PANDOC pandoc) if(PANDOC) file(GENERATE OUTPUT ${CMAKE_CURRENT_BINARY_DIR}/pandoc-md.sh CONTENT "${PANDOC} ${CMAKE_CURRENT_SOURCE_DIR}/mkdssp.1 -t markdown | sed -e \"s/\\\\\\' \\\\\\' (space)/ ' ' (space)/\" > ${CMAKE_CURRENT_SOURCE_DIR}/mkdssp.md" FILE_PERMISSIONS OWNER_EXECUTE OWNER_WRITE OWNER_READ) add_custom_command(OUTPUT ${CMAKE_CURRENT_SOURCE_DIR}/mkdssp.md DEPENDS ${CMAKE_CURRENT_SOURCE_DIR}/mkdssp.1 COMMAND "${CMAKE_CURRENT_BINARY_DIR}/pandoc-md.sh" WORKING_DIRECTORY ${CMAKE_CURRENT_SOURCE_DIR}/ VERBATIM) add_custom_command(OUTPUT ${CMAKE_CURRENT_SOURCE_DIR}/mkdssp.html DEPENDS ${CMAKE_CURRENT_SOURCE_DIR}/mkdssp.1 COMMAND ${PANDOC} -o mkdssp.html mkdssp.1 WORKING_DIRECTORY ${CMAKE_CURRENT_SOURCE_DIR}/ VERBATIM) add_custom_command(OUTPUT ${CMAKE_CURRENT_SOURCE_DIR}/mkdssp.pdf DEPENDS ${CMAKE_CURRENT_SOURCE_DIR}/mkdssp.1 COMMAND ${PANDOC} -o mkdssp.pdf mkdssp.1 -t html WORKING_DIRECTORY ${CMAKE_CURRENT_SOURCE_DIR}/ VERBATIM) add_custom_target(doc_files DEPENDS ${CMAKE_CURRENT_SOURCE_DIR}/mkdssp.html ${CMAKE_CURRENT_SOURCE_DIR}/mkdssp.pdf ${CMAKE_CURRENT_SOURCE_DIR}/mkdssp.md) add_dependencies(mkdssp doc_files) else() message(STATUS "Could not find pandoc, cannot recreate documentation files") endif() PDB-REDO-dssp-ca06797/doc/mkdssp.1000066400000000000000000000065221516741327300163250ustar00rootroot00000000000000.TH mkdssp 1 "2023-06-13" "version 4.3.2" "User Commands" .if n .ad l .nh .SH NAME mkdssp \- Assign secondary structure to proteins .SH SYNOPSIS mkdssp [OPTION] input [output] .SH DESCRIPTION The DSSP program was designed by Wolfgang Kabsch and Chris Sander to standardize secondary structure assignment. DSSP is a database of secondary structure assignments (and much more) for all protein entries in the Protein Data Bank (PDB). mkdssp is the program that calculates DSSP entries from PDB entries. mkdssp does \fBnot\fR predict secondary structure. .sp The original DSSP program wrote output in a fixed format, this version by default writes annotated mmCIF files, storing the secondary structure information in the _struct_conf category. .sp Since version 4.0 the mkdssp program also assigns PPII helices. .SH OPTIONS The input file can be either mmCIF or PDB format and the file may be gzip compressed. Note that input files must be formatted correctly. E.g. PDB files must have a CRYST1 record. More info: https://www.wwpdb.org/documentation/file-format-content/format33/sect8.html#CRYST1 .sp The output is optional, if omitted the output is written to \fIstdout\fR. If the name of the output file ends with either \fI.gz\fR or \fI.bz2\fR the output is compressed accordingly. .TP \fB--output-format\fR=[dssp|mmcif] If an output file is specified, the extension of the filename is used to choose to output format, but if it is unclear, mmcif is the default. Use this option to force output in either the old fixed column DSSP format or the new annotated mmCIF format. .TP \fB--no-dssp-categories\fR When writing mmCIF files, suppress the output of all dssp_ categories. .TP \fB--min-pp-stretch\fR This option can be used to define the minimal number of residues with PHI/PSI angles within the range required to assing a PP helix. .TP \fB--write-other\fR By default the new format does not write the structure information for OTHER. Use this flag to change that. .TP \fB--components\fR The knowledge of compounds is loaded from the CCD file \fIcomponents.cif\fR that should have been installed by \fIlibcifpp\fR. You can override that file by using this option. .TP \fB--extra-compounds\fR As an addition to the standard \fIcomponents.cif\fR file, you can add more files using this option. Files should be either in CCD format or should be CCP4 restraints files. .TP \fB--mmcif-dictionary\fR The default mmCIF dictionary file is installed by the \fIlibcifpp\fR library but you can override it using this option. .SH DETAILS The DSSP algorithm assings secondary structure based on the energy calculated for H-bonds. .br .B Table\ \&1.\ \&Secondary\ Structures\ recognized .TS allbox; cb cb cb . DSSP Code mmCIF Code Description .T& l l l. H HELX_RH_AL_P Alphahelix B STRN Betabridge E STRN Strand G HELX_RH_3T_P Helix_3 I HELX_RH_PI_P Helix_5 P HELX_LH_PP_P Helix_PPII T TURN_TY1_P Turn S BEND Bend T{ \(aq \(aq (space) T} OTHER Loop .TE .SH BUGS The mmCIF format currently lacks a lot of information that was available in the old format like information about the bridge pairs or the span of the various helices recognized. Also the accessibility information is left out. .sp If you think this information should be part of the output, please contact the author. .SH AUTHOR Written by Maarten L. Hekkelman .SH "REPORTING BUGS" Report bugs at https://github.com/PDB-REDO/dssp/issues PDB-REDO-dssp-ca06797/doc/mkdssp.html000066400000000000000000000117111516741327300171250ustar00rootroot00000000000000

NAME

mkdssp - Assign secondary structure to proteins

SYNOPSIS

mkdssp [OPTION] input [output]

DESCRIPTION

The DSSP program was designed by Wolfgang Kabsch and Chris Sander to standardize secondary structure assignment. DSSP is a database of secondary structure assignments (and much more) for all protein entries in the Protein Data Bank (PDB). mkdssp is the program that calculates DSSP entries from PDB entries. mkdssp does not predict secondary structure.

The original DSSP program wrote output in a fixed format, this version by default writes annotated mmCIF files, storing the secondary structure information in the _struct_conf category.

Since version 4.0 the mkdssp program also assigns PPII helices.

OPTIONS

The input file can be either mmCIF or PDB format and the file may be gzip compressed. Note that input files must be formatted correctly. E.g. PDB files must have a CRYST1 record. More info: https://www.wwpdb.org/documentation/file-format-content/format33/sect8.html#CRYST1

The output is optional, if omitted the output is written to stdout. If the name of the output file ends with either .gz or .bz2 the output is compressed accordingly.

--output-format=[dssp|mmcif]

If an output file is specified, the extension of the filename is used to choose to output format, but if it is unclear, mmcif is the default. Use this option to force output in either the old fixed column DSSP format or the new annotated mmCIF format.

--no-dssp-categories

When writing mmCIF files, suppress the output of all dssp_ categories.

--min-pp-stretch

This option can be used to define the minimal number of residues with PHI/PSI angles within the range required to assing a PP helix.

--write-other

By default the new format does not write the structure information for OTHER. Use this flag to change that.

--components

The knowledge of compounds is loaded from the CCD file components.cif that should have been installed by libcifpp. You can override that file by using this option.

--extra-compounds

As an addition to the standard components.cif file, you can add more files using this option. Files should be either in CCD format or should be CCP4 restraints files.

--mmcif-dictionary

The default mmCIF dictionary file is installed by the libcifpp library but you can override it using this option.

DETAILS

The DSSP algorithm assings secondary structure based on the energy calculated for H-bonds.
Table 1. Secondary Structures recognized

DSSP Code mmCIF Code Description
H HELX_RH_AL_P Alphahelix
B STRN Betabridge
E STRN Strand
G HELX_RH_3T_P Helix_3
I HELX_RH_PI_P Helix_5
P HELX_LH_PP_P Helix_PPII
T TURN_TY1_P Turn
S BEND Bend
' ' (space) OTHER Loop

BUGS

The mmCIF format currently lacks a lot of information that was available in the old format like information about the bridge pairs or the span of the various helices recognized. Also the accessibility information is left out.

If you think this information should be part of the output, please contact the author.

AUTHOR

Written by Maarten L. Hekkelman <maarten@hekkelman.com>

REPORTING BUGS

Report bugs at https://github.com/PDB-REDO/dssp/issues

PDB-REDO-dssp-ca06797/doc/mkdssp.md000066400000000000000000000064411516741327300165650ustar00rootroot00000000000000# NAME mkdssp - Assign secondary structure to proteins # SYNOPSIS mkdssp \[OPTION\] input \[output\] # DESCRIPTION The DSSP program was designed by Wolfgang Kabsch and Chris Sander to standardize secondary structure assignment. DSSP is a database of secondary structure assignments (and much more) for all protein entries in the Protein Data Bank (PDB). mkdssp is the program that calculates DSSP entries from PDB entries. mkdssp does **not** predict secondary structure. The original DSSP program wrote output in a fixed format, this version by default writes annotated mmCIF files, storing the secondary structure information in the \_struct_conf category. Since version 4.0 the mkdssp program also assigns PPII helices. # OPTIONS The input file can be either mmCIF or PDB format and the file may be gzip compressed. Note that input files must be formatted correctly. E.g. PDB files must have a CRYST1 record. More info: https://www.wwpdb.org/documentation/file-format-content/format33/sect8.html#CRYST1 The output is optional, if omitted the output is written to *stdout*. If the name of the output file ends with either *.gz* or *.bz2* the output is compressed accordingly. **\--output-format**=\[dssp\|mmcif\] : If an output file is specified, the extension of the filename is used to choose to output format, but if it is unclear, mmcif is the default. Use this option to force output in either the old fixed column DSSP format or the new annotated mmCIF format. **\--no-dssp-categories** : When writing mmCIF files, suppress the output of all dssp\_ categories. **\--min-pp-stretch** : This option can be used to define the minimal number of residues with PHI/PSI angles within the range required to assing a PP helix. **\--write-other** : By default the new format does not write the structure information for OTHER. Use this flag to change that. **\--components** : The knowledge of compounds is loaded from the CCD file *components.cif* that should have been installed by *libcifpp*. You can override that file by using this option. **\--extra-compounds** : As an addition to the standard *components.cif* file, you can add more files using this option. Files should be either in CCD format or should be CCP4 restraints files. **\--mmcif-dictionary** : The default mmCIF dictionary file is installed by the *libcifpp* library but you can override it using this option. # DETAILS The DSSP algorithm assings secondary structure based on the energy calculated for H-bonds.\ **Table 1. Secondary Structures recognized** --------------- -------------- ------------- DSSP Code mmCIF Code Description H HELX_RH_AL_P Alphahelix B STRN Betabridge E STRN Strand G HELX_RH_3T_P Helix_3 I HELX_RH_PI_P Helix_5 P HELX_LH_PP_P Helix_PPII T TURN_TY1_P Turn S BEND Bend ' ' (space) OTHER Loop --------------- -------------- ------------- # BUGS If mkdssp does not behave as expected, please contact the author. # AUTHOR Written by Maarten L. Hekkelman \ # REPORTING BUGS Report bugs at https://github.com/PDB-REDO/dssp/issues PDB-REDO-dssp-ca06797/doc/mkdssp.pdf000066400000000000000000001030111516741327300167250ustar00rootroot00000000000000%PDF-1.4 %âã 1 0 obj << /Title () /Creator (wkhtmltopdf 0.12.6) /Producer (Qt 5.15.3) /CreationDate (D:20230613091322+02'00') >> endobj 2 0 obj << /Type /Catalog /Pages 3 0 R >> endobj 4 0 obj << /Type /ExtGState /SA true /SM 0.02 /ca 1.0 /CA 1.0 /AIS false /SMask /None>> endobj 5 0 obj [/Pattern /DeviceRGB] endobj 6 0 obj << /Type /Page /Parent 3 0 R /Contents 10 0 R /Resources 12 0 R /Annots 13 0 R /MediaBox [0 0 595.000000 842.000000] >> endobj 12 0 obj << /ColorSpace << /PCSp 5 0 R /CSp /DeviceRGB /CSpg /DeviceGray >> /ExtGState << /GSa 4 0 R >> /Pattern << >> /Font << /F7 7 0 R /F8 8 0 R /F9 9 0 R >> /XObject << >> >> endobj 13 0 obj [ ] endobj 10 0 obj << /Length 11 0 R /Filter /FlateDecode >> stream x]n7}WsyY( r\ @ 6Ї EҴn]iI]vu(]ɪ*!g8sf8^zGj~og*?6hTV9}:{gf/>ǚr#M?~]u4̺otכdo/*>7-9]k]Wyjmg}[[8=ۿKq|/>*2]s)<̮̚s^,ڼvmb']YJ[-6N-ŲE׹jGiA-nKݱ3]Q7-ݨ]^ŘAqDoڒnD&7Nm Hյymj%u'Lo&Tv6yY \0^K˖:7.F}P m@Uu,!=:wEYMkdGUKӣS ) ZLӾFhօͿf[U^z[J?CA'eXKQPF )s42pEƲi#'"b:޸bJƒl:m)&Qy7S7U[bmnG6Z{ryh){so{;=oά5!ƃz}o sABY綁E;Viv:7.6eQm)d) M~oeNYyQЂu. aĔg:=غyˁo^<@Zk{ReJ4;-@y> Hu )suU:3HU4_:$~ѰIg' ~ń^"Xe(b&)%s xK"2:ks%dʐ:1N &rK 14|iWz$^ RކA!$2;$2XP5h#JY?Xl9]10xIlFɩf!4/*8F}ASƔEEڤI\+T$g#{8.F\*ď73*ӤQ#30TMHP&=."XM%J>BGX/Lbƀ %;-80 19xa(oI 愋m%\|;SRg2y"íTt7Ii?7RG%1\%ru8ATx Чٕ+78Y^ۙ,24DI_35(-l:pCjCYI|Rŗg\reѥ٦\D, 3T39Is~aʑ'5&_Qc$b')W*Tc+56YsbGA7/sCLVJMxKmSi -#/j$-i]*GgwD` D'BϖEj*IZ#MSY/߯W=HF]Do$Rmނ(oLo!Zs⹦Nmjیk)o2Wr'eƈ,-ŕ6 -bX\x;fϹV>5<<^Ee>2 f\,xl$E&\Ϝ/ IUFII!5qY2STooW.h 8JgȘ\g-Ϻn JJ0Tq剟jf 6Y՞p\ZZ*U9SZfWM#gv[|XJ{?;_n|y|r%K&5"^u5\Ћʁ%`*E6[ڷto9l< T> ruͺfע\-f=+u І7VL0kb]hzZR.mw򓉈M.*E'LA+́ ^5<<~c"T&Dx|mTסQʧTݝqMt0VOl3SZi? #3'a;ɍHmE/lDsv%靝RqL3~_8Y&itRN22/S^M"6fUom㐾o9co> endobj 17 0 obj << /ColorSpace << /PCSp 5 0 R /CSp /DeviceRGB /CSpg /DeviceGray >> /ExtGState << /GSa 4 0 R >> /Pattern << >> /Font << /F8 8 0 R /F7 7 0 R /F9 9 0 R >> /XObject << >> >> endobj 18 0 obj [ ] endobj 15 0 obj << /Length 16 0 R /Filter /FlateDecode >> stream x]M6y%x `99,.u9/["խ~áF@f9bUU(Gv܉D_qVuv{L??oﻷw7vCϯ/roR}ߍӏMSh{1x~K{76I{ɣ/>~8D!eeZ~Q?w7%ۏM!m[mgAֲxRUN3ZZRhZRMtliDѮcoflSzSUk:>c3tv{7)Z=-=x>%L#!zSF'BkcՔ.v}oQ#V!Uxxu-M/I]iUvF9 BFD؁2W}6cަvK|@fItndy(ZWcֽ`P!([s]x%&[gf*ZFY jOHOa͒v%`H RM{r!a'wqF׉PޡR]khߨgvg'2W˯b>Rv# ֖>A0<6 ޘS BWu\IHl=t. ZG4?q:)L8rjZ<`AP=V4vJKẖEXC߻}(=a6gIe\Q g}oxZ!/xEU=+M]BNUe3Uuxf_){PRe?ZgTGmn"}3=Ύ[0C#<>@Iԁ1 bK& CEvLfTҽḬ%8> +.q!)q e0-f;|n7lX%\'UgAR ͘s,gTfTs.o8>A5!| >{kB$3/ _HNg"q7<r!0S.?($׈g*uM* Ep9ue%h au+#KOxJ$ErFfyn1pdu)YU%͠ u}Ksm i >8DfLUtq-l"87iS9ъy#k@ˡiJo3cc٧>wv:T|"6 Va&q1KytZIS6y;f?~bd mhcAـS9ek*6D[:"pքtiҸ3|A@n[`0A&0jcΘ}H"Ix5<j$#dcsZ&0 ʿM8_Ȋ7ޫYȒ!/8K8 _$' vdɶŽTK~|Uz׳c\;nCjNJ1'7s0eӡ fwde3ȦVÎKYMgޫ|5 Frqlc8:w!P5a12U#Hz}ċDegIo˧jt!kJ עd1a-oD Ȝ9Iq+βd19n¥F_ sʨY ! DFj>M5ŹbSym%Đ eݒz8\7rCL ^:$24;:̔`.͔i `.J캥=ѕDm  YG2?37|w|󒐨v@¿[L|4S2mg"s=fdbrKZ)p"5ս:}a;u'U zcJ#v5zX'S֘)Ƽ>E{*# q-賋47g :tK'rS%&iiaJb&G=buqX E@$vcǿl7U2@!plb]OzLie򉏲PQ㮮eZ޶H}^Xן> endobj 20 0 obj << /Length1 11328 /Length 24 0 R /Filter /FlateDecode >> stream xZ p[ՙ>G B^~ɱ@˱'(l%#vBbµte][Uc%@w;](P$4S貔vYn)ӝ0S,2Yv+&0mw֊s?uFB'H7rNeR0-,-KI .a};0x|1`>QRp3sygV:GMO䤬)0Sۮ:uP?L?_eBZgb{ٗ6D@H#lo(6ӎ,~UdAI[IҁPm-[R6nœ5f˿fB;@ko{{};:;_>_?;`jw؛_ScjnZk뮾}iۼ oR[;ھx9| /l [ڷnn-G1|qtefjv[p_dAq(VkmqX&om O4>q÷o75޳02zmg[}5֗'/,\FֵcG7G)so^7:@wVrEHZŋd~4w}ϙ? hlmX'}`u {o==g Mϙ{z(_3G$^m S:je x$6E ay$!mWxQ)y]5}w.7v3Oާ>\(v.z U"{ Sg OZ8 Ol@ilQ̄oUhoY4uO^~˯:|;igr`nm𽟽'rsf{[ szDԜ NkC]', W gfb5pb;s }+'B33 zO."n\I}=2㆔/d=Oݿxӻe|4ɉC{8.X~!ۗE-S}?wa`I?G'}CKۮ->t͚0`n:=öعkf׾ϚW?b,O~ɩI<<Y7 |ġ:Ņnm} y7Y=}%-رx}AVP˧øicO+X}^xS3 ~׃9V}/L*aL묾dJ)YL j&?r3n۶N=P|εZsE.ŻZU>~\No>tP}dzpd z;ۂ33]8g9pkww^l`=f`f&&ZC)Ƶfjl~2QFgYdhUjㅅ)tg85$J=ȝ=|(MdC+'&\:YO{8d~.8::sX@alm9lf*]d= ޲Pl>GWQ yw_Bgfva?~ud0׺| %!3;k(4uսoyRU]ݞM:<ݛqVkh---Wy<wwq=V׻ZiP5rdNzj,[sokٝ?d-.s^}%Il7؆6v$B1㫞m<*~zWY{{X0a#[5菡qb*mmjPn Mu,`>j- ꚗ߷݆'уlށ-忖O59&ފcՖi#_Z;5AI3"+P^sSZ?'blAv<)VT?%6u KB-rt_qÍoԷb&x=8XĶ`]f1ڈ[[Q;>,6?.u K1B.K_,b|E}buh#"0 ҐH#;Qug/ꁗF A>1 {`Gx-LO$H:A*Dd%2$ ~ZrYЫ*ؕ5'B5)sit&HoO.},e$Kx?!Q*19qT$RnN։Dɑ|a6$HRJJ T#1? |{LYID!CTWj"SLZ 1 {7)Y5Gz=^_m+`-ŬX"/L\)5 hnx%c{Ui,܂[R"ˁ4 `&*=2kUYqӌu~u?%?Y_"L3[VG^qRF5YWhXjHpO.S%%$C:bU1Ee.97D5UfY-m38K "beqbayvI#OSK9Y*ϲSX-b7D+)4Yʬ3/jU-gzdHirĺ&-ִ*kڨGH*{\*$\IZ^Vqϰ}%&:e+z)3ͺ=Ed,2lksUv7O]WE9gfYݫX H 89'*:/~Iʥ/]1i Feԇ nNT5+J*Z:]:Dt,}ND9mEpfE\LEAf'0v"0ik!X#p?+S0!?BX5NØjI;}Vntà FŘd1 9#+0DF0슳ڡ(4eըB̢lfQ?*Aw݌):p ~LuI|ḣa} 2<Q>'6\qZ I73S*GQO,ǘc"8Ylk0^ʣI柟akEXI2Zƍ"b؊ڪRvFAAVx>-X#`5(rϸW_G/ baYv1+ӬLb+0w\ 03"?#%dud}u#8iL hw\K;FoWܕwOwE]xfkʫ?3nwQoݧ{AtWtgȮtm0$*. v!Noyvs+ll;_A[kk5ߪ>*/ſߩ029 _ٚj@ Iq$t"4Yi)euC>SQY<%kKb.tOmIe CrVtNZVsON˚ 4)gI7Iin@)f325IKIK:hsռr'I!]}=Tdu5C+J"A^LX1ŜZ?LAr&EAp$'p| PLD#Sqc0wt(>$2Ld(<&`,F"Q a-M#d Gd,4xmBU6Fa p(:ALP`r%щH,:@m8xEhhd4MqXtx?G)%L(A NͱQѠRvF‘qdxEd_\ rlJ`w!$+b2tH0$6 x E817 ǂ7Nș& AfÿCTO<LbA7GC1 a848 |^#vqv- @a¸H+x> /FontDescriptor 19 0 R /CIDToGIDMap /Identity /W [0 [600 513 402 640 602 644 318 640 527 640 636 560 948 640 644 592 320 370 320 ] ] >> endobj 22 0 obj << /Length 490 >> stream /CIDInit /ProcSet findresource begin 12 dict begin begincmap /CIDSystemInfo << /Registry (Adobe) /Ordering (UCS) /Supplement 0 >> def /CMapName /Adobe-Identity-UCS def /CMapType 2 def 1 begincodespacerange <0000> endcodespacerange 2 beginbfrange <0000> <0000> <0000> <0001> <0012> [<0073> <0074> <0064> <006F> <0075> <002E> <0067> <007A> <0062> <0032> <0063> <006D> <0070> <006E> <0065> <0069> <0066> <006C> ] endbfrange endcmap CMapName currentdict /CMap defineresource pop end end endstream endobj 9 0 obj << /Type /Font /Subtype /Type0 /BaseFont /DejaVuSerif-Italic /Encoding /Identity-H /DescendantFonts [21 0 R] /ToUnicode 22 0 R>> endobj 23 0 obj << /Length 3 >> stream endstream endobj 25 0 obj << /Type /FontDescriptor /FontName /QZAAAA+DejaVuSerif-Bold /Flags 4 /FontBBox [-835.937500 -389.160156 1854.00390 1145.01953 ] /ItalicAngle 0 /Ascent 938.964843 /Descent -235.839843 /CapHeight 938.964843 /StemV 43.9453125 /FontFile2 26 0 R /CIDSet 29 0 R >> endobj 26 0 obj << /Length1 13608 /Length 30 0 R /Filter /FlateDecode >> stream xZ tTչ#1T $! ID($$#df̜ 3ɑE@aY,k^kjr-UZj9gϓ.{ﺉg#]HQ[9a> HޝOw* .Oo܊u\l\y\wT_068ku nW"zU5Fuh\|.;!TaVyAH<:uq|F8EO/P?:$O k:x,8#`eH+,-(-,HTuEyO~NG;% ť9Ueyڒ/K^_W2Y}μ X|_bƯz1qhs޽6qsgJ8#I_iGkUgnlI$tx-DxSMp^{)ۈ/$G6o4#7MI~&1zAD׃mU`[Ɇ:\ aӖUUq0HVfřպ,ܳWΫ/ܵ-w][K9/YΟ,wiݽ Oa# -#d(O.T~^\WM.JA5ZoJCGͷ\^շvSASƀ|N7Eq >`aEe7UL.r9?4N'U[=aQܭi '0 IJU)Ϫ Vxfuf|k_ݛ7vvݑD>S/[w-v1i}4k|YgiM#5gPBzbu=C\|i$8$/HϫKGԆF~<,c*JUbx'WWN̈́SVS4+.̖OI\97 9\MD!·Ǹg'd=UkQ5$]EU^A|xxҿ$amH܇n&Km|\:J9+"}[c|Y4-MDPU< B<``x?~2{'.|}1d̯pjGO?m;vyuuonX?dVΪꃡ.0G{O H,15'ܯlݍm{NHCCeVlL#QE] h B`kDŰ"!'VZr^1,oY| Ç/~~G_=|U->*$: _nIūN`y)h">iRQS?ݹsaxՂź9Ln waICtw)HPR)t89EC,_?PXO^cbrwh@ Ü:sY9,AIjŦ=0 ?.w9&(}^- HJ%,YI4h>ÉϽ֬'ǧ_E?]a:xV44D\`߫L)9sq{ !C8d,.&%!O_p~EcTl\4BȼMsѤXSWJCU_UjEt̝KTܶ`{n㦋{;wco/-=턡_c{ٍz'HB $6^+I=8է "[Mmjʝ+r^zrdKe^;_r̭?k)AT(, E oA)t>` ЀKZidcnn0\SX|e^ pQ2&TPTxy?^Hq7}uUb>g;?Z$%^hd'cdžAX0N=!#b+'o߇oO p6qGq$-0 ^/7|yuܠ> #? 2eцi`"89Z7AK?W7/^5}<; MgqxjB]l lvB6sb`# e25T'oS=tǐV.9~W_ʞi˙J؛5?^Ix ]2IaE.A^ItBM=y-&v|I쳻߾!}BD:`1T Y@QHjQ?҉ڸ~@V[Iu3xFbOWȪ<2WDcL!utDž۾W~#c-\rgm=~Wy.ؼy<,$`t9xF I(&*+bȀŒC*47'v!.xn|dn D؏E< \"BEg Z=D$$G ,M'FͦjڡwBmsxסGP_.[䧾uO*/**O>O:5*Ӄ7e!>5+Ӊ-53sv:9@xR %ΓxT"+X'|%QXM8E_OXiH8R[2~j'7h>ToBK6-֏~uko@k4/gFhj~(hNnT=fHZU?Z6Z}95%rT@{-^}_`E!=y]M"ȺZgPwǨ :x;~ e[}{<1TV=zO]v]?Wfk ZA MȳywC#ykЭdcW?7Rq+x[sH;Z lZgk-ȍc|T-bql}5;ќ)WR.Dj$b5/4D5Fc9[Zp7[a}[klE<~Qw3[C8;[_[TI'f|S|l=]u!kPQI(P z4䆚ϣ:4 ~ 5M E/w VF_SJoάOPfX(nu^JÚK>@|@y=MbX{}1~{:_7kF,751*ۅY'xj 8BBwE{Ġٚ:~qU#P|)>MyWNuS(P_ua=yS-D~1 ӬsYScXx6G41!;aAJC-Qt,ܠYrQ|2@15!<{%GPh>eD4X7 ua.eg-K<ϼ[m8X Pd6xiM 1 Id7ZpS~ M&J&#䦲=Tc?tN';" d֢!lf&s%y6XzRu;5J%w]%"A<}~E ,ӾbdyjgOA}~ɊFt(z2bd"RŁKZ䡚x2 tۋdPEݤ\D?צBh, I\=@R# T`N4dv;!+*=_6F_,Kٝ{'nYڔܱbqH1<&A0*]E+:EgVz~GEgEnN)U*~ٜ1g$.Qdf;1L,bJ_ Q볭a9c}ћT2Q96d+"WNI;g=9;醫fmq1;~%&mRx^;7Ob/rքR&栔vʻv-mbtDt5Y"2*pIs#(:a?-5[+3Ԭ5o3GQO5g H}D8M^.:ڬhk6}@Q|wlB z9DQꨅĞfzH]Lwl,dR|Aߝ[;aIccIIR)uQ6*#^$(Qi"q#7SIFǘ$eGg,t$%RLSJ?ޜQh61*<+dxH" RM SFl+ !P"`dM>KGʢ۔J,hTFkG -4ۙ]KƱӖ,ۿڭ<eN:+`45(CLM&n+OAJrD./etiHͫu'0ɄgdΜHS i?BfT~a2O0|>Kx@ỷz}<;fhaWޤЗq}&y'zO #ā5xYSP>-D\9ε?_,#*#]>^r)("Aj@Vo p :>&ćH=10)nPP|{r` AIB( ..)<+~A!sň>^|g;s~;#bz$AH[3qg3\ g>y3syо},1eݒϿ8|kOz +S\FC5#4i 0q# 2#tXxf`{< d ҉A$CH+ wdfnD%2a#k0NX**Za8~q1oee B if)Jns{Nw(ʟ;>i|8,yyffcX9,_mjwq'V,Ttlh8nέb'|}mk*\T n7ȟ?I)cAIșee;1./aSGǦ~شh~\ٿ{؉]{`hv E;&3v12 4Jggsgz TL[[G&;~Wdw-v%%%ԋs˶~xvo5<rqCҚ%;]̌KK~uoj d\0/dBrb2[m[m.*(Vntc>Ӵ잝=esv;H0 ]vNvd1⹂%ɒD(It_[`s[/3yspMfx\^@:Jvb.PPNMΙ_~eSSSRR$gp Tg'(gKσ3l/^KFșyW lG`*OvWUW=Vh 0+Cw}%b6m[okbK/C8=*ɣmgwtϴi x/QU;ħ# ctdE- ]WV(xv~.A &_4|iЗn֔۲V7е{ /)m__Rzb8XВwv;{=K+UGnf; \pCP$zϗNpkgE%>LײEW݌<0~7MT,?ZGp 4W.I"*YEʷ>\J˭u_z֭>{1Hz{|NS'pْ`L `|Ƥ Z-.:.43 ˗U Bh>shv/TW!ez.KFYL.QS -!+_DHNd:dUW=u4i&OmFg YL,[Sp#XJ  T{>|;}Oq|g+ncV*s4>o1cUr+fo% Y#rTdLB/ ?=xodsTQC{ $q)=bSZ:κWJ\#̇1C|JC3<0҃|ObNNnY,+*b53a()+ 3:#(DC"ϑ밍`3|^>+V]#*~Pۑ/ Mͅ@j1JJ.mŸu[Zܱn1o6Ƴ vbo]ukjp~\K__g1εt5r>?q]ug P2#dxnj4me9/_~¿%syBdND'o|XifaOʙ|`ՓLt*{ɐǞ]>Lu n͍Kk߭;/ wn/[_oq%..jϛ3{ºU}V-T?/=*3q,a !%`<|jn~Vd >${: T|ZOA&8 >LBS#'p$Qf%~sE?u#~g4@l.x4JkUUz>o$?9 sҗHie@QQ{IqYaHaKvR6J)i40SnZ2oÙo:#لE8CƌI.)\٤FnH(6e{?y2pG? Lȵ1'Ox)D0G^.9TSdž] qnOc߶}iH-w9''/l)~i(}D#XuD#LW"똞69`f QZ=}?Mf>EI R[g'nZ%JFƔsidcq |W$ŭ?Ckb􇝰aeNo_c6^Yg?vVB!&PJ 9D/<ԣ,,T@x /O9?o6A&ƣ.6ӵ!/:yp ~Ru &O?yF&M{JSm wlZx'\zfVݨ`|V j R ;k-?:/ois &>$ H)DI&581+n'cKJzKY|cځeTF H.U5C!)|mbxIkN.BHl |K |K 2?Zш$E`^੢2D CgUB5˼3K ēġ/x 9$9QJ.%9tșDKɉl$$T"rB$rg}e']W- ܍3)#YqY9y ?sJ- p璚GC >-/v)G;nfn?ؿ1/} d@VfbގuA*亷1c1x[Gy#J3f;4~p-]OCD,e#-$sQ錴9S0NK Os24d00NS.R]FeBx?3 I,KZJNzRxAmE+*UkCUҪR5|'_E(sD2>~qF(L!_~|foaf]ke2t#nYbnxBͦ$ F2IXNtG$~tš'ΆC+Jv=U2%Gz/[ZSϘʱ}UyMOf{hV~3Ngהed< NE%޻ OqʌL;oN\PZ[.lqQ¸/ή5w.HO+/Z5_˺'^M* 1W꼾]ڪ-KjC*4ѶMȣHzdfZIkqz{ wDOͅ -sb2˒P'\pbepk f;?&#f<BR%f *%  oN"m /ɷ:(F$ wr(E裼d] dg`h _at.C~,s*9ЧzT0#7I &m@ggxVn|a0;|%Y i<#Bz".}_: ˔!(;*;% O/+?-c;@ie[c?5fT(((m^K+[@^8Z3zF_#?y1o:uΑ#+>LC5 y b[n-#b[~-Ggh41FmMؾ͜L$㑔 ƨr'mn¬fP,.Rhm{ŶЎE)[=eu :}=L'Ǣ&$Q,Q!r!qzdA> #ʄ 4 Ъ,*1>0 ʂ^5rlh)P|Yرiyw欆_CJhـB5#5z:6'aLе8滀=R[|c&;cڴ\->gpdj1U44:28/Y͙㔜PgZ_`5&`uhI+VRy+9 @,\eٳ~j \"3՜ku9ٹԮuUfJPpOtisrki0w8<ԍ@9䘀j9Se;9x]!AA] 7@.c @3')/EH^aY@1VC fh581́d"bA9 qï aiLTZѷACKFO6iМ-}{P)H6̊i;?ǯfg=BzмRB<UmuFM! fS\G%1QcXdR By;5B&7\ß.?>M5Qv5ؤ9$Fr0}bzIMM>D]p"\{ jd9#Q6C =vJ:p]D{ɴI;L%[ us%տ ,_=z bR(ᨊꧠvR"gYh.+^oDr%夠&Aj޹:~*j2:쨂PG5յP@SRgW)]BZP6 {_#z0k-EٕVYBcQEG)+CV([.J^D|jCE7Gq?'w=x*% Y K뚑w|rGV4̊ȵXLjq^!? kVxY]m >\!w {Dtap*&6 ARf~qHZB}i潊5B!z/pimXX]gĮ|v{*+0'EܟmB, ~9Fx=>Bm.YGHn=.q8rDI9CǛ/DZu\)3qq՜ CǨqS\ "L౳.H*qqa#Nm<>ΔŚ="}WF٢J V1 R1rnBzTȟYB;!p>on0zJPsvklŝ#/: endstream endobj 36 0 obj 8848 endobj 33 0 obj << /Type /Font /Subtype /CIDFontType2 /BaseFont /DejaVuSerif /CIDSystemInfo << /Registry (Adobe) /Ordering (Identity) /Supplement 0 >> /FontDescriptor 31 0 R /CIDToGIDMap /Identity /W [0 [600 636 636 636 338 636 636 948 606 640 513 640 318 722 320 640 644 592 560 602 596 478 565 402 644 390 820 673 667 395 875 390 644 802 685 856 640 1028 320 370 747 765 527 318 390 390 735 564 318 565 694 500 636 730 753 660 1024 337 337 636 838 838 337 843 872 640 664 712 799 636 275 838 1000 838 ] ] >> endobj 34 0 obj << /Length 875 >> stream /CIDInit /ProcSet findresource begin 12 dict begin begincmap /CIDSystemInfo << /Registry (Adobe) /Ordering (UCS) /Supplement 0 >> def /CMapName /Adobe-Identity-UCS def /CMapType 2 def 1 begincodespacerange <0000> endcodespacerange 2 beginbfrange <0000> <0000> <0000> <0001> <0049> [<0032> <0030> <0033> <002D> <0036> <0031> <006D> <006B> <0064> <0073> <0070> <0009> <0041> <0069> <0067> <006E> <0065> <0063> <006F> <0061> <0072> <0079> <0074> <0075> <005B> <004F> <0050> <0054> <0049> <004E> <005D> <0068> <0044> <0053> <0077> <0062> <0057> <006C> <0066> <004B> <0043> <007A> <002E> <0028> <0029> <0042> <0078> <002C> <0076> <0046> <005F> <0034> <0045> <0052> <0059> <004D> <003A> <002F> <0038> <0023> <003D> <007C> <0055> <0048> <0071> <004C> <0058> <0047> <0035> <0027> <003C> <0040> <003E> ] endbfrange endcmap CMapName currentdict /CMap defineresource pop end end endstream endobj 8 0 obj << /Type /Font /Subtype /Type0 /BaseFont /DejaVuSerif /Encoding /Identity-H /DescendantFonts [33 0 R] /ToUnicode 34 0 R>> endobj 35 0 obj << /Length 10 >> stream endstream endobj 3 0 obj << /Type /Pages /Kids [ 6 0 R 14 0 R ] /Count 2 /ProcSet [/PDF /Text /ImageB /ImageC] >> endobj xref 0 37 0000000000 65535 f 0000000015 00000 n 0000000169 00000 n 0000033387 00000 n 0000000218 00000 n 0000000313 00000 n 0000000350 00000 n 0000022317 00000 n 0000033189 00000 n 0000013653 00000 n 0000000691 00000 n 0000003630 00000 n 0000000485 00000 n 0000000671 00000 n 0000003651 00000 n 0000003993 00000 n 0000006992 00000 n 0000003787 00000 n 0000003973 00000 n 0000007013 00000 n 0000007296 00000 n 0000012817 00000 n 0000013111 00000 n 0000013797 00000 n 0000012796 00000 n 0000013850 00000 n 0000014131 00000 n 0000021184 00000 n 0000021586 00000 n 0000022459 00000 n 0000021163 00000 n 0000022515 00000 n 0000022791 00000 n 0000031752 00000 n 0000032262 00000 n 0000033326 00000 n 0000031731 00000 n trailer << /Size 37 /Info 1 0 R /Root 2 0 R >> startxref 33492 %%EOF PDB-REDO-dssp-ca06797/libdssp/000077500000000000000000000000001516741327300156305ustar00rootroot00000000000000PDB-REDO-dssp-ca06797/libdssp/CMakeLists.txt000066400000000000000000000075411516741327300203770ustar00rootroot00000000000000# SPDX-License-Identifier: BSD-2-Clause # # Copyright (c) 2025 NKI/AVL, Netherlands Cancer Institute # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions are met: # # 1. Redistributions of source code must retain the above copyright notice, this # list of conditions and the following disclaimer # 2. Redistributions in binary form must reproduce the above copyright notice, # this list of conditions and the following disclaimer in the documentation # and/or other materials provided with the distribution. # # THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS "AS IS" AND # ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED # WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE # DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS BE LIABLE FOR # ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES # (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; # LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND # ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS # SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. cmake_minimum_required(VERSION 3.23) file(READ VERSION VER_FILE_CONTENT) string(STRIP ${VER_FILE_CONTENT} VER_FILE_CONTENT) project(libdssp VERSION ${VER_FILE_CONTENT} LANGUAGES CXX) include(CMakePackageConfigHelpers) # We do not want to write an export file for all our symbols... set(CMAKE_WINDOWS_EXPORT_ALL_SYMBOLS ON) # Create a revision file, containing the current git version info write_version_header("${CMAKE_CURRENT_SOURCE_DIR}/src" LIB_NAME libdssp) # The DSSP code is in a separate library, optionally to be used by others add_library(dssp) add_library(dssp::dssp ALIAS dssp) target_sources(dssp PRIVATE ${CMAKE_CURRENT_SOURCE_DIR}/src/dssp.cpp ${CMAKE_CURRENT_SOURCE_DIR}/src/dssp-io.cpp ${CMAKE_CURRENT_SOURCE_DIR}/src/dssp-io.hpp PUBLIC FILE_SET dssp_header TYPE HEADERS BASE_DIRS ${CMAKE_CURRENT_SOURCE_DIR}/include FILES include/dssp.hpp ) target_link_libraries(dssp PUBLIC cifpp::cifpp) set_target_properties(dssp PROPERTIES POSITION_INDEPENDENT_CODE ON) target_compile_features(dssp PUBLIC cxx_std_17) target_include_directories(dssp PUBLIC "$" "$" ) # Install rules install(TARGETS dssp EXPORT dssp FILE_SET dssp_header DESTINATION include) if(MSVC AND BUILD_SHARED_LIBS) install( FILES $ DESTINATION "lib" OPTIONAL) endif() install(EXPORT dssp FILE "dssp-targets.cmake" NAMESPACE dssp:: DESTINATION lib/cmake/dssp ) set(CONFIG_TEMPLATE_FILE ${CMAKE_CURRENT_SOURCE_DIR}/cmake/dssp-config.cmake.in) configure_package_config_file( ${CONFIG_TEMPLATE_FILE} ${CMAKE_CURRENT_BINARY_DIR}/dssp/dssp-config.cmake INSTALL_DESTINATION lib/cmake/dssp ) set(dssp_MAJOR_VERSION ${CMAKE_PROJECT_VERSION_MAJOR}) set_target_properties(dssp PROPERTIES VERSION ${PROJECT_VERSION} SOVERSION ${dssp_MAJOR_VERSION} INTERFACE_dssp_MAJOR_VERSION ${dssp_MAJOR_VERSION}) set_property(TARGET dssp APPEND PROPERTY COMPATIBLE_INTERFACE_STRING dssp_MAJOR_VERSION ) write_basic_package_version_file( "${CMAKE_CURRENT_BINARY_DIR}/dssp/dssp-config-version.cmake" VERSION ${PROJECT_VERSION} COMPATIBILITY AnyNewerVersion ) install(FILES "${CMAKE_CURRENT_BINARY_DIR}/dssp/dssp-config.cmake" "${CMAKE_CURRENT_BINARY_DIR}/dssp/dssp-config-version.cmake" DESTINATION lib/cmake/dssp COMPONENT Devel ) # set(CIFPP_DATA_DIR "${CMAKE_INSTALL_FULL_DATADIR}/libcifpp") install(FILES "${CMAKE_CURRENT_SOURCE_DIR}/mmcif_pdbx/dssp-extension.dic" DESTINATION share/libcifpp) PDB-REDO-dssp-ca06797/libdssp/VERSION000066400000000000000000000000051516741327300166730ustar00rootroot000000000000004.6.1PDB-REDO-dssp-ca06797/libdssp/cmake/000077500000000000000000000000001516741327300167105ustar00rootroot00000000000000PDB-REDO-dssp-ca06797/libdssp/cmake/dssp-config.cmake.in000066400000000000000000000002541516741327300225340ustar00rootroot00000000000000@PACKAGE_INIT@ include(CMakeFindDependencyMacro) find_dependency(cifpp REQUIRED) INCLUDE("${CMAKE_CURRENT_LIST_DIR}/dssp-targets.cmake") check_required_components(dssp) PDB-REDO-dssp-ca06797/libdssp/cmake/libdssp.pc.in000066400000000000000000000005021516741327300212760ustar00rootroot00000000000000prefix=@prefix@ exec_prefix=@exec_prefix@ libdir=@libdir@ includedir=@includedir@ datalibdir=@datarootdir@/libdssp Name: libdssp Description: C++ library for the assignment of secondary structure in proteins Version: @PACKAGE_VERSION@ Requires.private: libcifpp Libs: -L${libdir} -ldssp Cflags: -I${includedir} -pthread PDB-REDO-dssp-ca06797/libdssp/include/000077500000000000000000000000001516741327300172535ustar00rootroot00000000000000PDB-REDO-dssp-ca06797/libdssp/include/dssp.hpp000066400000000000000000000175601516741327300207460ustar00rootroot00000000000000/*- * SPDX-License-Identifier: BSD-2-Clause * * Copyright (c) 2020 NKI/AVL, Netherlands Cancer Institute * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions are met: * * 1. Redistributions of source code must retain the above copyright notice, this * list of conditions and the following disclaimer * 2. Redistributions in binary form must reproduce the above copyright notice, * this list of conditions and the following disclaimer in the documentation * and/or other materials provided with the distribution. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS "AS IS" AND * ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED * WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE * DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS BE LIABLE FOR * ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES * (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; * LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND * ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT * (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS * SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. */ #pragma once /// \file DSSP.hpp /// Calculate DSSP-like secondary structure information. #include #include #include #include class dssp { public: struct residue; enum class structure_type : char { Loop = ' ', Alphahelix = 'H', Betabridge = 'B', Strand = 'E', Helix_3 = 'G', Helix_5 = 'I', Helix_PPII = 'P', Turn = 'T', Bend = 'S' }; enum class helix_type { _3_10, alpha, pi, pp }; enum class helix_position_type { None, Start, End, StartAndEnd, Middle }; static constexpr size_t kHistogramSize = 30; struct statistics { struct { uint32_t residues, chains, SS_bridges, intra_chain_SS_bridges, H_bonds; uint32_t H_bonds_in_antiparallel_bridges, H_bonds_in_parallel_bridges; uint32_t H_Bonds_per_distance[11]; } count; double accessible_surface; struct { uint32_t residues_per_alpha_helix[kHistogramSize]; uint32_t parallel_bridges_per_ladder[kHistogramSize]; uint32_t antiparallel_bridges_per_ladder[kHistogramSize]; uint32_t ladders_per_sheet[kHistogramSize]; } histogram; }; enum class chain_break_type { None, NewChain, Gap }; dssp(const cif::datablock &db, int model_nr, int min_poly_proline_stretch_length, bool calculateSurfaceAccessibility); dssp(const cif::mm::structure &s, int min_poly_proline_stretch_length, bool calculateSurfaceAccessibility); ~dssp(); dssp(const dssp &) = delete; dssp &operator=(const dssp &) = delete; [[nodiscard]] statistics get_statistics() const; class iterator; using res_iterator = typename std::vector::iterator; class residue_info { public: friend class iterator; residue_info() = default; residue_info(const residue_info &rhs) = default; residue_info &operator=(const residue_info &rhs) = default; explicit operator bool() const { return not empty(); } [[nodiscard]] bool empty() const { return m_impl == nullptr; } [[nodiscard]] std::string asym_id() const; [[nodiscard]] int seq_id() const; [[nodiscard]] std::string alt_id() const; [[nodiscard]] std::string compound_id() const; [[nodiscard]] char compound_letter() const; // Single letter for residue compound type, or 'X' in case it is not known [[nodiscard]] std::string auth_asym_id() const; [[nodiscard]] int auth_seq_id() const; [[nodiscard]] std::string pdb_strand_id() const; [[nodiscard]] int pdb_seq_num() const; [[nodiscard]] std::string pdb_ins_code() const; [[nodiscard]] std::optional alpha() const; [[nodiscard]] std::optional kappa() const; [[nodiscard]] std::optional phi() const; [[nodiscard]] std::optional psi() const; [[nodiscard]] std::optional tco() const; [[nodiscard]] std::optional omega() const; [[nodiscard]] bool is_pre_pro() const; [[nodiscard]] bool is_cis() const { return std::abs(omega().value_or(360)) < 30.0f; } [[nodiscard]] float chiral_volume() const; [[nodiscard]] std::size_t nr_of_chis() const; [[nodiscard]] float chi(std::size_t index) const; [[nodiscard]] std::vector chis() const { std::vector result; for (size_t i = 0; i < nr_of_chis(); ++i) result.push_back(chi(i)); return result; } [[nodiscard]] std::tuple ca_location() const; [[nodiscard]] chain_break_type chain_break() const; /// \brief the internal number in DSSP [[nodiscard]] int nr() const; [[nodiscard]] structure_type type() const; [[nodiscard]] int ssBridgeNr() const; [[nodiscard]] helix_position_type helix(helix_type helixType) const; [[nodiscard]] bool is_alpha_helix_end_before_start() const; [[nodiscard]] bool bend() const; [[nodiscard]] double accessibility() const; /// \brief returns resinfo, ladder and parallel [[nodiscard]] std::tuple bridge_partner(int i) const; [[nodiscard]] int sheet() const; [[nodiscard]] int strand() const; /// \brief return resinfo and the energy of the bond [[nodiscard]] std::tuple acceptor(int i) const; [[nodiscard]] std::tuple donor(int i) const; /// \brief Simple compare equals bool operator==(const residue_info &rhs) const { return m_impl == rhs.m_impl; } /// \brief Returns \result true if there is a bond between two residues friend bool test_bond(residue_info const &a, residue_info const &b); [[nodiscard]] residue_info next() const; private: residue_info(residue *res) : m_impl(res) { } residue *m_impl = nullptr; }; class iterator { public: using iterator_category = std::bidirectional_iterator_tag; using value_type = const residue_info; using difference_type = std::ptrdiff_t; using pointer = value_type *; using reference = value_type &; iterator() = default; iterator(const iterator &i) = default; iterator(residue *res); iterator &operator=(const iterator &i) = default; reference operator*() const { return m_current; } pointer operator->() const { return &m_current; } iterator &operator++(); iterator operator++(int) { auto tmp(*this); this->operator++(); return tmp; } iterator &operator--(); iterator operator--(int) { auto tmp(*this); this->operator--(); return tmp; } bool operator==(const iterator &rhs) const { return m_current.m_impl == rhs.m_current.m_impl; } bool operator!=(const iterator &rhs) const { return m_current.m_impl != rhs.m_current.m_impl; } private: residue_info m_current; }; static_assert(std::input_iterator); using value_type = residue_info; // To access residue info by key, i.e. LabelAsymID and LabelSeqID using key_type = std::tuple; [[nodiscard]] iterator begin() const; [[nodiscard]] iterator end() const; [[nodiscard]] iterator cbegin() const; [[nodiscard]] iterator cend() const; residue_info operator[](const key_type &key) const; [[nodiscard]] bool empty() const { return begin() == end(); } // -------------------------------------------------------------------- // Writing out the data, either in legacy format... void write_legacy_output(std::ostream &os) const; // ... or as annotation in the cif::datablock void annotate(cif::datablock &db, bool writeOther, bool writeDSSPCategories) const; // convenience method, when creating old style DSSP files enum class pdb_record_type { HEADER, COMPND, SOURCE, AUTHOR }; [[nodiscard]] std::string get_pdb_header_line(pdb_record_type pdb_record) const; private: struct DSSP_impl *m_impl; }; static_assert(std::ranges::input_range);PDB-REDO-dssp-ca06797/libdssp/mmcif_pdbx/000077500000000000000000000000001516741327300177405ustar00rootroot00000000000000PDB-REDO-dssp-ca06797/libdssp/mmcif_pdbx/dssp-extension.dic000066400000000000000000001741551516741327300234210ustar00rootroot00000000000000# File: dssp-extension.dic # Date: 30-May-2023 data_dssp-extension.dic _datablock.id dssp-extension.dic _datablock.description ; This data block holds the dictionary for Secondary Structure information as written by e.g. DSSP ; _dictionary.title dssp-extension.dic _dictionary.datablock_id dssp-extension.dic _dictionary.version 1.1.1 loop_ _dictionary_history.version _dictionary_history.update _dictionary_history.revision 1.0 2023-05-30 ; Initial release ; 1.1 2025-02-26 ; Changes (mlh) + Added dictionary blocks ; 1.1.1 2025-05-12 ; Changes (mlh) + Changed mandatory_code of accessible_surface_of_protein to no ; ######################################## ## Category dssp_struct_bridge_pairs ## ######################################## save_dssp_struct_bridge_pairs # _category.description 'dssp_struct_bridge_pairs describes bridge pairs as assigned by DSSP.' _category.id dssp_struct_bridge_pairs _category.mandatory_code no # _category_key.name '_dssp_struct_bridge_pairs.id' loop_ _category_group.id 'inclusive_group' 'struct_group' # loop_ _category_examples.detail _category_examples.case # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - ; Example taken from 1cbs, first bridge pair ; ; _dssp_struct_bridge_pairs.id 2 _dssp_struct_bridge_pairs.label_comp_id ASN _dssp_struct_bridge_pairs.label_seq_id 2 _dssp_struct_bridge_pairs.label_asym_id A _dssp_struct_bridge_pairs.auth_seq_id 2 _dssp_struct_bridge_pairs.auth_asym_id A _dssp_struct_bridge_pairs.pdbx_PDB_ins_code ? _dssp_struct_bridge_pairs.acceptor_1_label_comp_id PHE _dssp_struct_bridge_pairs.acceptor_1_label_seq_id 3 _dssp_struct_bridge_pairs.acceptor_1_label_asym_id A _dssp_struct_bridge_pairs.acceptor_1_auth_seq_id 3 _dssp_struct_bridge_pairs.acceptor_1_auth_asym_id A _dssp_struct_bridge_pairs.acceptor_1_pdbx_PDB_ins_code ? _dssp_struct_bridge_pairs.acceptor_1_energy -0.1 _dssp_struct_bridge_pairs.acceptor_2_label_comp_id SER _dssp_struct_bridge_pairs.acceptor_2_label_seq_id 4 _dssp_struct_bridge_pairs.acceptor_2_label_asym_id A _dssp_struct_bridge_pairs.acceptor_2_auth_seq_id 4 _dssp_struct_bridge_pairs.acceptor_2_auth_asym_id A _dssp_struct_bridge_pairs.acceptor_2_pdbx_PDB_ins_code ? _dssp_struct_bridge_pairs.acceptor_2_energy -0.1 _dssp_struct_bridge_pairs.donor_1_label_comp_id ASN _dssp_struct_bridge_pairs.donor_1_label_seq_id 91 _dssp_struct_bridge_pairs.donor_1_label_asym_id A _dssp_struct_bridge_pairs.donor_1_auth_seq_id 91 _dssp_struct_bridge_pairs.donor_1_auth_asym_id A _dssp_struct_bridge_pairs.donor_1_pdbx_PDB_ins_code ? _dssp_struct_bridge_pairs.donor_1_energy -0.0 _dssp_struct_bridge_pairs.donor_2_label_comp_id GLU _dssp_struct_bridge_pairs.donor_2_label_seq_id 46 _dssp_struct_bridge_pairs.donor_2_label_asym_id A _dssp_struct_bridge_pairs.donor_2_auth_seq_id 46 _dssp_struct_bridge_pairs.donor_2_auth_asym_id A _dssp_struct_bridge_pairs.donor_2_pdbx_PDB_ins_code ? _dssp_struct_bridge_pairs.donor_2_energy -0.0 ; save_ # save__dssp_struct_bridge_pairs.id _item.description ; The value of _dssp_struct_bridge_pairs.id must uniquely identify a record in the dssp_struct_bridge_pairs list. ; _item.name '_dssp_struct_bridge_pairs.id' _item.category_id dssp_struct_bridge_pairs _item.mandatory_code yes _item_type.code code save_ save__dssp_struct_bridge_pairs.label_comp_id _item.description ; A component of the identifier for this monomer. This data item is a pointer to _chem_comp.id in the CHEM_COMP category. ; _item.name '_dssp_struct_bridge_pairs.label_comp_id' _item.category_id dssp_struct_bridge_pairs _item.mandatory_code yes _item_type.code ucode save_ save__dssp_struct_bridge_pairs.label_seq_id _item.description ; A component of the identifier for this monomer. ; _item.name '_dssp_struct_bridge_pairs.label_seq_id' _item.category_id dssp_struct_bridge_pairs _item.mandatory_code yes _item_type.code int save_ save__dssp_struct_bridge_pairs.label_asym_id _item.description ; A component of the identifier for this monomer ; _item.name '_dssp_struct_bridge_pairs.label_asym_id' _item.category_id dssp_struct_bridge_pairs _item.mandatory_code yes _item_type.code code save_ save__dssp_struct_bridge_pairs.auth_seq_id _item.description ; A component of the identifier for this monomer ; _item.name '_dssp_struct_bridge_pairs.auth_seq_id' _item.category_id dssp_struct_bridge_pairs _item.mandatory_code no _item_type.code int save_ save__dssp_struct_bridge_pairs.auth_asym_id _item.description ; A component of the identifier for this monomer ; _item.name '_dssp_struct_bridge_pairs.auth_asym_id' _item.category_id dssp_struct_bridge_pairs _item.mandatory_code no _item_type.code code save_ save__dssp_struct_bridge_pairs.pdbx_PDB_ins_code _item.description ; A component of the identifier for this monomer ; _item.name '_dssp_struct_bridge_pairs.pdbx_PDB_ins_code' _item.category_id dssp_struct_bridge_pairs _item.mandatory_code no _item_type.code code save_ save__dssp_struct_bridge_pairs.acceptor_1_label_comp_id _item.description ; A component of the identifier of the first residue that forms a bridge pair with this monomer where this monomer is the donor. ; _item.name '_dssp_struct_bridge_pairs.acceptor_1_label_comp_id' _item.category_id dssp_struct_bridge_pairs _item.mandatory_code no _item_type.code ucode save_ save__dssp_struct_bridge_pairs.acceptor_1_label_seq_id _item.description ; A component of the identifier of the first residue that forms a bridge pair with this monomer where this monomer is the donor. ; _item.name '_dssp_struct_bridge_pairs.acceptor_1_label_seq_id' _item.category_id dssp_struct_bridge_pairs _item.mandatory_code no _item_type.code int save_ save__dssp_struct_bridge_pairs.acceptor_1_label_asym_id _item.description ; A component of the identifier of the first residue that forms a bridge pair with this monomer where this monomer is the donor. ; _item.name '_dssp_struct_bridge_pairs.acceptor_1_label_asym_id' _item.category_id dssp_struct_bridge_pairs _item.mandatory_code no _item_type.code code save_ save__dssp_struct_bridge_pairs.acceptor_1_auth_seq_id _item.description ; A component of the identifier of the first residue that forms a bridge pair with this monomer where this monomer is the donor. ; _item.name '_dssp_struct_bridge_pairs.acceptor_1_auth_seq_id' _item.category_id dssp_struct_bridge_pairs _item.mandatory_code no _item_type.code int save_ save__dssp_struct_bridge_pairs.acceptor_1_auth_asym_id _item.description ; A component of the identifier of the first residue that forms a bridge pair with this monomer where this monomer is the donor. ; _item.name '_dssp_struct_bridge_pairs.acceptor_1_auth_asym_id' _item.category_id dssp_struct_bridge_pairs _item.mandatory_code no _item_type.code code save_ save__dssp_struct_bridge_pairs.acceptor_1_pdbx_PDB_ins_code _item.description ; A component of the identifier of the first residue that forms a bridge pair with this monomer where this monomer is the donor. ; _item.name '_dssp_struct_bridge_pairs.acceptor_1_pdbx_PDB_ins_code' _item.category_id dssp_struct_bridge_pairs _item.mandatory_code no _item_type.code code save_ save__dssp_struct_bridge_pairs.acceptor_1_energy _item.description ; The calculated energy for the H-bond between this residue and the first acceptor. ; _item.name '_dssp_struct_bridge_pairs.acceptor_1_energy' _item.category_id dssp_struct_bridge_pairs _item.mandatory_code no _item_type.code float save_ save__dssp_struct_bridge_pairs.acceptor_2_label_comp_id _item.description ; A component of the identifier of the second residue that forms a bridge pair with this monomer where this monomer is the donor. ; _item.name '_dssp_struct_bridge_pairs.acceptor_2_label_comp_id' _item.category_id dssp_struct_bridge_pairs _item.mandatory_code no _item_type.code ucode save_ save__dssp_struct_bridge_pairs.acceptor_2_label_seq_id _item.description ; A component of the identifier of the second residue that forms a bridge pair with this monomer where this monomer is the donor. ; _item.name '_dssp_struct_bridge_pairs.acceptor_2_label_seq_id' _item.category_id dssp_struct_bridge_pairs _item.mandatory_code no _item_type.code int save_ save__dssp_struct_bridge_pairs.acceptor_2_label_asym_id _item.description ; A component of the identifier of the second residue that forms a bridge pair with this monomer where this monomer is the donor. ; _item.name '_dssp_struct_bridge_pairs.acceptor_2_label_asym_id' _item.category_id dssp_struct_bridge_pairs _item.mandatory_code no _item_type.code code save_ save__dssp_struct_bridge_pairs.acceptor_2_auth_seq_id _item.description ; A component of the identifier of the second residue that forms a bridge pair with this monomer where this monomer is the donor. ; _item.name '_dssp_struct_bridge_pairs.acceptor_2_auth_seq_id' _item.category_id dssp_struct_bridge_pairs _item.mandatory_code no _item_type.code int save_ save__dssp_struct_bridge_pairs.acceptor_2_auth_asym_id _item.description ; A component of the identifier of the second residue that forms a bridge pair with this monomer where this monomer is the donor. ; _item.name '_dssp_struct_bridge_pairs.acceptor_2_auth_asym_id' _item.category_id dssp_struct_bridge_pairs _item.mandatory_code no _item_type.code code save_ save__dssp_struct_bridge_pairs.acceptor_2_pdbx_PDB_ins_code _item.description ; A component of the identifier of the second residue that forms a bridge pair with this monomer where this monomer is the donor. ; _item.name '_dssp_struct_bridge_pairs.acceptor_2_pdbx_PDB_ins_code' _item.category_id dssp_struct_bridge_pairs _item.mandatory_code no _item_type.code code save_ save__dssp_struct_bridge_pairs.acceptor_2_energy _item.description ; The calculated energy for the H-bond between this residue and the second acceptor. ; _item.name '_dssp_struct_bridge_pairs.acceptor_2_energy' _item.category_id dssp_struct_bridge_pairs _item.mandatory_code no _item_type.code float save_ save__dssp_struct_bridge_pairs.donor_1_label_comp_id _item.description ; A component of the identifier of the first residue that forms a bridge pair with this monomer where this monomer is the acceptor. ; _item.name '_dssp_struct_bridge_pairs.donor_1_label_comp_id' _item.category_id dssp_struct_bridge_pairs _item.mandatory_code no _item_type.code ucode save_ save__dssp_struct_bridge_pairs.donor_1_label_seq_id _item.description ; A component of the identifier of the first residue that forms a bridge pair with this monomer where this monomer is the acceptor. ; _item.name '_dssp_struct_bridge_pairs.donor_1_label_seq_id' _item.category_id dssp_struct_bridge_pairs _item.mandatory_code no _item_type.code int save_ save__dssp_struct_bridge_pairs.donor_1_label_asym_id _item.description ; A component of the identifier of the first residue that forms a bridge pair with this monomer where this monomer is the acceptor. ; _item.name '_dssp_struct_bridge_pairs.donor_1_label_asym_id' _item.category_id dssp_struct_bridge_pairs _item.mandatory_code no _item_type.code code save_ save__dssp_struct_bridge_pairs.donor_1_auth_seq_id _item.description ; A component of the identifier of the first residue that forms a bridge pair with this monomer where this monomer is the acceptor. ; _item.name '_dssp_struct_bridge_pairs.donor_1_auth_seq_id' _item.category_id dssp_struct_bridge_pairs _item.mandatory_code no _item_type.code int save_ save__dssp_struct_bridge_pairs.donor_1_auth_asym_id _item.description ; A component of the identifier of the first residue that forms a bridge pair with this monomer where this monomer is the acceptor. ; _item.name '_dssp_struct_bridge_pairs.donor_1_auth_asym_id' _item.category_id dssp_struct_bridge_pairs _item.mandatory_code no _item_type.code code save_ save__dssp_struct_bridge_pairs.donor_1_pdbx_PDB_ins_code _item.description ; A component of the identifier of the first residue that forms a bridge pair with this monomer where this monomer is the acceptor. ; _item.name '_dssp_struct_bridge_pairs.donor_1_pdbx_PDB_ins_code' _item.category_id dssp_struct_bridge_pairs _item.mandatory_code no _item_type.code code save_ save__dssp_struct_bridge_pairs.donor_1_energy _item.description ; The calculated energy for the H-bond between this residue and the first donor. ; _item.name '_dssp_struct_bridge_pairs.donor_1_energy' _item.category_id dssp_struct_bridge_pairs _item.mandatory_code no _item_type.code float save_ save__dssp_struct_bridge_pairs.donor_2_label_comp_id _item.description ; A component of the identifier of the second residue that forms a bridge pair with this monomer where this monomer is the acceptor. ; _item.name '_dssp_struct_bridge_pairs.donor_2_label_comp_id' _item.category_id dssp_struct_bridge_pairs _item.mandatory_code no _item_type.code ucode save_ save__dssp_struct_bridge_pairs.donor_2_label_seq_id _item.description ; A component of the identifier of the second residue that forms a bridge pair with this monomer where this monomer is the acceptor. ; _item.name '_dssp_struct_bridge_pairs.donor_2_label_seq_id' _item.category_id dssp_struct_bridge_pairs _item.mandatory_code no _item_type.code int save_ save__dssp_struct_bridge_pairs.donor_2_label_asym_id _item.description ; A component of the identifier of the second residue that forms a bridge pair with this monomer where this monomer is the acceptor. ; _item.name '_dssp_struct_bridge_pairs.donor_2_label_asym_id' _item.category_id dssp_struct_bridge_pairs _item.mandatory_code no _item_type.code code save_ save__dssp_struct_bridge_pairs.donor_2_auth_seq_id _item.description ; A component of the identifier of the second residue that forms a bridge pair with this monomer where this monomer is the acceptor. ; _item.name '_dssp_struct_bridge_pairs.donor_2_auth_seq_id' _item.category_id dssp_struct_bridge_pairs _item.mandatory_code no _item_type.code int save_ save__dssp_struct_bridge_pairs.donor_2_auth_asym_id _item.description ; A component of the identifier of the second residue that forms a bridge pair with this monomer where this monomer is the acceptor. ; _item.name '_dssp_struct_bridge_pairs.donor_2_auth_asym_id' _item.category_id dssp_struct_bridge_pairs _item.mandatory_code no _item_type.code code save_ save__dssp_struct_bridge_pairs.donor_2_pdbx_PDB_ins_code _item.description ; A component of the identifier of the second residue that forms a bridge pair with this monomer where this monomer is the acceptor. ; _item.name '_dssp_struct_bridge_pairs.donor_2_pdbx_PDB_ins_code' _item.category_id dssp_struct_bridge_pairs _item.mandatory_code no _item_type.code code save_ save__dssp_struct_bridge_pairs.donor_2_energy _item.description ; The calculated energy for the H-bond between this residue and the second donor. ; _item.name '_dssp_struct_bridge_pairs.donor_2_energy' _item.category_id dssp_struct_bridge_pairs _item.mandatory_code no _item_type.code float save_ ######################################## ## Category dssp_struct_ladder ## ######################################## save_dssp_struct_ladder # _category.description 'dssp_struct_ladder describes ladders as assigned by DSSP.' _category.id dssp_struct_ladder _category.mandatory_code no # _category_key.name '_dssp_struct_ladder.id' loop_ _category_group.id 'inclusive_group' 'struct_group' # loop_ _category_examples.detail _category_examples.case # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - ; Example taken from 1cbs, first ladder ; ; _dssp_struct_ladder.id A _dssp_struct_ladder.sheet_id A _dssp_struct_ladder.range_id_1 A _dssp_struct_ladder.range_id_2 B _dssp_struct_ladder.type anti-parallel _dssp_struct_ladder.beg_1_label_comp_id GLY _dssp_struct_ladder.beg_1_label_asym_id A _dssp_struct_ladder.beg_1_label_seq_id 5 _dssp_struct_ladder.pdbx_beg_1_PDB_ins_code ? _dssp_struct_ladder.end_1_label_comp_id TRP _dssp_struct_ladder.end_1_label_asym_id A _dssp_struct_ladder.end_1_label_seq_id 7 _dssp_struct_ladder.pdbx_end_1_PDB_ins_code ? _dssp_struct_ladder.beg_1_auth_comp_id GLY _dssp_struct_ladder.beg_1_auth_asym_id A _dssp_struct_ladder.beg_1_auth_seq_id 5 _dssp_struct_ladder.end_1_auth_comp_id TRP _dssp_struct_ladder.end_1_auth_asym_id A _dssp_struct_ladder.end_1_auth_seq_id 7 _dssp_struct_ladder.beg_2_label_comp_id ILE _dssp_struct_ladder.beg_2_label_asym_id A _dssp_struct_ladder.beg_2_label_seq_id 43 _dssp_struct_ladder.pdbx_beg_2_PDB_ins_code ? _dssp_struct_ladder.end_2_label_comp_id VAL _dssp_struct_ladder.end_2_label_asym_id A _dssp_struct_ladder.end_2_label_seq_id 41 _dssp_struct_ladder.pdbx_end_2_PDB_ins_code ? _dssp_struct_ladder.beg_2_auth_comp_id ILE _dssp_struct_ladder.beg_2_auth_asym_id A _dssp_struct_ladder.beg_2_auth_seq_id 43 _dssp_struct_ladder.end_2_auth_comp_id VAL _dssp_struct_ladder.end_2_auth_asym_id A _dssp_struct_ladder.end_2_auth_seq_id 41 ; save_ save__dssp_struct_ladder.id _item.description ; The value of _dssp_struct_ladder.id must uniquely identify a record in the dssp_struct_ladder list. ; _item.name '_dssp_struct_ladder.id' _item.category_id dssp_struct_ladder _item.mandatory_code yes _item_type.code code save_ save__dssp_struct_ladder.sheet_id _item.description ; This data item is a pointer to _struct_sheet.id in the STRUCT_SHEET category. ; _item.name '_dssp_struct_ladder.sheet_id' _item.category_id dssp_struct_ladder _item.mandatory_code yes _item_type.code code save_ save__dssp_struct_ladder.range_id_1 _item.description ; This data item is a pointer to _struct_sheet_range.id in the STRUCT_SHEET_RANGE category. ; _item.name '_dssp_struct_ladder.range_id_1' _item.category_id dssp_struct_ladder _item.mandatory_code yes _item_type.code code save_ save__dssp_struct_ladder.range_id_2 _item.description ; This data item is a pointer to _struct_sheet_range.id in the STRUCT_SHEET_RANGE category. ; _item.name '_dssp_struct_ladder.range_id_2' _item.category_id dssp_struct_ladder _item.mandatory_code yes _item_type.code code save_ save__dssp_struct_ladder.type _item.description ; The type of the ladder, be it parallel or anti-parallel ; _item.name '_dssp_struct_ladder.type' _item.category_id dssp_struct_ladder _item.mandatory_code yes _item_type.code code loop_ _item_enumeration.value _item_enumeration.detail parallel 'The strands forming a ladder are oriented parallel' anti-parallel 'The strands forming a ladder are oriented anti-parallel' save_ save__dssp_struct_ladder.beg_1_label_comp_id _item.description ; A component of the identifier for the residue at which the first ladder segment begins. ; _item.name '_dssp_struct_ladder.beg_1_label_comp_id' _item.category_id dssp_struct_ladder _item.mandatory_code yes _item_type.code ucode save_ save__dssp_struct_ladder.beg_1_label_asym_id _item.description ; A component of the identifier for the residue at which the first ladder segment begins. ; _item.name '_dssp_struct_ladder.beg_1_label_asym_id' _item.category_id dssp_struct_ladder _item.mandatory_code yes _item_type.code code save_ save__dssp_struct_ladder.beg_1_label_seq_id _item.description ; A component of the identifier for the residue at which the first ladder segment begins. ; _item.name '_dssp_struct_ladder.beg_1_label_seq_id' _item.category_id dssp_struct_ladder _item.mandatory_code yes _item_type.code int save_ save__dssp_struct_ladder.pdbx_beg_1_PDB_ins_code _item.description ; A component of the identifier for the residue at which the first ladder segment begins. ; _item.name '_dssp_struct_ladder.pdbx_beg_1_PDB_ins_code' _item.category_id dssp_struct_ladder _item.mandatory_code no _item_type.code code save_ save__dssp_struct_ladder.end_1_label_comp_id _item.description ; A component of the identifier for the residue at which the first ladder segment ends. ; _item.name '_dssp_struct_ladder.end_1_label_comp_id' _item.category_id dssp_struct_ladder _item.mandatory_code yes _item_type.code ucode save_ save__dssp_struct_ladder.end_1_label_asym_id _item.description ; A component of the identifier for the residue at which the first ladder segment ends. ; _item.name '_dssp_struct_ladder.end_1_label_asym_id' _item.category_id dssp_struct_ladder _item.mandatory_code yes _item_type.code code save_ save__dssp_struct_ladder.end_1_label_seq_id _item.description ; A component of the identifier for the residue at which the first ladder segment ends. ; _item.name '_dssp_struct_ladder.end_1_label_seq_id' _item.category_id dssp_struct_ladder _item.mandatory_code yes _item_type.code int save_ save__dssp_struct_ladder.pdbx_end_1_PDB_ins_code _item.description ; A component of the identifier for the residue at which the first ladder segment ends. ; _item.name '_dssp_struct_ladder.pdbx_end_1_PDB_ins_code' _item.category_id dssp_struct_ladder _item.mandatory_code no _item_type.code code save_ save__dssp_struct_ladder.beg_1_auth_comp_id _item.description ; A component of the identifier for the residue at which the first ladder segment begins. ; _item.name '_dssp_struct_ladder.beg_1_auth_comp_id' _item.category_id dssp_struct_ladder _item.mandatory_code no _item_type.code ucode save_ save__dssp_struct_ladder.beg_1_auth_asym_id _item.description ; A component of the identifier for the residue at which the first ladder segment begins. ; _item.name '_dssp_struct_ladder.beg_1_auth_asym_id' _item.category_id dssp_struct_ladder _item.mandatory_code no _item_type.code code save_ save__dssp_struct_ladder.beg_1_auth_seq_id _item.description ; A component of the identifier for the residue at which the first ladder segment begins. ; _item.name '_dssp_struct_ladder.beg_1_auth_seq_id' _item.category_id dssp_struct_ladder _item.mandatory_code no _item_type.code int save_ save__dssp_struct_ladder.end_1_auth_comp_id _item.description ; A component of the identifier for the residue at which the first ladder segment ends. ; _item.name '_dssp_struct_ladder.end_1_auth_comp_id' _item.category_id dssp_struct_ladder _item.mandatory_code no _item_type.code ucode save_ save__dssp_struct_ladder.end_1_auth_asym_id _item.description ; A component of the identifier for the residue at which the first ladder segment ends. ; _item.name '_dssp_struct_ladder.end_1_auth_asym_id' _item.category_id dssp_struct_ladder _item.mandatory_code no _item_type.code code save_ save__dssp_struct_ladder.end_1_auth_seq_id _item.description ; A component of the identifier for the residue at which the first ladder segment ends. ; _item.name '_dssp_struct_ladder.end_1_auth_seq_id' _item.category_id dssp_struct_ladder _item.mandatory_code no _item_type.code int save_ save__dssp_struct_ladder.beg_2_label_comp_id _item.description ; A component of the identifier for the residue at which the second ladder segment begins. ; _item.name '_dssp_struct_ladder.beg_2_label_comp_id' _item.category_id dssp_struct_ladder _item.mandatory_code yes _item_type.code ucode save_ save__dssp_struct_ladder.beg_2_label_asym_id _item.description ; A component of the identifier for the residue at which the second ladder segment begins. ; _item.name '_dssp_struct_ladder.beg_2_label_asym_id' _item.category_id dssp_struct_ladder _item.mandatory_code yes _item_type.code code save_ save__dssp_struct_ladder.beg_2_label_seq_id _item.description ; A component of the identifier for the residue at which the second ladder segment begins. ; _item.name '_dssp_struct_ladder.beg_2_label_seq_id' _item.category_id dssp_struct_ladder _item.mandatory_code yes _item_type.code int save_ save__dssp_struct_ladder.pdbx_beg_2_PDB_ins_code _item.description ; A component of the identifier for the residue at which the second ladder segment begins. ; _item.name '_dssp_struct_ladder.pdbx_beg_2_PDB_ins_code' _item.category_id dssp_struct_ladder _item.mandatory_code no _item_type.code code save_ save__dssp_struct_ladder.end_2_label_comp_id _item.description ; A component of the identifier for the residue at which the second ladder segment ends. ; _item.name '_dssp_struct_ladder.end_2_label_comp_id' _item.category_id dssp_struct_ladder _item.mandatory_code yes _item_type.code ucode save_ save__dssp_struct_ladder.end_2_label_asym_id _item.description ; A component of the identifier for the residue at which the second ladder segment ends. ; _item.name '_dssp_struct_ladder.end_2_label_asym_id' _item.category_id dssp_struct_ladder _item.mandatory_code yes _item_type.code code save_ save__dssp_struct_ladder.end_2_label_seq_id _item.description ; A component of the identifier for the residue at which the second ladder segment ends. ; _item.name '_dssp_struct_ladder.end_2_label_seq_id' _item.category_id dssp_struct_ladder _item.mandatory_code yes _item_type.code int save_ save__dssp_struct_ladder.pdbx_end_2_PDB_ins_code _item.description ; A component of the identifier for the residue at which the second ladder segment ends. ; _item.name '_dssp_struct_ladder.pdbx_end_2_PDB_ins_code' _item.category_id dssp_struct_ladder _item.mandatory_code no _item_type.code code save_ save__dssp_struct_ladder.beg_2_auth_comp_id _item.description ; A component of the identifier for the residue at which the second ladder segment begins. ; _item.name '_dssp_struct_ladder.beg_2_auth_comp_id' _item.category_id dssp_struct_ladder _item.mandatory_code no _item_type.code ucode save_ save__dssp_struct_ladder.beg_2_auth_asym_id _item.description ; A component of the identifier for the residue at which the second ladder segment begins. ; _item.name '_dssp_struct_ladder.beg_2_auth_asym_id' _item.category_id dssp_struct_ladder _item.mandatory_code no _item_type.code code save_ save__dssp_struct_ladder.beg_2_auth_seq_id _item.description ; A component of the identifier for the residue at which the second ladder segment begins. ; _item.name '_dssp_struct_ladder.beg_2_auth_seq_id' _item.category_id dssp_struct_ladder _item.mandatory_code no _item_type.code int save_ save__dssp_struct_ladder.end_2_auth_comp_id _item.description ; A component of the identifier for the residue at which the second ladder segment ends. ; _item.name '_dssp_struct_ladder.end_2_auth_comp_id' _item.category_id dssp_struct_ladder _item.mandatory_code no _item_type.code ucode save_ save__dssp_struct_ladder.end_2_auth_asym_id _item.description ; A component of the identifier for the residue at which the second ladder segment ends. ; _item.name '_dssp_struct_ladder.end_2_auth_asym_id' _item.category_id dssp_struct_ladder _item.mandatory_code no _item_type.code code save_ save__dssp_struct_ladder.end_2_auth_seq_id _item.description ; A component of the identifier for the residue at which the second ladder segment ends. ; _item.name '_dssp_struct_ladder.end_2_auth_seq_id' _item.category_id dssp_struct_ladder _item.mandatory_code no _item_type.code int save_ ######################################## ## Category dssp_statistics ## ######################################## save_dssp_statistics # _category.description 'dssp_statistics contains secondary structure statistics as calculated by DSSP.' _category.id dssp_statistics _category.mandatory_code no # _category_key.name '_dssp_statistics.entry_id' loop_ _category_group.id 'inclusive_group' 'struct_group' # loop_ _category_examples.detail _category_examples.case # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - ; Example taken from 1cbs ; ; _dssp_statistics.entry_id 1CBS _dssp_statistics.nr_of_residues 137 _dssp_statistics.nr_of_chains 1 _dssp_statistics.nr_of_ss_bridges_total 0 _dssp_statistics.nr_of_ss_bridges_intra_chain 0 _dssp_statistics.nr_of_ss_bridges_inter_chain 0 _dssp_statistics.accessible_surface_of_protein 7905.01 ; save_ save__dssp_statistics.entry_id _item.description ; The entry ID for which these statistics are calculated. ; _item.name '_dssp_statistics.entry_id' _item.category_id dssp_statistics _item.mandatory_code yes _item_type.code code # _item_linked.child_name "_dssp_statistics.entry_id" _item_linked.parent_name "_entry.id" # save_ save__dssp_statistics.nr_of_residues _item.description ; The total number of residues to which secondary structure information was assigned. ; _item.name '_dssp_statistics.nr_of_residues' _item.category_id dssp_statistics _item.mandatory_code yes _item_type.code int save_ save__dssp_statistics.nr_of_chains _item.description ; The number of chains used ; _item.name '_dssp_statistics.nr_of_chains' _item.category_id dssp_statistics _item.mandatory_code yes _item_type.code int save_ save__dssp_statistics.nr_of_ss_bridges_total _item.description ; The number of sulfur-sulfur bridges assigned. ; _item.name '_dssp_statistics.nr_of_ss_bridges_total' _item.category_id dssp_statistics _item.mandatory_code yes _item_type.code int save_ save__dssp_statistics.nr_of_ss_bridges_intra_chain _item.description ; The number of intra-chain sulfur-sulfur bridges assigned. ; _item.name '_dssp_statistics.nr_of_ss_bridges_intra_chain' _item.category_id dssp_statistics _item.mandatory_code yes _item_type.code int save_ save__dssp_statistics.nr_of_ss_bridges_inter_chain _item.description ; The number of inter-chain sulfur-sulfur bridges assigned. ; _item.name '_dssp_statistics.nr_of_ss_bridges_inter_chain' _item.category_id dssp_statistics _item.mandatory_code yes _item_type.code int save_ save__dssp_statistics.accessible_surface_of_protein _item.description ; The total accessible surface of the protein in square Angstroms. ; _item.name '_dssp_statistics.accessible_surface_of_protein' _item.category_id dssp_statistics _item.mandatory_code no _item_type.code float save_ ######################################## ## Category dssp_statistics_hbond ## ######################################## save_dssp_statistics_hbond # _category.description 'dssp_statistics_hbond contains statistics for the collection of h-bond variants calculated by DSSP.' _category.id dssp_statistics_hbond _category.mandatory_code no # loop_ _category_key.name '_dssp_statistics_hbond.entry_id' '_dssp_statistics_hbond.type' loop_ _category_group.id 'inclusive_group' 'struct_group' # loop_ _category_examples.detail _category_examples.case # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - ; Example taken from 1cbs ; ; _dssp_statistics_hbond.entry_id 1CBS _dssp_statistics_hbond.type O(I)-->H-N(J) _dssp_statistics_hbond.count 94 _dssp_statistics_hbond.count_per_100 68.6 ; save_ save__dssp_statistics_hbond.entry_id _item.description ; The entry ID for which these statistics are calculated. ; _item.name '_dssp_statistics_hbond.entry_id' _item.category dssp_statistics_hbond _item.mandatory_code yes _item_type.code code # _item_linked.child_name "_dssp_statistics_hbond.entry_id" _item_linked.parent_name "_entry.id" # save_ save__dssp_statistics_hbond.type _item.description ; The type of the h-bond ; _item.name '_dssp_statistics_hbond.type' _item.category dssp_statistics_hbond _item.mandatory_code yes _item_type.code text loop_ _item_enumeration.value _item_enumeration.detail O(I)-->H-N(J) 'non-bridge h-bond with residue further away than 5 residues' 'PARALLEL BRIDGES' 'h-bond forming a parallel bridge' 'ANTIPARALLEL BRIDGES' 'h-bond forming a anti-parallel bridge' O(I)-->H-N(I-5) 'h-bond with residue five residues before the current one' O(I)-->H-N(I-4) 'h-bond with residue four residues before the current one' O(I)-->H-N(I-3) 'h-bond with residue three residues before the current one' O(I)-->H-N(I-2) 'h-bond with residue two residues before the current one' O(I)-->H-N(I-1) 'h-bond with residue one residue before the current one' O(I)-->H-N(I+0) 'h-bond with current residue itself' O(I)-->H-N(I+1) 'h-bond with residue one residues after the current one' O(I)-->H-N(I+2) 'h-bond with residue two residues after the current one' O(I)-->H-N(I+3) 'h-bond with residue three residues after the current one' O(I)-->H-N(I+4) 'h-bond with residue four residues after the current one' O(I)-->H-N(I+5) 'h-bond with residue five residues after the current one' save_ save__dssp_statistics_hbond.count _item.description ; Absolute number of h-bonds of this type ; _item.name '_dssp_statistics_hbond.count' _item.category dssp_statistics_hbond _item.mandatory_code yes _item_type.code int save_ save__dssp_statistics_hbond.count_per_100 _item.description ; Number of h-bonds of this type per hundred residues in the entire structure ; _item.name '_dssp_statistics_hbond.count_per_100' _item.category dssp_statistics_hbond _item.mandatory_code yes _item_type.code float save_ ######################################## ## Category dssp_statistics_histogram ## ######################################## save_dssp_statistics_histogram # _category.description 'dssp_statistics_histogram contains the statistics for the ladders and helices in the form of a histogram as calculated by DSSP.' _category.id dssp_statistics_histogram _category.mandatory_code no # loop_ _category_key.name '_dssp_statistics_histogram.entry_id' '_dssp_statistics_histogram.type' loop_ _category_group.id 'inclusive_group' 'struct_group' # loop_ _category_examples.detail _category_examples.case # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - ; Example taken from 1cbs ; ; _dssp_statistics_histogram.entry_id 1CBS _dssp_statistics_histogram.type antiparallel_bridges_per_ladder _dssp_statistics_histogram.1 0 _dssp_statistics_histogram.2 0 _dssp_statistics_histogram.3 1 _dssp_statistics_histogram.4 1 _dssp_statistics_histogram.5 1 _dssp_statistics_histogram.6 1 _dssp_statistics_histogram.7 4 _dssp_statistics_histogram.8 1 _dssp_statistics_histogram.9 0 _dssp_statistics_histogram.10 0 _dssp_statistics_histogram.11 0 _dssp_statistics_histogram.12 0 _dssp_statistics_histogram.13 0 _dssp_statistics_histogram.14 0 _dssp_statistics_histogram.15 0 _dssp_statistics_histogram.16 0 _dssp_statistics_histogram.17 0 _dssp_statistics_histogram.18 0 _dssp_statistics_histogram.19 0 _dssp_statistics_histogram.20 0 _dssp_statistics_histogram.21 0 _dssp_statistics_histogram.22 0 _dssp_statistics_histogram.23 0 _dssp_statistics_histogram.24 0 _dssp_statistics_histogram.25 0 _dssp_statistics_histogram.26 0 _dssp_statistics_histogram.27 0 _dssp_statistics_histogram.28 0 _dssp_statistics_histogram.29 0 _dssp_statistics_histogram.30 0 ; save_ save__dssp_statistics_histogram.entry_id _item.description ; The entry ID for which these statistics are calculated. ; _item.name '_dssp_statistics_histogram.entry_id' _item.category dssp_statistics_histogram _item.mandatory_code yes _item_type.code code # _item_linked.child_name "_dssp_statistics_histogram.entry_id" _item_linked.parent_name "_entry.id" # save_ save__dssp_statistics_histogram.type _item.description ; The type for which this histogram contains data ; _item.name '_dssp_statistics_histogram.type' _item.category dssp_statistics_histogram _item.mandatory_code yes _item_type.code code loop_ _item_enumeration.value _item_enumeration.detail residues_per_alpha_helix 'residues per alpha helix' parallel_bridges_per_ladder 'parallel bridges per ladder' antiparallel_bridges_per_ladder 'antiparallel bridges per ladder' ladders_per_sheet 'ladders per sheet' save_ save__dssp_statistics_histogram.1 _item.description ; The count of this type of ladder with a length of 1 residues ; _item.name '_dssp_statistics_histogram.1' _item.category dssp_statistics_histogram _item.mandatory_code yes _item_type.code int save_ save__dssp_statistics_histogram.2 _item.description ; The count of this type of ladder with a length of 2 residues ; _item.name '_dssp_statistics_histogram.2' _item.category dssp_statistics_histogram _item.mandatory_code yes _item_type.code int save_ save__dssp_statistics_histogram.3 _item.description ; The count of this type of ladder with a length of 3 residues ; _item.name '_dssp_statistics_histogram.3' _item.category dssp_statistics_histogram _item.mandatory_code yes _item_type.code int save_ save__dssp_statistics_histogram.4 _item.description ; The count of this type of ladder with a length of 4 residues ; _item.name '_dssp_statistics_histogram.4' _item.category dssp_statistics_histogram _item.mandatory_code yes _item_type.code int save_ save__dssp_statistics_histogram.5 _item.description ; The count of this type of ladder with a length of 5 residues ; _item.name '_dssp_statistics_histogram.5' _item.category dssp_statistics_histogram _item.mandatory_code yes _item_type.code int save_ save__dssp_statistics_histogram.6 _item.description ; The count of this type of ladder with a length of 6 residues ; _item.name '_dssp_statistics_histogram.6' _item.category dssp_statistics_histogram _item.mandatory_code yes _item_type.code int save_ save__dssp_statistics_histogram.7 _item.description ; The count of this type of ladder with a length of 7 residues ; _item.name '_dssp_statistics_histogram.7' _item.category dssp_statistics_histogram _item.mandatory_code yes _item_type.code int save_ save__dssp_statistics_histogram.8 _item.description ; The count of this type of ladder with a length of 8 residues ; _item.name '_dssp_statistics_histogram.8' _item.category dssp_statistics_histogram _item.mandatory_code yes _item_type.code int save_ save__dssp_statistics_histogram.9 _item.description ; The count of this type of ladder with a length of 9 residues ; _item.name '_dssp_statistics_histogram.9' _item.category dssp_statistics_histogram _item.mandatory_code yes _item_type.code int save_ save__dssp_statistics_histogram.10 _item.description ; The count of this type of ladder with a length of 10 residues ; _item.name '_dssp_statistics_histogram.10' _item.category dssp_statistics_histogram _item.mandatory_code yes _item_type.code int save_ save__dssp_statistics_histogram.11 _item.description ; The count of this type of ladder with a length of 11 residues ; _item.name '_dssp_statistics_histogram.11' _item.category dssp_statistics_histogram _item.mandatory_code yes _item_type.code int save_ save__dssp_statistics_histogram.12 _item.description ; The count of this type of ladder with a length of 12 residues ; _item.name '_dssp_statistics_histogram.12' _item.category dssp_statistics_histogram _item.mandatory_code yes _item_type.code int save_ save__dssp_statistics_histogram.13 _item.description ; The count of this type of ladder with a length of 13 residues ; _item.name '_dssp_statistics_histogram.13' _item.category dssp_statistics_histogram _item.mandatory_code yes _item_type.code int save_ save__dssp_statistics_histogram.14 _item.description ; The count of this type of ladder with a length of 14 residues ; _item.name '_dssp_statistics_histogram.14' _item.category dssp_statistics_histogram _item.mandatory_code yes _item_type.code int save_ save__dssp_statistics_histogram.15 _item.description ; The count of this type of ladder with a length of 15 residues ; _item.name '_dssp_statistics_histogram.15' _item.category dssp_statistics_histogram _item.mandatory_code yes _item_type.code int save_ save__dssp_statistics_histogram.16 _item.description ; The count of this type of ladder with a length of 16 residues ; _item.name '_dssp_statistics_histogram.16' _item.category dssp_statistics_histogram _item.mandatory_code yes _item_type.code int save_ save__dssp_statistics_histogram.17 _item.description ; The count of this type of ladder with a length of 17 residues ; _item.name '_dssp_statistics_histogram.17' _item.category dssp_statistics_histogram _item.mandatory_code yes _item_type.code int save_ save__dssp_statistics_histogram.18 _item.description ; The count of this type of ladder with a length of 18 residues ; _item.name '_dssp_statistics_histogram.18' _item.category dssp_statistics_histogram _item.mandatory_code yes _item_type.code int save_ save__dssp_statistics_histogram.19 _item.description ; The count of this type of ladder with a length of 19 residues ; _item.name '_dssp_statistics_histogram.19' _item.category dssp_statistics_histogram _item.mandatory_code yes _item_type.code int save_ save__dssp_statistics_histogram.20 _item.description ; The count of this type of ladder with a length of 20 residues ; _item.name '_dssp_statistics_histogram.20' _item.category dssp_statistics_histogram _item.mandatory_code yes _item_type.code int save_ save__dssp_statistics_histogram.21 _item.description ; The count of this type of ladder with a length of 21 residues ; _item.name '_dssp_statistics_histogram.21' _item.category dssp_statistics_histogram _item.mandatory_code yes _item_type.code int save_ save__dssp_statistics_histogram.22 _item.description ; The count of this type of ladder with a length of 22 residues ; _item.name '_dssp_statistics_histogram.22' _item.category dssp_statistics_histogram _item.mandatory_code yes _item_type.code int save_ save__dssp_statistics_histogram.23 _item.description ; The count of this type of ladder with a length of 23 residues ; _item.name '_dssp_statistics_histogram.23' _item.category dssp_statistics_histogram _item.mandatory_code yes _item_type.code int save_ save__dssp_statistics_histogram.24 _item.description ; The count of this type of ladder with a length of 24 residues ; _item.name '_dssp_statistics_histogram.24' _item.category dssp_statistics_histogram _item.mandatory_code yes _item_type.code int save_ save__dssp_statistics_histogram.25 _item.description ; The count of this type of ladder with a length of 25 residues ; _item.name '_dssp_statistics_histogram.25' _item.category dssp_statistics_histogram _item.mandatory_code yes _item_type.code int save_ save__dssp_statistics_histogram.26 _item.description ; The count of this type of ladder with a length of 26 residues ; _item.name '_dssp_statistics_histogram.26' _item.category dssp_statistics_histogram _item.mandatory_code yes _item_type.code int save_ save__dssp_statistics_histogram.27 _item.description ; The count of this type of ladder with a length of 27 residues ; _item.name '_dssp_statistics_histogram.27' _item.category dssp_statistics_histogram _item.mandatory_code yes _item_type.code int save_ save__dssp_statistics_histogram.28 _item.description ; The count of this type of ladder with a length of 28 residues ; _item.name '_dssp_statistics_histogram.28' _item.category dssp_statistics_histogram _item.mandatory_code yes _item_type.code int save_ save__dssp_statistics_histogram.29 _item.description ; The count of this type of ladder with a length of 29 residues ; _item.name '_dssp_statistics_histogram.29' _item.category dssp_statistics_histogram _item.mandatory_code yes _item_type.code int save_ save__dssp_statistics_histogram.30 _item.description ; The count of this type of ladder with a length of 30 or more residues ; _item.name '_dssp_statistics_histogram.30' _item.category dssp_statistics_histogram _item.mandatory_code yes _item_type.code int save_ ######################################## ## Category dssp_struct_summary ## ######################################## save_dssp_struct_summary # _category.description 'dssp_struct_summary contains the extra secondary structure information per residue as calculated by DSSP.' _category.id dssp_struct_summary _category.mandatory_code no # loop_ _category_key.name '_dssp_struct_summary.entry_id' '_dssp_struct_summary.label_asym_id' '_dssp_struct_summary.label_seq_id' '_dssp_struct_summary.label_comp_id' loop_ _category_group.id 'inclusive_group' 'struct_group' # loop_ _category_examples.detail _category_examples.case # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - ; Example taken from 1cbs ; ; _dssp_struct_summary.entry_id 1CBS _dssp_struct_summary.label_comp_id PHE _dssp_struct_summary.label_asym_id A _dssp_struct_summary.label_seq_id 15 _dssp_struct_summary.secondary_structure H _dssp_struct_summary.ss_bridge . _dssp_struct_summary.helix_3_10 . _dssp_struct_summary.helix_alpha > _dssp_struct_summary.helix_pi . _dssp_struct_summary.helix_pp . _dssp_struct_summary.bend S _dssp_struct_summary.chirality + _dssp_struct_summary.sheet . _dssp_struct_summary.strand . _dssp_struct_summary.ladder_1 . _dssp_struct_summary.ladder_2 . _dssp_struct_summary.accessibility 23.1 _dssp_struct_summary.TCO 0.940 _dssp_struct_summary.kappa 73.9 _dssp_struct_summary.alpha 44.8 _dssp_struct_summary.phi -66.9 _dssp_struct_summary.psi -48.6 _dssp_struct_summary.x_ca 22.4 _dssp_struct_summary.y_ca 17.2 _dssp_struct_summary.z_ca 17.7 ; save_ save__dssp_struct_summary.entry_id _item.description ; The entry ID for which these statistics are calculated. ; _item.name '_dssp_struct_summary.entry_id' _item.category dssp_struct_summary _item.mandatory_code yes _item_type.code code # _item_linked.child_name "_dssp_struct_summary.entry_id" _item_linked.parent_name "_entry.id" # save_ save__dssp_struct_summary.label_comp_id _item.description ; A component of the identifier for this monomer. This data item is a pointer to _chem_comp.id in the CHEM_COMP category. ; _item.name '_dssp_struct_summary.label_comp_id' _item.category dssp_struct_summary _item.mandatory_code yes _item_type.code ucode save_ save__dssp_struct_summary.label_asym_id _item.description ; A component of the identifier for this monomer ; _item.name '_dssp_struct_summary.label_asym_id' _item.category dssp_struct_summary _item.mandatory_code yes _item_type.code code save_ save__dssp_struct_summary.label_seq_id _item.description ; A component of the identifier for this monomer ; _item.name '_dssp_struct_summary.label_seq_id' _item.category dssp_struct_summary _item.mandatory_code yes _item_type.code code save_ save__dssp_struct_summary.secondary_structure _item.description ; The secondary structure assigned to this residue in a single letter code The value for this field may be empty in which case the assigned secondary structure is Loop. ; _item.name '_dssp_struct_summary.secondary_structure' _item.category dssp_struct_summary _item.mandatory_code no _item_type.code code loop_ _item_enumeration.value _item_enumeration.detail H Alphahelix B Betabridge E Strand G Helix_3 I Helix_5 P Helix_PPII T Turn S Bend save_ save__dssp_struct_summary.ss_bridge _item.description ; Identifier for the SS-Bridge formed by this residue ; _item.name '_dssp_struct_summary.ss_bridge' _item.category dssp_struct_summary _item.mandatory_code no _item_type.code int save_ save__dssp_struct_summary.helix_3_10 _item.description ; In case this residue is a candidate to form a 3_10 helix, this field contains the position of the residue in the helix. ; _item.name '_dssp_struct_summary.helix_3_10' _item.category dssp_struct_summary _item.mandatory_code no _item_type.code code loop_ _item_enumeration.value _item_enumeration.detail '>' 'The residue has h-bond(s) is a candidate to start a 3_10 helix' '3' 'The residue has h-bond(s) is a candidate to be within a 3_10 helix' '<' 'The residue has h-bond(s) is a candidate to end a 3_10 helix' 'X' 'The residue has h-bond(s) is a candidate for both a start and an end of a 3_10 helix' save_ save__dssp_struct_summary.helix_alpha _item.description ; In case this residue is a candidate to form a alpha helix, this field contains the position of the residue in the helix. ; _item.name '_dssp_struct_summary.helix_alpha' _item.category dssp_struct_summary _item.mandatory_code no _item_type.code code loop_ _item_enumeration.value _item_enumeration.detail '>' 'The residue has h-bond(s) is a candidate to start a alpha helix' '4' 'The residue has h-bond(s) is a candidate to be within a alpha helix' '<' 'The residue has h-bond(s) is a candidate to end a alpha helix' 'X' 'The residue has h-bond(s) is a candidate for both a start and an end of a alpha helix' save_ save__dssp_struct_summary.helix_pi _item.description ; In case this residue is a candidate to form a pi helix, this field contains the position of the residue in the helix. ; _item.name '_dssp_struct_summary.helix_pi' _item.category dssp_struct_summary _item.mandatory_code no _item_type.code code loop_ _item_enumeration.value _item_enumeration.detail '>' 'The residue has h-bond(s) is a candidate to start a pi helix' '5' 'The residue has h-bond(s) is a candidate to be within a pi helix' '<' 'The residue has h-bond(s) is a candidate to end a pi helix' 'X' 'The residue has h-bond(s) is a candidate for both a start and an end of a pi helix' save_ save__dssp_struct_summary.helix_pp _item.description ; In case this residue is a candidate to form a poly-proline helix, this field contains the position of the residue in the helix. ; _item.name '_dssp_struct_summary.helix_pp' _item.category dssp_struct_summary _item.mandatory_code no _item_type.code code loop_ _item_enumeration.value _item_enumeration.detail '>' 'The residue has h-bond(s) is a candidate to start a poly-proline helix' 'P' 'The residue has h-bond(s) is a candidate to be within a poly-proline helix' '<' 'The residue has h-bond(s) is a candidate to end a poly-proline helix' 'X' 'The residue has h-bond(s) is a candidate for both a start and an end of a poly-proline helix' save_ save__dssp_struct_summary.bend _item.description ; If this field contains S this indicates that the assigned secondary structure Turn actually forms a Bend. ; _item.name '_dssp_struct_summary.bend' _item.category dssp_struct_summary _item.mandatory_code no _item_type.code code _item_enumeration.value S _item_enumeration.detail 'The residue forms a Bend' save_ save__dssp_struct_summary.chirality _item.description ; The chirality for the virtual torsion angle (dihedral angle) defined by the four C-alpha atoms of residues I-1, I, I+1 and I+2. ; _item.name '_dssp_struct_summary.chirality' _item.category dssp_struct_summary _item.mandatory_code no _item_type.code code loop_ _item_enumeration.value '+' '-' save_ save__dssp_struct_summary.sheet _item.description ; This data item is a pointer to _struct_sheet.id in the STRUCT_SHEET category. ; _item.name '_dssp_struct_summary.sheet' _item.category dssp_struct_summary _item.mandatory_code no _item_type.code code save_ save__dssp_struct_summary.strand _item.description ; This data item is a pointer to _struct_sheet_range.id in the STRUCT_SHEET_RANGE category. ; _item.name '_dssp_struct_summary.strand' _item.category dssp_struct_summary _item.mandatory_code no _item_type.code code save_ save__dssp_struct_summary.ladder_1 _item.description ; Label for the first beta bridge of which this residue is part. ; _item.name '_dssp_struct_summary.ladder_1' _item.category dssp_struct_summary _item.mandatory_code no _item_type.code code save_ save__dssp_struct_summary.ladder_2 _item.description ; Label for the second beta bridge of which this residue is part. ; _item.name '_dssp_struct_summary.ladder_2' _item.category dssp_struct_summary _item.mandatory_code no _item_type.code code save_ save__dssp_struct_summary.accessibility _item.description ; Solvent accessibility for this residue in square Angstroms ; _item.name '_dssp_struct_summary.accessibility' _item.category dssp_struct_summary _item.mandatory_code no _item_type.code float save_ save__dssp_struct_summary.TCO _item.description ; The cosine of the angle between C=O of residue I and C=O of residue I-1. For alpha-helices, TCO is near +1, for Beta-sheets TCO is near -1. Not used for structure definition. ; _item.name '_dssp_struct_summary.TCO' _item.category dssp_struct_summary _item.mandatory_code no _item_type.code float save_ save__dssp_struct_summary.kappa _item.description ; The virtual bond angle (bend angle) defined by the three C-alpha atoms of residues I-2, I and I+2. Used to define bend (structure code 'S'). ; _item.name '_dssp_struct_summary.kappa' _item.category dssp_struct_summary _item.mandatory_code no _item_type.code float save_ save__dssp_struct_summary.alpha _item.description ; The virtual torsion angle (dihedral angle) defined by the four C-alpha atoms of residues I-1, I, I+1 and I+2. Used to define chirality (structure code '+' or '-'). ; _item.name '_dssp_struct_summary.alpha' _item.category dssp_struct_summary _item.mandatory_code no _item_type.code float save_ save__dssp_struct_summary.phi _item.description ; IUPAC peptide backbone torsion phi angle ; _item.name '_dssp_struct_summary.phi' _item.category dssp_struct_summary _item.mandatory_code no _item_type.code float save_ save__dssp_struct_summary.psi _item.description ; IUPAC peptide backbone torsion psi angle ; _item.name '_dssp_struct_summary.psi' _item.category dssp_struct_summary _item.mandatory_code no _item_type.code float save_ save__dssp_struct_summary.x_ca _item.description ; The x coordinate of the C-alpha atom for this residue ; _item.name '_dssp_struct_summary.x_ca' _item.category dssp_struct_summary _item.mandatory_code no _item_type.code float save_ save__dssp_struct_summary.y_ca _item.description ; The y coordinate of the C-alpha atom for this residue ; _item.name '_dssp_struct_summary.y_ca' _item.category dssp_struct_summary _item.mandatory_code no _item_type.code float save_ save__dssp_struct_summary.z_ca _item.description ; The z coordinate of the C-alpha atom for this residue ; _item.name '_dssp_struct_summary.z_ca' _item.category dssp_struct_summary _item.mandatory_code no _item_type.code float save_ PDB-REDO-dssp-ca06797/libdssp/src/000077500000000000000000000000001516741327300164175ustar00rootroot00000000000000PDB-REDO-dssp-ca06797/libdssp/src/dssp-io.cpp000066400000000000000000000740221516741327300205060ustar00rootroot00000000000000/*- * SPDX-License-Identifier: BSD-2-Clause * * Copyright (c) 2020 NKI/AVL, Netherlands Cancer Institute * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions are met: * * 1. Redistributions of source code must retain the above copyright notice, this * list of conditions and the following disclaimer * 2. Redistributions in binary form must reproduce the above copyright notice, * this list of conditions and the following disclaimer in the documentation * and/or other materials provided with the distribution. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS "AS IS" AND * ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED * WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE * DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS BE LIABLE FOR * ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES * (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; * LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND * ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT * (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS * SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. */ #include "dssp-io.hpp" #include "cif++/category.hpp" #include "cif++/item.hpp" #include "cif++/validate.hpp" #include "revision.hpp" #include #include #include #include #include #include #include // -------------------------------------------------------------------- std::string ResidueToDSSPLine(const dssp::residue_info &info) { /* This is the header line for the residue lines in a DSSP file: # RESIDUE AA STRUCTURE BP1 BP2 ACC N-H-->O O-->H-N N-H-->O O-->H-N TCO KAPPA ALPHA PHI PSI X-CA Y-CA Z-CA */ // auto& residue = info.residue(); auto &residue = info; if (residue.pdb_strand_id().length() > 1) throw std::runtime_error("This file contains data that won't fit in the original DSSP format"); char code = residue.compound_letter(); if (code == 'C') // a cysteine { auto ssbridgenr = info.ssBridgeNr(); if (ssbridgenr) code = 'a' + ((ssbridgenr - 1) % 26); } char ss = ' '; switch (info.type()) { case dssp::structure_type::Alphahelix: ss = 'H'; break; case dssp::structure_type::Betabridge: ss = 'B'; break; case dssp::structure_type::Strand: ss = 'E'; break; case dssp::structure_type::Helix_3: ss = 'G'; break; case dssp::structure_type::Helix_5: ss = 'I'; break; case dssp::structure_type::Helix_PPII: ss = 'P'; break; case dssp::structure_type::Turn: ss = 'T'; break; case dssp::structure_type::Bend: ss = 'S'; break; case dssp::structure_type::Loop: ss = ' '; break; } char helix[4] = { ' ', ' ', ' ', ' ' }; for (dssp::helix_type helixType : { dssp::helix_type::_3_10, dssp::helix_type::alpha, dssp::helix_type::pi, dssp::helix_type::pp }) { switch (info.helix(helixType)) { case dssp::helix_position_type::None: helix[static_cast(helixType)] = ' '; break; case dssp::helix_position_type::Start: helix[static_cast(helixType)] = '>'; break; case dssp::helix_position_type::End: helix[static_cast(helixType)] = '<'; break; case dssp::helix_position_type::StartAndEnd: helix[static_cast(helixType)] = 'X'; break; case dssp::helix_position_type::Middle: helix[static_cast(helixType)] = (helixType == dssp::helix_type::pp ? 'P' : static_cast('3' + static_cast(helixType))); break; } } char bend = ' '; if (info.bend()) bend = 'S'; double alpha = residue.alpha().value_or(360); char chirality = alpha == 360 ? ' ' : (alpha < 0 ? '-' : '+'); uint32_t bp[2] = {}; char bridgelabel[2] = { ' ', ' ' }; for (uint32_t i : { 0, 1 }) { const auto &[p, ladder, parallel] = info.bridge_partner(i); if (not p) continue; bp[i] = p.nr() % 10000; // won't fit otherwise... bridgelabel[i] = (parallel ? 'a' : 'A') + ladder % 26; } char sheet = ' '; if (info.sheet() != 0) sheet = 'A' + (info.sheet() - 1) % 26; std::string NHO[2], ONH[2]; for (int i : { 0, 1 }) { const auto &[donor, donorE] = info.donor(i); const auto &[acceptor, acceptorE] = info.acceptor(i); NHO[i] = ONH[i] = "0, 0.0"; if (acceptor) { auto d = acceptor.nr() - info.nr(); NHO[i] = std::format("{:d},{:3.1f}", d, acceptorE); } if (donor) { auto d = donor.nr() - info.nr(); ONH[i] = std::format("{:d},{:3.1f}", d, donorE); } } // auto ca = residue.atomByID("CA"); auto const &[cax, cay, caz] = residue.ca_location(); return std::format("{:5d}{:5d}{:1.1s}{:1.1s} {:1c} {:1c}{:1c}{:1c}{:1c}{:1c}{:1c}{:1c}{:1c}{:1c}{:4d}{:4d}{:1c}{:4.0f} {:>11s}{:>11s}{:>11s}{:>11s} {:6.3f}{:6.1f}{:6.1f}{:6.1f}{:6.1f} {:6.1f} {:6.1f} {:6.1f}", info.nr(), residue.pdb_seq_num(), residue.pdb_ins_code(), residue.pdb_strand_id(), code, ss, helix[3], helix[0], helix[1], helix[2], bend, chirality, bridgelabel[0], bridgelabel[1], bp[0], bp[1], sheet, floor(info.accessibility() + 0.5), NHO[0], ONH[0], NHO[1], ONH[1], residue.tco().value_or(0), residue.kappa().value_or(360), residue.alpha().value_or(360), residue.phi().value_or(360), residue.psi().value_or(360), cax, cay, caz); } void writeDSSP(const dssp &dssp, std::ostream &os) { using namespace std::chrono; auto stats = dssp.get_statistics(); std::time_t today = system_clock::to_time_t(system_clock::now()); std::tm *tm = std::gmtime(&today); std::string version = klibdsspVersionNumber; if (version.length() < 10) version.insert(version.end(), 10 - version.length(), ' '); os << "==== Secondary Structure Definition by the program DSSP, NKI version " << version << " ==== DATE=" << std::put_time(tm, "%F") << " .\n" << "REFERENCE M.L. HEKKELMAN ET AL, PROTEIN SCIENCE 34.8 (2025) e70208; W. KABSCH AND C.SANDER, BIOPOLYMERS 22 (1983) 2577-2637    .\n" << dssp.get_pdb_header_line(dssp::pdb_record_type::HEADER) << ".\n" << dssp.get_pdb_header_line(dssp::pdb_record_type::COMPND) << ".\n" << dssp.get_pdb_header_line(dssp::pdb_record_type::SOURCE) << ".\n" << dssp.get_pdb_header_line(dssp::pdb_record_type::AUTHOR) << ".\n"; os << std::format("{:5d}{:3d}{:3d}{:3d}{:3d} TOTAL NUMBER OF RESIDUES, NUMBER OF CHAINS, NUMBER OF SS-BRIDGES(TOTAL,INTRACHAIN,INTERCHAIN) .", stats.count.residues, stats.count.chains, stats.count.SS_bridges, stats.count.intra_chain_SS_bridges, (stats.count.SS_bridges - stats.count.intra_chain_SS_bridges)) << '\n'; os << std::format("{:8.1f} ACCESSIBLE SURFACE OF PROTEIN (ANGSTROM**2) .", stats.accessible_surface) << '\n'; // hydrogenbond summary os << std::format("{:5d}{:5.1f} TOTAL NUMBER OF HYDROGEN BONDS OF TYPE O(I)-->H-N(J) , SAME NUMBER PER 100 RESIDUES .", stats.count.H_bonds, (stats.count.H_bonds * 100.0 / stats.count.residues)) << '\n'; os << std::format("{:5d}{:5.1f} TOTAL NUMBER OF HYDROGEN BONDS IN PARALLEL BRIDGES, SAME NUMBER PER 100 RESIDUES .", stats.count.H_bonds_in_parallel_bridges, (stats.count.H_bonds_in_parallel_bridges * 100.0 / stats.count.residues)) << '\n'; os << std::format("{:5d}{:5.1f} TOTAL NUMBER OF HYDROGEN BONDS IN ANTIPARALLEL BRIDGES, SAME NUMBER PER 100 RESIDUES .", stats.count.H_bonds_in_antiparallel_bridges, (stats.count.H_bonds_in_antiparallel_bridges * 100.0 / stats.count.residues)) << '\n'; for (int k = 0; k < 11; ++k) os << std::format("{:5d}{:5.1f} TOTAL NUMBER OF HYDROGEN BONDS OF TYPE O(I)-->H-N(I{:1c}{:1d}), SAME NUMBER PER 100 RESIDUES .", stats.count.H_Bonds_per_distance[k], (stats.count.H_Bonds_per_distance[k] * 100.0 / stats.count.residues), (k - 5 < 0 ? '-' : '+'), abs(k - 5)) << '\n'; // histograms... os << " 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 *** HISTOGRAMS OF *** .\n"; for (auto hi : stats.histogram.residues_per_alpha_helix) os << std::format("{:3d}", hi); os << " RESIDUES PER ALPHA HELIX .\n"; for (auto hi : stats.histogram.parallel_bridges_per_ladder) os << std::format("{:3d}", hi); os << " PARALLEL BRIDGES PER LADDER .\n"; for (auto hi : stats.histogram.antiparallel_bridges_per_ladder) os << std::format("{:3d}", hi); os << " ANTIPARALLEL BRIDGES PER LADDER .\n"; for (auto hi : stats.histogram.ladders_per_sheet) os << std::format("{:3d}", hi); os << " LADDERS PER SHEET .\n"; // per residue information os << " # RESIDUE AA STRUCTURE BP1 BP2 ACC N-H-->O O-->H-N N-H-->O O-->H-N TCO KAPPA ALPHA PHI PSI X-CA Y-CA Z-CA\n"; int last = 0; for (auto ri : dssp) { // insert a break line whenever we detect missing residues // can be the transition to a different chain, or missing residues in the current chain if (ri.nr() != last + 1) os << std::format("{:5d} !{:1c} 0 0 0 0, 0.0 0, 0.0 0, 0.0 0, 0.0 0.000 360.0 360.0 360.0 360.0 0.0 0.0 0.0", (last + 1), (ri.chain_break() == dssp::chain_break_type::NewChain ? '*' : ' ')) << '\n'; os << ResidueToDSSPLine(ri) << '\n'; last = ri.nr(); } } // -------------------------------------------------------------------- void writeBridgePairs(cif::datablock &db, const dssp &dssp) { auto &hb = db["dssp_struct_bridge_pairs"]; hb.add_item("id"); hb.add_item("label_comp_id"); hb.add_item("label_seq_id"); hb.add_item("label_asym_id"); hb.add_item("auth_seq_id"); hb.add_item("auth_asym_id"); hb.add_item("pdbx_PDB_ins_code"); // force right order for (std::string da : { "acceptor_", "donor_" }) { for (std::string i : { "1_", "2_" }) { for (std::string n : { "label_comp_id", "label_seq_id", "label_asym_id", "auth_seq_id", "auth_asym_id", "pdbx_PDB_ins_code", "energy" }) hb.add_item(da + i + n); } } for (auto &res : dssp) { cif::row_initializer data({ { "id", hb.get_unique_id("") }, { "label_comp_id", res.compound_id() }, { "label_seq_id", res.seq_id() }, { "label_asym_id", res.asym_id() }, // { "auth_comp_id", res.compound_id() }, { "auth_seq_id", res.auth_seq_id() }, { "auth_asym_id", res.auth_asym_id() }, { "pdbx_PDB_ins_code", res.pdb_ins_code() } }); for (int i : { 0, 1 }) { const auto &&[acceptor, acceptorEnergy] = res.acceptor(i); const auto &&[donor, donorEnergy] = res.donor(i); if (acceptor) { if (i == 0) { data.emplace_back("acceptor_1_label_comp_id", acceptor.compound_id()); data.emplace_back("acceptor_1_label_seq_id", acceptor.seq_id()); data.emplace_back("acceptor_1_label_asym_id", acceptor.asym_id()); // data.emplace_back("acceptor_1_auth_comp_id", acceptor.compound_id()); data.emplace_back("acceptor_1_auth_seq_id", acceptor.auth_seq_id()); data.emplace_back("acceptor_1_auth_asym_id", acceptor.auth_asym_id()); data.emplace_back("acceptor_1_pdbx_PDB_ins_code", acceptor.pdb_ins_code()); data.emplace_back("acceptor_1_energy", { acceptorEnergy, 1 }); } else { data.emplace_back("acceptor_2_label_comp_id", acceptor.compound_id()); data.emplace_back("acceptor_2_label_seq_id", acceptor.seq_id()); data.emplace_back("acceptor_2_label_asym_id", acceptor.asym_id()); // data.emplace_back("acceptor_2_auth_comp_id", acceptor.compound_id()); data.emplace_back("acceptor_2_auth_seq_id", acceptor.auth_seq_id()); data.emplace_back("acceptor_2_auth_asym_id", acceptor.auth_asym_id()); data.emplace_back("acceptor_2_pdbx_PDB_ins_code", acceptor.pdb_ins_code()); data.emplace_back("acceptor_2_energy", { acceptorEnergy, 1 }); } } if (donor) { if (i == 0) { data.emplace_back("donor_1_label_comp_id", donor.compound_id()); data.emplace_back("donor_1_label_seq_id", donor.seq_id()); data.emplace_back("donor_1_label_asym_id", donor.asym_id()); // data.emplace_back("donor_1_auth_comp_id", donor.compound_id()); data.emplace_back("donor_1_auth_seq_id", donor.auth_seq_id()); data.emplace_back("donor_1_auth_asym_id", donor.auth_asym_id()); data.emplace_back("donor_1_pdbx_PDB_ins_code", donor.pdb_ins_code()); data.emplace_back("donor_1_energy", { donorEnergy, 1 }); } else { data.emplace_back("donor_2_label_comp_id", donor.compound_id()); data.emplace_back("donor_2_label_seq_id", donor.seq_id()); data.emplace_back("donor_2_label_asym_id", donor.asym_id()); // data.emplace_back("donor_2_auth_comp_id", donor.compound_id()); data.emplace_back("donor_2_auth_seq_id", donor.auth_seq_id()); data.emplace_back("donor_2_auth_asym_id", donor.auth_asym_id()); data.emplace_back("donor_2_pdbx_PDB_ins_code", donor.pdb_ins_code()); data.emplace_back("donor_2_energy", { donorEnergy, 1 }); } } } hb.emplace(std::move(data)); } } void writeSheets(cif::datablock &db, const dssp &dssp) { using namespace cif::literals; using res_list = std::vector; // clean up old info first for (auto sheet_cat : { "struct_sheet", "struct_sheet_order", "struct_sheet_range", "struct_sheet_hbond", "pdbx_struct_sheet_hbond" }) std::erase_if(db, [sheet_cat](const cif::category &cat) { return cat.name() == sheet_cat; }); // create a list of strands, based on the SS info in DSSP. Store sheet number along with the strand. std::map, res_list> strands; std::set sheetNrs; for (auto &res : dssp) { if (res.type() != dssp::structure_type::Strand and res.type() != dssp::structure_type::Betabridge) continue; strands[{ res.sheet(), res.strand() }].emplace_back(res); sheetNrs.insert(res.sheet()); } // -------------------------------------------------------------------- auto &struct_sheet = db["struct_sheet"]; auto &struct_sheet_range = db["struct_sheet_range"]; for (int sheetNr : sheetNrs) { auto sheetID = cif::cif_id_for_number(sheetNr - 1); struct_sheet.emplace({ { "id", sheetID }, { "number_strands", std::count_if(strands.begin(), strands.end(), [nr = sheetNr](std::tuple, res_list> const &s) { const auto &[strandID, strand] = s; return strand.front().sheet() == nr; }) } }); for (auto &&[strandTuple, strand] : strands) { if (strand.front().sheet() != sheetNr) continue; std::string strandID = cif::cif_id_for_number(strand.front().strand() - 1); std::ranges::sort(strand, [](dssp::residue_info const &a, dssp::residue_info const &b) { return a.nr() < b.nr(); }); auto &beg = strand.front(); auto &end = strand.back(); struct_sheet_range.emplace({ { "sheet_id", sheetID }, { "id", strandID }, { "beg_label_comp_id", beg.compound_id() }, { "beg_label_asym_id", beg.asym_id() }, { "beg_label_seq_id", beg.seq_id() }, { "pdbx_beg_PDB_ins_code", beg.pdb_ins_code() }, { "end_label_comp_id", end.compound_id() }, { "end_label_asym_id", end.asym_id() }, { "end_label_seq_id", end.seq_id() }, { "pdbx_end_PDB_ins_code", end.pdb_ins_code() }, { "beg_auth_comp_id", beg.compound_id() }, { "beg_auth_asym_id", beg.auth_asym_id() }, { "beg_auth_seq_id", std::to_string(beg.auth_seq_id()) }, { "end_auth_comp_id", end.compound_id() }, { "end_auth_asym_id", end.auth_asym_id() }, { "end_auth_seq_id", std::to_string(end.auth_seq_id()) } }); } } } void writeLadders(cif::datablock &db, const dssp &dssp) { // Write out the DSSP ladders struct ladder_info { ladder_info(int label, int sheet, bool parallel, const dssp::residue_info &a, const dssp::residue_info &b) : ladder(label) , sheet(sheet) , parallel(parallel) , pairs({ { a, b } }) { } bool operator<(const ladder_info &rhs) const { return ladder < rhs.ladder; } int ladder; int sheet; bool parallel; std::vector> pairs; }; std::vector ladders; for (auto res : dssp) { for (int i : { 0, 1 }) { const auto &[p, ladder, parallel] = res.bridge_partner(i); if (not p) continue; bool is_new = true; for (auto &l : ladders) { if (l.ladder != ladder) continue; assert(l.parallel == parallel); if (std::ranges::find_if(l.pairs, [na = p.nr(), nb = res.nr()](const auto &p) { return p.first.nr() == na and p.second.nr() == nb; }) != l.pairs.end()) { is_new = false; break; } l.pairs.emplace_back(res, p); is_new = false; break; } if (not is_new) continue; ladders.emplace_back(ladder, res.sheet() - 1, parallel, res, p); } } std::ranges::sort(ladders, std::less<>()); auto &dssp_struct_ladder = db["dssp_struct_ladder"]; for (const auto &l : ladders) { const auto &[beg1, beg2] = l.pairs.front(); const auto &[end1, end2] = l.pairs.back(); dssp_struct_ladder.emplace({ { "id", cif::cif_id_for_number(l.ladder) }, { "sheet_id", cif::cif_id_for_number(l.sheet) }, { "range_id_1", cif::cif_id_for_number(beg1.strand() - 1) }, { "range_id_2", cif::cif_id_for_number(beg2.strand() - 1) }, { "type", l.parallel ? "parallel" : "anti-parallel" }, { "beg_1_label_comp_id", beg1.compound_id() }, { "beg_1_label_asym_id", beg1.asym_id() }, { "beg_1_label_seq_id", beg1.seq_id() }, { "pdbx_beg_1_PDB_ins_code", beg1.pdb_ins_code() }, { "end_1_label_comp_id", end1.compound_id() }, { "end_1_label_asym_id", end1.asym_id() }, { "end_1_label_seq_id", end1.seq_id() }, { "pdbx_end_1_PDB_ins_code", end1.pdb_ins_code() }, { "beg_1_auth_comp_id", beg1.compound_id() }, { "beg_1_auth_asym_id", beg1.auth_asym_id() }, { "beg_1_auth_seq_id", beg1.auth_seq_id() }, { "end_1_auth_comp_id", end1.compound_id() }, { "end_1_auth_asym_id", end1.auth_asym_id() }, { "end_1_auth_seq_id", end1.auth_seq_id() }, { "beg_2_label_comp_id", beg2.compound_id() }, { "beg_2_label_asym_id", beg2.asym_id() }, { "beg_2_label_seq_id", beg2.seq_id() }, { "pdbx_beg_2_PDB_ins_code", beg2.pdb_ins_code() }, { "end_2_label_comp_id", end2.compound_id() }, { "end_2_label_asym_id", end2.asym_id() }, { "end_2_label_seq_id", end2.seq_id() }, { "pdbx_end_2_PDB_ins_code", end2.pdb_ins_code() }, { "beg_2_auth_comp_id", beg2.compound_id() }, { "beg_2_auth_asym_id", beg2.auth_asym_id() }, { "beg_2_auth_seq_id", beg2.auth_seq_id() }, { "end_2_auth_comp_id", end2.compound_id() }, { "end_2_auth_asym_id", end2.auth_asym_id() }, { "end_2_auth_seq_id", end2.auth_seq_id() } }); } } void writeStatistics(cif::datablock &db, const dssp &dssp) { using namespace std::literals; auto stats = dssp.get_statistics(); auto &dssp_statistics = db["dssp_statistics"]; std::optional surface_accessibility; if (stats.accessible_surface > 0) surface_accessibility = stats.accessible_surface; auto stats_i = dssp_statistics.emplace({ { "entry_id", db.name() }, { "nr_of_residues", stats.count.residues }, { "nr_of_chains", stats.count.chains }, { "nr_of_ss_bridges_total", stats.count.SS_bridges }, { "nr_of_ss_bridges_intra_chain", stats.count.intra_chain_SS_bridges }, { "nr_of_ss_bridges_inter_chain", stats.count.SS_bridges - stats.count.intra_chain_SS_bridges }, { "accessible_surface_of_protein", { surface_accessibility, 2 } } }); auto &dssp_struct_hbonds = db["dssp_statistics_hbond"]; dssp_struct_hbonds.emplace({ { "entry_id", db.name() }, { "type", "O(I)-->H-N(J)" }, { "count", stats.count.H_bonds }, { "count_per_100", { stats.count.H_bonds * 100.0 / stats.count.residues, 1 } } }); dssp_struct_hbonds.emplace({ { "entry_id", db.name() }, { "type", "PARALLEL BRIDGES" }, { "count", stats.count.H_bonds_in_parallel_bridges }, { "count_per_100", { stats.count.H_bonds_in_parallel_bridges * 100.0 / stats.count.residues, 1 } } }); dssp_struct_hbonds.emplace({ { "entry_id", db.name() }, { "type", "ANTIPARALLEL BRIDGES" }, { "count", stats.count.H_bonds_in_antiparallel_bridges }, { "count_per_100", { stats.count.H_bonds_in_antiparallel_bridges * 100.0 / stats.count.residues, 1 } } }); for (int k = 0; k < 11; ++k) dssp_struct_hbonds.emplace({ { "entry_id", db.name() }, { "type", "O(I)-->H-N(I"s + (k - 5 < 0 ? '-' : '+') + std::to_string(abs(k - 5)) + ")" }, { "count", stats.count.H_Bonds_per_distance[k] }, { "count_per_100", { stats.count.H_Bonds_per_distance[k] * 100.0 / stats.count.residues, 1 } } }); auto &dssp_statistics_histogram = db["dssp_statistics_histogram"]; using histogram_data_type = std::tuple; for (const auto &[type, values] : std::vector{ { "residues_per_alpha_helix", stats.histogram.residues_per_alpha_helix }, { "parallel_bridges_per_ladder", stats.histogram.parallel_bridges_per_ladder }, { "antiparallel_bridges_per_ladder", stats.histogram.antiparallel_bridges_per_ladder }, { "ladders_per_sheet", stats.histogram.ladders_per_sheet } }) { auto hi = dssp_statistics_histogram.emplace({ { "entry_id", db.name() }, { "type", type }, { "1", values[0] }, { "2", values[1] }, { "3", values[2] }, { "4", values[3] }, { "5", values[4] }, { "6", values[5] }, { "7", values[6] }, { "8", values[7] }, { "9", values[8] }, { "10", values[9] }, { "11", values[10] }, { "12", values[11] }, { "13", values[12] }, { "14", values[13] }, { "15", values[14] }, { "16", values[15] }, { "17", values[16] }, { "18", values[17] }, { "19", values[18] }, { "20", values[19] }, { "21", values[20] }, { "22", values[21] }, { "23", values[22] }, { "24", values[23] }, { "25", values[24] }, { "26", values[25] }, { "27", values[26] }, { "28", values[27] }, { "29", values[28] }, { "30", values[29] }, }); } } void writeSummary(cif::datablock &db, const dssp &dssp) { bool writeAccessibility = dssp.get_statistics().accessible_surface > 0; // A approximation of the old format auto &dssp_struct_summary = db["dssp_struct_summary"]; // prime the category with the field labels we need, this is to ensure proper order in writing out the data. for (auto label : { "entry_id", "label_comp_id", "label_asym_id", "label_seq_id", "secondary_structure", "ss_bridge", "helix_3_10", "helix_alpha", "helix_pi", "helix_pp", "bend", "chirality", "sheet", "strand", "ladder_1", "ladder_2", "accessibility", "TCO", "kappa", "alpha", "phi", "psi", "x_ca", "y_ca", "z_ca" }) dssp_struct_summary.add_item(label); for (auto res : dssp) { /* This is the header line for the residue lines in a DSSP file: # RESIDUE AA STRUCTURE BP1 BP2 ACC N-H-->O O-->H-N N-H-->O O-->H-N TCO KAPPA ALPHA PHI PSI X-CA Y-CA Z-CA */ std::string ss_bridge = "."; if (res.ssBridgeNr() != 0) ss_bridge = std::to_string(res.ssBridgeNr()); std::string ss = { res.type() == dssp::structure_type::Loop ? '.' : static_cast(res.type()) }; std::string helix[4] = { ".", ".", ".", "." }; for (dssp::helix_type helixType : { dssp::helix_type::_3_10, dssp::helix_type::alpha, dssp::helix_type::pi, dssp::helix_type::pp }) { switch (res.helix(helixType)) { // case dssp::helix_position_type::None: helix[static_cast(helixType)] = ' '; break; case dssp::helix_position_type::Start: helix[static_cast(helixType)] = { '>' }; break; case dssp::helix_position_type::End: helix[static_cast(helixType)] = { '<' }; break; case dssp::helix_position_type::StartAndEnd: helix[static_cast(helixType)] = { 'X' }; break; case dssp::helix_position_type::Middle: if (helixType == dssp::helix_type::pp) helix[static_cast(helixType)] = { 'P' }; else helix[static_cast(helixType)] = { static_cast('3' + static_cast(helixType)) }; break; default: break; } } std::string bend = "."; if (res.bend()) bend = "S"; std::string chirality = "."; if (res.alpha().has_value()) chirality = *res.alpha() < 0 ? "-" : "+"; std::string ladders[2] = { ".", "." }; for (uint32_t i : { 0, 1 }) { const auto &[p, ladder, parallel] = res.bridge_partner(i); if (not p) continue; ladders[i] = cif::cif_id_for_number(ladder); } auto const &[cax, cay, caz] = res.ca_location(); cif::row_initializer data{ { "entry_id", db.name() }, { "label_comp_id", res.compound_id() }, { "label_asym_id", res.asym_id() }, { "label_seq_id", res.seq_id() }, { "secondary_structure", ss }, { "ss_bridge", ss_bridge }, { "helix_3_10", helix[0] }, { "helix_alpha", helix[1] }, { "helix_pi", helix[2] }, { "helix_pp", helix[3] }, { "bend", bend }, { "chirality", chirality }, { "sheet", res.sheet() ? cif::cif_id_for_number(res.sheet() - 1) : "." }, { "strand", res.strand() ? cif::cif_id_for_number(res.strand() - 1) : "." }, { "ladder_1", ladders[0] }, { "ladder_2", ladders[1] }, { "x_ca", { cax, 1 } }, { "y_ca", { cay, 1 } }, { "z_ca", { caz, 1 } }, }; if (writeAccessibility) data.emplace_back("accessibility", { res.accessibility(), 1 }); if (res.tco().has_value()) data.emplace_back("TCO", { *res.tco(), 3 }); else data.set_value("TCO", cif::item_value_type::INAPPLICABLE); if (res.kappa().has_value()) data.emplace_back("kappa", { *res.kappa(), 1 }); else data.set_value("kappa", cif::item_value_type::INAPPLICABLE); if (res.alpha().has_value()) data.emplace_back("alpha", { *res.alpha(), 1 }); else data.set_value("alpha", cif::item_value_type::INAPPLICABLE); if (res.phi().has_value()) data.emplace_back("phi", { *res.phi(), 1 }); else data.set_value("phi", cif::item_value_type::INAPPLICABLE); if (res.psi().has_value()) data.emplace_back("psi", { *res.psi(), 1 }); else data.set_value("psi", cif::item_value_type::INAPPLICABLE); dssp_struct_summary.emplace(std::move(data)); } } // Work around stupid change in signature of cif::validator_factory::get... template void fill_audit_conform(cif::category &audit_conform) { auto &cf = ValidatorFactory::instance(); if constexpr (std::is_pointer_v().get(""))>) cf.get("mmcif_pdbx.dic")->fill_audit_conform(audit_conform); else cf.get("mmcif_pdbx.dic").fill_audit_conform(audit_conform); } void annotateDSSP(cif::datablock &db, const dssp &dssp, bool writeOther, bool writeNewFormat) { using namespace std::literals; auto &audit_conform = db["audit_conform"]; if (audit_conform.empty()) fill_audit_conform(audit_conform); audit_conform.erase(cif::key("dict_name") == "dssp-extension.dic"); audit_conform.emplace({ // { "dict_name", "dssp-extension.dic" }, { "dict_version", "1.1.1" }, { "dict_location", "https://pdb-redo.eu/dssp/dssp-extension.dic" } }); // Re-load the dictionary db.load_dictionary(); if (dssp.empty()) { if (cif::VERBOSE > 0) std::cout << "No secondary structure information found\n"; } else { for (auto cat : std::initializer_list{ "dssp_struct_bridge_pairs", "dssp_struct_ladder", "dssp_statistics", "dssp_statistics_hbond", "dssp_statistics_histogram", "dssp_struct_summary" }) { std::erase_if(db, [cat](cif::category &c) { return c.name() == cat; }); } if (writeNewFormat) { writeBridgePairs(db, dssp); writeSheets(db, dssp); writeLadders(db, dssp); writeStatistics(db, dssp); writeSummary(db, dssp); } // replace all struct_conf and struct_conf_type records auto &structConfType = db["struct_conf_type"]; structConfType.clear(); auto &structConf = db["struct_conf"]; structConf.clear(); std::map foundTypes; auto st = dssp.begin(), lt = st; auto lastSS = st->type(); for (auto t = dssp.begin();; lt = t, ++t) { bool stop = t == dssp.end(); bool flush = (stop or t->type() != lastSS); if (flush and (writeOther or lastSS != dssp::structure_type::Loop)) { auto &rb = *st; auto &re = *lt; std::string id; switch (lastSS) { case dssp::structure_type::Helix_3: id = "HELX_RH_3T_P"; break; case dssp::structure_type::Alphahelix: id = "HELX_RH_AL_P"; break; case dssp::structure_type::Helix_5: id = "HELX_RH_PI_P"; break; case dssp::structure_type::Helix_PPII: id = "HELX_LH_PP_P"; break; case dssp::structure_type::Turn: id = "TURN_TY1_P"; break; case dssp::structure_type::Bend: id = "BEND"; break; case dssp::structure_type::Betabridge: case dssp::structure_type::Strand: id = "STRN"; break; case dssp::structure_type::Loop: id = "OTHER"; break; } if (foundTypes.count(id) == 0) { structConfType.emplace({ { "id", id }, { "criteria", "DSSP" } }); foundTypes[id] = 1; } structConf.emplace({ // { "conf_type_id", id }, { "id", id + std::to_string(foundTypes[id]++) }, { "pdbx_PDB_helix_id", cif::item_value_type::INAPPLICABLE }, { "beg_label_comp_id", rb.compound_id() }, { "beg_label_asym_id", rb.asym_id() }, { "beg_label_seq_id", rb.seq_id() }, { "pdbx_beg_PDB_ins_code", rb.pdb_ins_code() }, { "end_label_comp_id", re.compound_id() }, { "end_label_asym_id", re.asym_id() }, { "end_label_seq_id", re.seq_id() }, { "pdbx_end_PDB_ins_code", re.pdb_ins_code() }, { "beg_auth_comp_id", rb.compound_id() }, { "beg_auth_asym_id", rb.auth_asym_id() }, { "beg_auth_seq_id", std::to_string(rb.auth_seq_id()) }, { "end_auth_comp_id", re.compound_id() }, { "end_auth_asym_id", re.auth_asym_id() }, { "end_auth_seq_id", std::to_string(re.auth_seq_id()) } }); st = t; } if (stop) break; if (lastSS != t->type()) { st = t; lastSS = t->type(); } } } auto &software = db["software"]; software.emplace({ // { "pdbx_ordinal", software.get_unique_id("") }, { "name", "DSSP" }, { "version", klibdsspVersionNumber }, { "date", klibdsspRevisionDate }, { "classification", "model annotation" } }); } PDB-REDO-dssp-ca06797/libdssp/src/dssp-io.hpp000066400000000000000000000030771516741327300205150ustar00rootroot00000000000000/*- * SPDX-License-Identifier: BSD-2-Clause * * Copyright (c) 2020 NKI/AVL, Netherlands Cancer Institute * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions are met: * * 1. Redistributions of source code must retain the above copyright notice, this * list of conditions and the following disclaimer * 2. Redistributions in binary form must reproduce the above copyright notice, * this list of conditions and the following disclaimer in the documentation * and/or other materials provided with the distribution. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS "AS IS" AND * ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED * WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE * DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS BE LIABLE FOR * ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES * (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; * LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND * ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT * (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS * SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. */ #pragma once #include "dssp.hpp" void writeDSSP(const dssp& dssp, std::ostream& os); void annotateDSSP(cif::datablock &db, const dssp& dssp, bool writeOther, bool writeNewFormat); PDB-REDO-dssp-ca06797/libdssp/src/dssp.cpp000066400000000000000000001664701516741327300201120ustar00rootroot00000000000000/*- * SPDX-License-Identifier: BSD-2-Clause * * Copyright (c) 2020 NKI/AVL, Netherlands Cancer Institute * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions are met: * * 1. Redistributions of source code must retain the above copyright notice, this * list of conditions and the following disclaimer * 2. Redistributions in binary form must reproduce the above copyright notice, * this list of conditions and the following disclaimer in the documentation * and/or other materials provided with the distribution. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS "AS IS" AND * ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED * WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE * DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS BE LIABLE FOR * ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES * (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; * LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND * ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT * (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS * SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. */ // Calculate DSSP-like secondary structure information #include "dssp.hpp" #include "dssp-io.hpp" #include #include #include #include #include #include #include #ifdef near # undef near #endif using residue = dssp::residue; using statistics = dssp::statistics; using structure_type = dssp::structure_type; using helix_type = dssp::helix_type; using helix_position_type = dssp::helix_position_type; using chain_break_type = dssp::chain_break_type; // -------------------------------------------------------------------- const double kPI = std::numbers::pi; struct point { float mX, mY, mZ; }; inline point operator-(const point &lhs, const point &rhs) { return { lhs.mX - rhs.mX, lhs.mY - rhs.mY, lhs.mZ - rhs.mZ }; } inline point operator*(const point &lhs, float rhs) { return { lhs.mX * rhs, lhs.mY * rhs, lhs.mZ * rhs }; } inline float distance_sq(const point &a, const point &b) { return (a.mX - b.mX) * (a.mX - b.mX) + (a.mY - b.mY) * (a.mY - b.mY) + (a.mZ - b.mZ) * (a.mZ - b.mZ); } inline float distance(const point &a, const point &b) { return std::sqrt(distance_sq(a, b)); } inline float dot_product(const point &a, const point &b) { return a.mX * b.mX + a.mY * b.mY + a.mZ * b.mZ; } inline point cross_product(const point &a, const point &b) { return { a.mY * b.mZ - b.mY * a.mZ, a.mZ * b.mX - b.mZ * a.mX, a.mX * b.mY - b.mX * a.mY }; } float dihedral_angle(const point &p1, const point &p2, const point &p3, const point &p4) { point v12 = p1 - p2; // vector from p2 to p1 point v43 = p4 - p3; // vector from p3 to p4 point z = p2 - p3; // vector from p3 to p2 point p = cross_product(z, v12); point x = cross_product(z, v43); point y = cross_product(z, x); float u = dot_product(x, x); float v = dot_product(y, y); float result = 360; if (u > 0 and v > 0) { u = dot_product(p, x) / std::sqrt(u); v = dot_product(p, y) / std::sqrt(v); if (u != 0 or v != 0) result = std::atan2(v, u) * 180.f / static_cast(kPI); } return result; } float cosinus_angle(const point &p1, const point &p2, const point &p3, const point &p4) { point v12 = p1 - p2; point v34 = p3 - p4; float result = 0; float x = dot_product(v12, v12) * dot_product(v34, v34); if (x > 0) result = dot_product(v12, v34) / std::sqrt(x); return result; } enum residue_type : char { kUnknownResidue = 'X', // kAlanine = 'A', // ala kArginine = 'R', // arg kAsparagine = 'N', // asn kAsparticAcid = 'D', // asp kCysteine = 'C', // cys kGlutamicAcid = 'E', // glu kGlutamine = 'Q', // gln kGlycine = 'G', // gly kHistidine = 'H', // his kIsoleucine = 'I', // ile kLeucine = 'L', // leu kLysine = 'K', // lys kMethionine = 'M', // met kPhenylalanine = 'F', // phe kProline = 'P', // pro kSerine = 'S', // ser kThreonine = 'T', // thr kTryptophan = 'W', // trp kTyrosine = 'Y', // tyr kValine = 'V', // val }; struct { residue_type type; char name[4]; } const kResidueInfo[] = { { kUnknownResidue, "UNK" }, { kAlanine, "ALA" }, { kArginine, "ARG" }, { kAsparagine, "ASN" }, { kAsparticAcid, "ASP" }, { kCysteine, "CYS" }, { kGlutamicAcid, "GLU" }, { kGlutamine, "GLN" }, { kGlycine, "GLY" }, { kHistidine, "HIS" }, { kIsoleucine, "ILE" }, { kLeucine, "LEU" }, { kLysine, "LYS" }, { kMethionine, "MET" }, { kPhenylalanine, "PHE" }, { kProline, "PRO" }, { kSerine, "SER" }, { kThreonine, "THR" }, { kTryptophan, "TRP" }, { kTyrosine, "TYR" }, { kValine, "VAL" } }; constexpr residue_type MapResidue(std::string_view inName) { residue_type result = kUnknownResidue; for (auto &ri : kResidueInfo) { if (inName == ri.name) { result = ri.type; break; } } return result; } struct HBond { residue *res; double energy; }; enum class bridge_type { None, Parallel, AntiParallel }; struct bridge { bridge_type type; uint32_t sheet, ladder; std::set link; std::deque i, j; std::string chainI, chainJ; bool operator<(const bridge &b) const { return chainI < b.chainI or (chainI == b.chainI and i.front() < b.i.front()); } }; struct bridge_partner { residue *m_residue; uint32_t ladder; bool parallel; }; // -------------------------------------------------------------------- const float // kSSBridgeDistance = 3.0f, kMinimalDistance = 0.5f, kMinimalCADistance = 9.0f, kMinHBondEnergy = -9.9f, kMaxHBondEnergy = -0.5f, kCouplingConstant = -27.888f, // = -332 * 0.42 * 0.2 kMaxPeptideBondLength = 2.5f; const float kRadiusN = 1.65f, kRadiusCA = 1.87f, kRadiusC = 1.76f, kRadiusO = 1.4f, kRadiusSideAtom = 1.8f, kRadiusWater = 1.4f; struct dssp::residue { residue(residue &&) = default; residue &operator=(residue &&) = default; residue(int model_nr, std::string_view pdb_strand_id, int pdb_seq_num, std::string_view pdb_ins_code) : mPDBStrandID(pdb_strand_id) , mPDBSeqNum(pdb_seq_num) , mPDBInsCode(pdb_ins_code) , m_model_nr(model_nr) { // update the box containing all atoms mBox[0].mX = mBox[0].mY = mBox[0].mZ = std::numeric_limits::max(); mBox[1].mX = mBox[1].mY = mBox[1].mZ = -std::numeric_limits::max(); mH = point{ std::numeric_limits::max(), std::numeric_limits::max(), std::numeric_limits::max() }; for (auto &p : m_chiralAtoms) p = {}; } void addAtom(cif::const_row_handle atom) { std::string asymID, compID, atomID, type, authAsymID; std::optional altID; int seqID, authSeqID; std::optional model; float x, y, z; cif::tie(asymID, compID, atomID, altID, type, seqID, model, x, y, z, authAsymID, authSeqID) = atom.get("label_asym_id", "label_comp_id", "label_atom_id", "label_alt_id", "type_symbol", "label_seq_id", "pdbx_PDB_model_num", "Cartn_x", "Cartn_y", "Cartn_z", "auth_asym_id", "auth_seq_id"); if (model and model != m_model_nr) return; if (m_seen == 0) { mAsymID = asymID; mCompoundID = compID; mSeqID = seqID; mAuthSeqID = authSeqID; mAuthAsymID = authAsymID; mType = MapResidue(mCompoundID); if (altID) mAltID = *altID; } if (atomID == "CA") { m_seen |= 1; mCAlpha = { x, y, z }; ExtendBox(mCAlpha, kRadiusCA + 2 * kRadiusWater); if (mType == kValine) m_chiralAtoms[1] = mCAlpha; } else if (atomID == "C") { m_seen |= 2; mC = { x, y, z }; ExtendBox(mC, kRadiusC + 2 * kRadiusWater); } else if (atomID == "N") { m_seen |= 4; mH = mN = { x, y, z }; ExtendBox(mN, kRadiusN + 2 * kRadiusWater); } else if (atomID == "O") { m_seen |= 8; mO = { x, y, z }; ExtendBox(mO, kRadiusO + 2 * kRadiusWater); } else if (type != "H") { m_seen |= 16; mSideChain.emplace_back(atomID, point{ x, y, z }); ExtendBox(point{ x, y, z }, kRadiusSideAtom + 2 * kRadiusWater); if (mType == kLeucine) { if (atomID == "CG") m_chiralAtoms[0] = { x, y, z }; else if (atomID == "CB") m_chiralAtoms[1] = { x, y, z }; else if (atomID == "CD1") m_chiralAtoms[2] = { x, y, z }; else if (atomID == "CD2") m_chiralAtoms[3] = { x, y, z }; } else if (mType == kValine) { if (atomID == "CB") m_chiralAtoms[0] = { x, y, z }; else if (atomID == "CG1") m_chiralAtoms[2] = { x, y, z }; else if (atomID == "CG2") m_chiralAtoms[3] = { x, y, z }; } } } void finish() { const int kSeenAll = (1 bitor 2 bitor 4 bitor 8); mComplete = (m_seen bitand kSeenAll) == kSeenAll; if (mType == kValine or mType == kLeucine) mChiralVolume = dot_product(m_chiralAtoms[1] - m_chiralAtoms[0], cross_product(m_chiralAtoms[2] - m_chiralAtoms[0], m_chiralAtoms[3] - m_chiralAtoms[0])); mRadius = mBox[1].mX - mBox[0].mX; if (mRadius < mBox[1].mY - mBox[0].mY) mRadius = mBox[1].mY - mBox[0].mY; if (mRadius < mBox[1].mZ - mBox[0].mZ) mRadius = mBox[1].mZ - mBox[0].mZ; mCenter.mX = (mBox[0].mX + mBox[1].mX) / 2; mCenter.mY = (mBox[0].mY + mBox[1].mY) / 2; mCenter.mZ = (mBox[0].mZ + mBox[1].mZ) / 2; } void assignHydrogen() { // assign the Hydrogen mH = mN; if (mType != kProline and mPrev != nullptr) { auto pc = mPrev->mC; auto po = mPrev->mO; auto CODistance = static_cast(distance(pc, po)); mH.mX += (pc.mX - po.mX) / CODistance; mH.mY += (pc.mY - po.mY) / CODistance; mH.mZ += (pc.mZ - po.mZ) / CODistance; } } void SetSecondaryStructure(structure_type inSS) { mSecondaryStructure = inSS; } [[nodiscard]] structure_type GetSecondaryStructure() const { return mSecondaryStructure; } void SetBetaPartner(uint32_t n, residue &inResidue, uint32_t inLadder, bool inParallel) { assert(n == 0 or n == 1); mBetaPartner[n].m_residue = &inResidue; mBetaPartner[n].ladder = inLadder; mBetaPartner[n].parallel = inParallel; } [[nodiscard]] bridge_partner GetBetaPartner(uint32_t n) const { assert(n == 0 or n == 1); return mBetaPartner[n]; } void SetSheet(uint32_t inSheet) { mSheet = inSheet; } [[nodiscard]] uint32_t GetSheet() const { return mSheet; } void SetStrand(uint32_t inStrand) { mStrand = inStrand; } [[nodiscard]] uint32_t GetStrand() const { return mStrand; } [[nodiscard]] bool IsBend() const { return mBend; } void SetBend(bool inBend) { mBend = inBend; } [[nodiscard]] helix_position_type GetHelixFlag(helix_type helixType) const { auto stride = static_cast(helixType); assert(stride < 4); return mHelixFlags[stride]; } [[nodiscard]] bool IsHelixStart(helix_type helixType) const { auto stride = static_cast(helixType); assert(stride < 4); return mHelixFlags[stride] == helix_position_type::Start or mHelixFlags[stride] == helix_position_type::StartAndEnd; } void SetHelixFlag(helix_type helixType, helix_position_type inHelixFlag) { auto stride = static_cast(helixType); assert(stride < 4); mHelixFlags[stride] = inHelixFlag; } void SetSSBridgeNr(uint8_t inBridgeNr) { if (mType != kCysteine) throw std::runtime_error("Only cysteine residues can form sulphur bridges"); mSSBridgeNr = inBridgeNr; } [[nodiscard]] uint8_t GetSSBridgeNr() const { if (mType != kCysteine) throw std::runtime_error("Only cysteine residues can form sulphur bridges"); return mSSBridgeNr; } float CalculateSurface(const std::vector &inResidues); float CalculateSurface(const point &inAtom, float inRadius, const std::vector &inNeighbours); [[nodiscard]] bool AtomIntersectsBox(const point &atom, float inRadius) const { return atom.mX + inRadius >= mBox[0].mX and atom.mX - inRadius <= mBox[1].mX and atom.mY + inRadius >= mBox[0].mY and atom.mY - inRadius <= mBox[1].mY and atom.mZ + inRadius >= mBox[0].mZ and atom.mZ - inRadius <= mBox[1].mZ; } void ExtendBox(const point &atom, float inRadius) { if (mBox[0].mX > atom.mX - inRadius) mBox[0].mX = atom.mX - inRadius; if (mBox[0].mY > atom.mY - inRadius) mBox[0].mY = atom.mY - inRadius; if (mBox[0].mZ > atom.mZ - inRadius) mBox[0].mZ = atom.mZ - inRadius; if (mBox[1].mX < atom.mX + inRadius) mBox[1].mX = atom.mX + inRadius; if (mBox[1].mY < atom.mY + inRadius) mBox[1].mY = atom.mY + inRadius; if (mBox[1].mZ < atom.mZ + inRadius) mBox[1].mZ = atom.mZ + inRadius; } point get_atom(std::string_view name) { if (name == "CA") return mCAlpha; else if (name == "C") return mC; else if (name == "N") return mN; else if (name == "O") return mO; else if (name == "H") return mH; else { for (const auto &[n, p] : mSideChain) { if (n == name) return p; } } return {}; } residue *mNext = nullptr; residue *mPrev = nullptr; // const Monomer &mM; std::string mAsymID; int mSeqID; std::string mCompoundID; std::string mAltID; int mNumber; bool mComplete = false; std::string mAuthAsymID; int mAuthSeqID; std::string mPDBStrandID; int mPDBSeqNum; std::string mPDBInsCode; point mCAlpha, mC, mN, mO, mH; point mBox[2] = {}; float mRadius; point mCenter; std::vector> mSideChain; float mAccessibility = 0; float mChiralVolume = 0; // float mAlpha = 360, mKappa = 360, mPhi = 360, mPsi = 360, mTCO = 0, mOmega = 360; std::optional mAlpha, mKappa, mPhi, mPsi, mTCO, mOmega; residue_type mType; uint8_t mSSBridgeNr = 0; structure_type mSecondaryStructure = structure_type::Loop; HBond mHBondDonor[2] = {}, mHBondAcceptor[2] = {}; bridge_partner mBetaPartner[2] = {}; uint32_t mSheet = 0; uint32_t mStrand = 0; // Added to ease the writing of mmCIF's struct_sheet and friends helix_position_type mHelixFlags[4] = { helix_position_type::None, helix_position_type::None, helix_position_type::None, helix_position_type::None }; // bool mBend = false; chain_break_type mChainBreak = chain_break_type::None; int m_seen = 0, m_model_nr = 0; std::array m_chiralAtoms; }; // -------------------------------------------------------------------- class accumulator { public: struct candidate { point location; double radius; double distance; auto operator<=>(const candidate &rhs) const { return distance <=> rhs.distance; } }; void operator()(const point &a, const point &b, double d, double r) { double distance = distance_sq(a, b); d += kRadiusWater; r += kRadiusWater; double test = d + r; test *= test; if (distance < test and distance > 0.0001) { candidate c = { b - a, r * r, distance }; m_x.push_back(c); std::ranges::push_heap(m_x, std::less<>()); } } void sort() { std::ranges::sort_heap(m_x, std::less<>()); } std::vector m_x; }; // we use a fibonacci sphere to calculate the even distribution of the dots class MSurfaceDots { public: static MSurfaceDots &Instance(); [[nodiscard]] size_t size() const { return mPoints.size(); } const point &operator[](size_t inIx) const { return mPoints[inIx]; } [[nodiscard]] double weight() const { return mWeight; } private: MSurfaceDots(int32_t inN); std::vector mPoints; double mWeight; }; MSurfaceDots &MSurfaceDots::Instance() { const int32_t kN = 200; static MSurfaceDots sInstance(kN); return sInstance; } MSurfaceDots::MSurfaceDots(int32_t N) { auto P = 2 * N + 1; const float kGoldenRatio = std::numbers::phi_v; mWeight = (4 * kPI) / P; for (auto i = -N; i <= N; ++i) { float lat = std::asin((2.0f * i) / P); auto lon = static_cast(std::fmod(i, kGoldenRatio) * 2 * kPI / kGoldenRatio); mPoints.emplace_back(point{ std::sin(lon) * std::cos(lat), std::cos(lon) * std::cos(lat), std::sin(lat) }); } } float residue::CalculateSurface(const point &inAtom, float inRadius, const std::vector &inNeighbours) { accumulator accumulate; for (auto r : inNeighbours) { if (r->AtomIntersectsBox(inAtom, inRadius)) { accumulate(inAtom, r->mN, inRadius, kRadiusN); accumulate(inAtom, r->mCAlpha, inRadius, kRadiusCA); accumulate(inAtom, r->mC, inRadius, kRadiusC); accumulate(inAtom, r->mO, inRadius, kRadiusO); for (const auto &[name, atom] : r->mSideChain) accumulate(inAtom, atom, inRadius, kRadiusSideAtom); } } accumulate.sort(); float radius = inRadius + kRadiusWater; float surface = 0; MSurfaceDots &surfaceDots = MSurfaceDots::Instance(); for (size_t i = 0; i < surfaceDots.size(); ++i) { point xx = surfaceDots[i] * radius; bool free = true; for (size_t k = 0; free and k < accumulate.m_x.size(); ++k) free = accumulate.m_x[k].radius < distance_sq(xx, accumulate.m_x[k].location); if (free) surface += static_cast(surfaceDots.weight()); } return surface * radius * radius; } float residue::CalculateSurface(const std::vector &inResidues) { std::vector neighbours; for (auto &r : inResidues) { point center = r.mCenter; float radius = r.mRadius; if (distance_sq(mCenter, center) < (mRadius + radius) * (mRadius + radius)) neighbours.push_back(const_cast(&r)); } mAccessibility = CalculateSurface(mN, kRadiusN, neighbours) + CalculateSurface(mCAlpha, kRadiusCA, neighbours) + CalculateSurface(mC, kRadiusC, neighbours) + CalculateSurface(mO, kRadiusO, neighbours); for (const auto &[name, atom] : mSideChain) mAccessibility += CalculateSurface(atom, kRadiusSideAtom, neighbours); return mAccessibility; } void CalculateAccessibilities(std::vector &inResidues, statistics &stats) { stats.accessible_surface = 0; for (auto &residue : inResidues) stats.accessible_surface += residue.CalculateSurface(inResidues); } // -------------------------------------------------------------------- // TODO: use the angle to improve bond energy calculation. double CalculateHBondEnergy(residue &inDonor, residue &inAcceptor) { double result = 0; if (inDonor.mType != kProline) { double distanceHO = distance(inDonor.mH, inAcceptor.mO); double distanceHC = distance(inDonor.mH, inAcceptor.mC); double distanceNC = distance(inDonor.mN, inAcceptor.mC); double distanceNO = distance(inDonor.mN, inAcceptor.mO); if (distanceHO < kMinimalDistance or distanceHC < kMinimalDistance or distanceNC < kMinimalDistance or distanceNO < kMinimalDistance) result = kMinHBondEnergy; else result = kCouplingConstant / distanceHO - kCouplingConstant / distanceHC + kCouplingConstant / distanceNC - kCouplingConstant / distanceNO; // DSSP compatibility mode: result = std::round(result * 1000) / 1000; if (result < kMinHBondEnergy) result = kMinHBondEnergy; } // update donor if (result < inDonor.mHBondAcceptor[0].energy) { inDonor.mHBondAcceptor[1] = inDonor.mHBondAcceptor[0]; inDonor.mHBondAcceptor[0].res = &inAcceptor; inDonor.mHBondAcceptor[0].energy = result; } else if (result < inDonor.mHBondAcceptor[1].energy) { inDonor.mHBondAcceptor[1].res = &inAcceptor; inDonor.mHBondAcceptor[1].energy = result; } // and acceptor if (result < inAcceptor.mHBondDonor[0].energy) { inAcceptor.mHBondDonor[1] = inAcceptor.mHBondDonor[0]; inAcceptor.mHBondDonor[0].res = &inDonor; inAcceptor.mHBondDonor[0].energy = result; } else if (result < inAcceptor.mHBondDonor[1].energy) { inAcceptor.mHBondDonor[1].res = &inDonor; inAcceptor.mHBondDonor[1].energy = result; } return result; } // -------------------------------------------------------------------- void CalculateHBondEnergies(std::vector &inResidues, std::vector> &q) { std::unique_ptr progress; if (cif::VERBOSE >= 0) progress = std::make_unique(q.size(), "calculate hbond energies"); for (const auto &[i, j] : q) { auto &ri = inResidues[i]; auto &rj = inResidues[j]; CalculateHBondEnergy(ri, rj); if (j != i + 1) CalculateHBondEnergy(rj, ri); if (progress) progress->consumed(1); } } // -------------------------------------------------------------------- bool NoChainBreak(const residue *a, const residue *b) { bool result = a->mAsymID == b->mAsymID; for (auto r = a; result and r != b; r = r->mNext) { auto next = r->mNext; if (next == nullptr) result = false; else result = next->mNumber == r->mNumber + 1; } return result; } bool NoChainBreak(const residue &a, const residue &b) { return NoChainBreak(&a, &b); } // -------------------------------------------------------------------- bool TestBond(const residue *a, const residue *b) { return (a->mHBondAcceptor[0].res == b and a->mHBondAcceptor[0].energy < kMaxHBondEnergy) or (a->mHBondAcceptor[1].res == b and a->mHBondAcceptor[1].energy < kMaxHBondEnergy); } bool test_bond(dssp::residue_info const &a, dssp::residue_info const &b) { return a and b and TestBond(a.m_impl, b.m_impl); } // -------------------------------------------------------------------- bridge_type TestBridge(const residue &r1, const residue &r2) { // I. a d II. a d parallel auto a = r1.mPrev; // \ / auto b = &r1; // b e b e auto c = r1.mNext; // / \ .. auto d = r2.mPrev; // c f c f auto e = &r2; // auto f = r2.mNext; // III. a <- f IV. a f antiparallel // bridge_type result = bridge_type::None; // b e b <-> e // // c -> d c d if (a and c and NoChainBreak(a, c) and d and f and NoChainBreak(d, f)) { if ((TestBond(c, e) and TestBond(e, a)) or (TestBond(f, b) and TestBond(b, d))) result = bridge_type::Parallel; else if ((TestBond(c, d) and TestBond(f, a)) or (TestBond(e, b) and TestBond(b, e))) result = bridge_type::AntiParallel; } return result; } // -------------------------------------------------------------------- // return true if any of the residues in bridge a is identical to any of the residues in bridge b bool Linked(const bridge &a, const bridge &b) { return find_first_of(a.i.begin(), a.i.end(), b.i.begin(), b.i.end()) != a.i.end() or find_first_of(a.i.begin(), a.i.end(), b.j.begin(), b.j.end()) != a.i.end() or find_first_of(a.j.begin(), a.j.end(), b.i.begin(), b.i.end()) != a.j.end() or find_first_of(a.j.begin(), a.j.end(), b.j.begin(), b.j.end()) != a.j.end(); } // -------------------------------------------------------------------- void CalculateBetaSheets(std::vector &inResidues, statistics &stats, std::vector> &q) { // if (cif::VERBOSE) // std::cerr << "calculating beta sheets\n"; std::unique_ptr progress; if (cif::VERBOSE >= 0) progress = std::make_unique(q.size(), "calculate beta sheets"); // Calculate Bridges std::vector bridges; for (const auto &[i, j] : q) { if (progress) progress->consumed(1); auto &ri = inResidues[i]; auto &rj = inResidues[j]; bridge_type type = TestBridge(ri, rj); if (type == bridge_type::None) continue; bool found = false; for (bridge &bridge : bridges) { if (type != bridge.type or i != bridge.i.back() + 1) continue; if (type == bridge_type::Parallel and bridge.j.back() + 1 == j) { bridge.i.push_back(i); bridge.j.push_back(j); found = true; break; } if (type == bridge_type::AntiParallel and bridge.j.front() - 1 == j) { bridge.i.push_back(i); bridge.j.push_front(j); found = true; break; } } if (not found) { bridge bridge = {}; bridge.type = type; bridge.i.push_back(i); bridge.chainI = ri.mAsymID; bridge.j.push_back(j); bridge.chainJ = rj.mAsymID; bridges.push_back(bridge); } } // extend ladders std::ranges::sort(bridges, std::less<>()); for (uint32_t i = 0; i < bridges.size(); ++i) { for (uint32_t j = i + 1; j < bridges.size(); ++j) { uint32_t ibi = bridges[i].i.front(); uint32_t iei = bridges[i].i.back(); uint32_t jbi = bridges[i].j.front(); uint32_t jei = bridges[i].j.back(); uint32_t ibj = bridges[j].i.front(); uint32_t iej = bridges[j].i.back(); uint32_t jbj = bridges[j].j.front(); uint32_t jej = bridges[j].j.back(); if (bridges[i].type != bridges[j].type or NoChainBreak(inResidues[std::min(ibi, ibj)], inResidues[std::max(iei, iej)]) == false or NoChainBreak(inResidues[std::min(jbi, jbj)], inResidues[std::max(jei, jej)]) == false or ibj - iei >= 6 or (iei >= ibj and ibi <= iej)) { continue; } bool bulge; if (bridges[i].type == bridge_type::Parallel) bulge = ((jbj - jei < 6 and ibj - iei < 3) or (jbj - jei < 3)); else bulge = ((jbi - jej < 6 and ibj - iei < 3) or (jbi - jej < 3)); if (bulge) { bridges[i].i.insert(bridges[i].i.end(), bridges[j].i.begin(), bridges[j].i.end()); if (bridges[i].type == bridge_type::Parallel) bridges[i].j.insert(bridges[i].j.end(), bridges[j].j.begin(), bridges[j].j.end()); else bridges[i].j.insert(bridges[i].j.begin(), bridges[j].j.begin(), bridges[j].j.end()); bridges.erase(bridges.begin() + j); --j; } } } // Sheet std::set ladderset; for (bridge &bridge : bridges) { ladderset.insert(&bridge); size_t n = bridge.i.size(); if (n > dssp::kHistogramSize) n = dssp::kHistogramSize; if (bridge.type == bridge_type::Parallel) stats.histogram.parallel_bridges_per_ladder[n - 1] += 1; else stats.histogram.antiparallel_bridges_per_ladder[n - 1] += 1; } uint32_t sheet = 1, ladder = 0; while (not ladderset.empty()) { std::set sheetset; sheetset.insert(*ladderset.begin()); ladderset.erase(ladderset.begin()); bool done = false; while (not done) { done = true; for (bridge *a : sheetset) { for (bridge *b : ladderset) { if (Linked(*a, *b)) { sheetset.insert(b); ladderset.erase(b); done = false; break; } } if (not done) break; } } for (bridge *bridge : sheetset) { bridge->ladder = ladder; bridge->sheet = sheet; bridge->link = sheetset; ++ladder; } size_t nrOfLaddersPerSheet = sheetset.size(); if (nrOfLaddersPerSheet > dssp::kHistogramSize) nrOfLaddersPerSheet = dssp::kHistogramSize; if (nrOfLaddersPerSheet == 1 and (*sheetset.begin())->i.size() > 1) stats.histogram.ladders_per_sheet[0] += 1; else if (nrOfLaddersPerSheet > 1) stats.histogram.ladders_per_sheet[nrOfLaddersPerSheet - 1] += 1; ++sheet; } for (bridge &bridge : bridges) { // find out if any of the i and j set members already have // a bridge assigned, if so, we're assigning bridge 2 uint32_t betai = 0, betaj = 0; for (uint32_t l : bridge.i) { if (inResidues[l].GetBetaPartner(0).m_residue != nullptr) { betai = 1; break; } } for (uint32_t l : bridge.j) { if (inResidues[l].GetBetaPartner(0).m_residue != nullptr) { betaj = 1; break; } } structure_type ss = structure_type::Betabridge; if (bridge.i.size() > 1) ss = structure_type::Strand; if (bridge.type == bridge_type::Parallel) { stats.count.H_bonds_in_parallel_bridges += bridge.i.back() - bridge.i.front() + 2; auto j = bridge.j.begin(); for (uint32_t i : bridge.i) inResidues[i].SetBetaPartner(betai, inResidues[*j++], bridge.ladder, true); j = bridge.i.begin(); for (uint32_t i : bridge.j) inResidues[i].SetBetaPartner(betaj, inResidues[*j++], bridge.ladder, true); } else { stats.count.H_bonds_in_antiparallel_bridges += bridge.i.back() - bridge.i.front() + 2; auto j = bridge.j.rbegin(); for (uint32_t i : bridge.i) inResidues[i].SetBetaPartner(betai, inResidues[*j++], bridge.ladder, false); j = bridge.i.rbegin(); for (uint32_t i : bridge.j) inResidues[i].SetBetaPartner(betaj, inResidues[*j++], bridge.ladder, false); } for (uint32_t i = bridge.i.front(); i <= bridge.i.back(); ++i) { if (inResidues[i].GetSecondaryStructure() != structure_type::Strand) inResidues[i].SetSecondaryStructure(ss); inResidues[i].SetSheet(bridge.sheet); } for (uint32_t i = bridge.j.front(); i <= bridge.j.back(); ++i) { if (inResidues[i].GetSecondaryStructure() != structure_type::Strand) inResidues[i].SetSecondaryStructure(ss); inResidues[i].SetSheet(bridge.sheet); } } // Create 'strands'. A strand is a range of residues without a gap in between // that belong to the same sheet. int strand = 0; for (uint32_t iSheet = 1; iSheet < sheet; ++iSheet) { int lastNr = -1; for (auto &res : inResidues) { if (res.mSheet != iSheet) continue; if (lastNr + 1 < res.mNumber) ++strand; res.mStrand = strand; lastNr = res.mNumber; } } } // -------------------------------------------------------------------- void CalculateAlphaHelices(std::vector &inResidues, statistics &stats, bool inPreferPiHelices = true) { if (cif::VERBOSE) std::cerr << "calculating alpha helices\n"; // Helix and Turn for (helix_type helixType : { helix_type::_3_10, helix_type::alpha, helix_type::pi }) { uint32_t stride = static_cast(helixType) + 3; for (uint32_t i = 0; i + stride < inResidues.size(); ++i) { if (NoChainBreak(inResidues[i], inResidues[i + stride]) and TestBond(&inResidues[i + stride], &inResidues[i])) { inResidues[i + stride].SetHelixFlag(helixType, helix_position_type::End); for (uint32_t j = i + 1; j < i + stride; ++j) { if (inResidues[j].GetHelixFlag(helixType) == helix_position_type::None) inResidues[j].SetHelixFlag(helixType, helix_position_type::Middle); } if (inResidues[i].GetHelixFlag(helixType) == helix_position_type::End) inResidues[i].SetHelixFlag(helixType, helix_position_type::StartAndEnd); else inResidues[i].SetHelixFlag(helixType, helix_position_type::Start); } } } for (auto &r : inResidues) { if (r.mKappa.has_value()) r.SetBend(*r.mKappa > 70); } for (uint32_t i = 1; i + 4 < inResidues.size(); ++i) { if (inResidues[i].IsHelixStart(helix_type::alpha) and inResidues[i - 1].IsHelixStart(helix_type::alpha)) { for (uint32_t j = i; j <= i + 3; ++j) inResidues[j].SetSecondaryStructure(structure_type::Alphahelix); } } for (uint32_t i = 1; i + 3 < inResidues.size(); ++i) { if (inResidues[i].IsHelixStart(helix_type::_3_10) and inResidues[i - 1].IsHelixStart(helix_type::_3_10)) { bool empty = true; for (uint32_t j = i; empty and j <= i + 2; ++j) empty = inResidues[j].GetSecondaryStructure() == structure_type::Loop or inResidues[j].GetSecondaryStructure() == structure_type::Helix_3; if (empty) { for (uint32_t j = i; j <= i + 2; ++j) inResidues[j].SetSecondaryStructure(structure_type::Helix_3); } } } for (uint32_t i = 1; i + 5 < inResidues.size(); ++i) { if (inResidues[i].IsHelixStart(helix_type::pi) and inResidues[i - 1].IsHelixStart(helix_type::pi)) { bool empty = true; for (uint32_t j = i; empty and j <= i + 4; ++j) empty = inResidues[j].GetSecondaryStructure() == structure_type::Loop or inResidues[j].GetSecondaryStructure() == structure_type::Helix_5 or (inPreferPiHelices and inResidues[j].GetSecondaryStructure() == structure_type::Alphahelix); if (empty) { for (uint32_t j = i; j <= i + 4; ++j) inResidues[j].SetSecondaryStructure(structure_type::Helix_5); } } } for (uint32_t i = 1; i + 1 < inResidues.size(); ++i) { if (inResidues[i].GetSecondaryStructure() == structure_type::Loop) { bool isTurn = false; for (helix_type helixType : { helix_type::_3_10, helix_type::alpha, helix_type::pi }) { uint32_t stride = 3 + static_cast(helixType); for (uint32_t k = 1; k < stride and not isTurn; ++k) isTurn = (i >= k) and inResidues[i - k].IsHelixStart(helixType); } if (isTurn) inResidues[i].SetSecondaryStructure(structure_type::Turn); else if (inResidues[i].IsBend()) inResidues[i].SetSecondaryStructure(structure_type::Bend); } } std::string asym; size_t helixLength = 0; for (auto &r : inResidues) { if (r.mAsymID != asym) { helixLength = 0; asym = r.mAsymID; } if (r.GetSecondaryStructure() == structure_type::Alphahelix) ++helixLength; else if (helixLength > 0) { if (helixLength > dssp::kHistogramSize) helixLength = dssp::kHistogramSize; stats.histogram.residues_per_alpha_helix[helixLength - 1] += 1; helixLength = 0; } } } // -------------------------------------------------------------------- void CalculatePPHelices(std::vector &inResidues, statistics &stats, int stretch_length) { if (cif::VERBOSE) std::cerr << "calculating pp helices\n"; size_t N = inResidues.size(); const float epsilon = 29; const float phi_min = -75 - epsilon; const float phi_max = -75 + epsilon; const float psi_min = 145 - epsilon; const float psi_max = 145 + epsilon; std::vector phi(N), psi(N); for (uint32_t i = 1; i + 1 < inResidues.size(); ++i) { phi[i] = static_cast(inResidues[i].mPhi.value_or(360)); psi[i] = static_cast(inResidues[i].mPsi.value_or(360)); } for (uint32_t i = 1; i + 3 < inResidues.size(); ++i) { switch (stretch_length) { case 2: { if (phi_min > phi[i + 0] or phi[i + 0] > phi_max or phi_min > phi[i + 1] or phi[i + 1] > phi_max) continue; if (psi_min > psi[i + 0] or psi[i + 0] > psi_max or psi_min > psi[i + 1] or psi[i + 1] > psi_max) continue; // auto phi_avg = (phi[i + 0] + phi[i + 1]) / 2; // auto phi_sq = (phi[i + 0] - phi_avg) * (phi[i + 0] - phi_avg) + // (phi[i + 1] - phi_avg) * (phi[i + 1] - phi_avg); // if (phi_sq >= 200) // continue; // auto psi_avg = (psi[i + 0] + psi[i + 1]) / 2; // auto psi_sq = (psi[i + 0] - psi_avg) * (psi[i + 0] - psi_avg) + // (psi[i + 1] - psi_avg) * (psi[i + 1] - psi_avg); // if (psi_sq >= 200) // continue; switch (inResidues[i].GetHelixFlag(helix_type::pp)) { case helix_position_type::None: inResidues[i].SetHelixFlag(helix_type::pp, helix_position_type::Start); break; case helix_position_type::End: inResidues[i].SetHelixFlag(helix_type::pp, helix_position_type::Middle); break; default: break; } inResidues[i + 1].SetHelixFlag(helix_type::pp, helix_position_type::End); if (inResidues[i].GetSecondaryStructure() == structure_type::Loop) inResidues[i].SetSecondaryStructure(structure_type::Helix_PPII); if (inResidues[i + 1].GetSecondaryStructure() == structure_type::Loop) inResidues[i + 1].SetSecondaryStructure(structure_type::Helix_PPII); } break; case 3: { if (phi_min > phi[i + 0] or phi[i + 0] > phi_max or phi_min > phi[i + 1] or phi[i + 1] > phi_max or phi_min > phi[i + 2] or phi[i + 2] > phi_max) continue; if (psi_min > psi[i + 0] or psi[i + 0] > psi_max or psi_min > psi[i + 1] or psi[i + 1] > psi_max or psi_min > psi[i + 2] or psi[i + 2] > psi_max) continue; // auto phi_avg = (phi[i + 0] + phi[i + 1] + phi[i + 2]) / 3; // auto phi_sq = (phi[i + 0] - phi_avg) * (phi[i + 0] - phi_avg) + // (phi[i + 1] - phi_avg) * (phi[i + 1] - phi_avg) + // (phi[i + 2] - phi_avg) * (phi[i + 2] - phi_avg); // if (phi_sq >= 300) // continue; // auto psi_avg = (psi[i + 0] + psi[i + 1] + psi[i + 2]) / 3; // auto psi_sq = (psi[i + 0] - psi_avg) * (psi[i + 0] - psi_avg) + // (psi[i + 1] - psi_avg) * (psi[i + 1] - psi_avg) + // (psi[i + 2] - psi_avg) * (psi[i + 2] - psi_avg); // if (psi_sq >= 300) // continue; switch (inResidues[i].GetHelixFlag(helix_type::pp)) { case helix_position_type::None: inResidues[i].SetHelixFlag(helix_type::pp, helix_position_type::Start); break; case helix_position_type::End: inResidues[i].SetHelixFlag(helix_type::pp, helix_position_type::StartAndEnd); break; default: break; } inResidues[i + 1].SetHelixFlag(helix_type::pp, helix_position_type::Middle); inResidues[i + 2].SetHelixFlag(helix_type::pp, helix_position_type::End); if (inResidues[i + 0].GetSecondaryStructure() == structure_type::Loop) inResidues[i + 0].SetSecondaryStructure(structure_type::Helix_PPII); if (inResidues[i + 1].GetSecondaryStructure() == structure_type::Loop) inResidues[i + 1].SetSecondaryStructure(structure_type::Helix_PPII); if (inResidues[i + 2].GetSecondaryStructure() == structure_type::Loop) inResidues[i + 2].SetSecondaryStructure(structure_type::Helix_PPII); break; } default: throw std::runtime_error("Unsupported stretch length"); } } } // -------------------------------------------------------------------- struct DSSP_impl { DSSP_impl(const cif::datablock &db, int model_nr, int min_poly_proline_stretch_length); auto findRes(const std::string &asymID, int seqID) { return std::ranges::find_if(mResidues, [&](auto &r) { return r.mAsymID == asymID and r.mSeqID == seqID; }); } void calculateSurface(); void calculateSecondaryStructure(); std::string GetPDBHEADERLine(); std::string GetPDBCOMPNDLine(); std::string GetPDBSOURCELine(); std::string GetPDBAUTHORLine(); const cif::datablock &mDB; std::vector mResidues; std::vector> mSSBonds; int m_min_poly_proline_stretch_length; statistics mStats = {}; }; // -------------------------------------------------------------------- DSSP_impl::DSSP_impl(const cif::datablock &db, int model_nr, int min_poly_proline_stretch_length) : mDB(db) , m_min_poly_proline_stretch_length(min_poly_proline_stretch_length) { using namespace cif::literals; if (cif::VERBOSE) std::cerr << "loading residues\n"; int resNumber = 0; auto &pdbx_poly_seq_scheme = mDB["pdbx_poly_seq_scheme"]; auto &atom_site = mDB["atom_site"]; using key_type = std::tuple; using index_type = std::map; index_type index; mResidues.reserve(pdbx_poly_seq_scheme.size()); for (const auto &[asym_id, seq_id, pdb_strand_id, pdb_seq_num, pdb_ins_code] : pdbx_poly_seq_scheme.rows("asym_id", "seq_id", "pdb_strand_id", "pdb_seq_num", "pdb_ins_code")) { index[{ asym_id, seq_id }] = mResidues.size(); mResidues.emplace_back(model_nr, pdb_strand_id, pdb_seq_num, pdb_ins_code); } for (auto atom : atom_site) { std::string asym_id; int seq_id; cif::tie(asym_id, seq_id) = atom.get("label_asym_id", "label_seq_id"); auto i = index.find({ asym_id, seq_id }); if (i == index.end()) continue; mResidues[i->second].addAtom(atom); } for (auto &residue : mResidues) residue.finish(); std::erase_if(mResidues, [](const dssp::residue &r) { return not r.mComplete; }); mStats.count.chains = 1; chain_break_type brk = chain_break_type::NewChain; for (size_t i = 0; i < mResidues.size(); ++i) { auto &residue = mResidues[i]; ++resNumber; if (i > 0) { if (distance(mResidues[i - 1].mC, mResidues[i].mN) > kMaxPeptideBondLength) { ++mStats.count.chains; if (mResidues[i - 1].mAsymID == mResidues[i].mAsymID) brk = chain_break_type::Gap; else brk = chain_break_type::NewChain; ++resNumber; } } residue.mChainBreak = brk; residue.mNumber = resNumber; brk = chain_break_type::None; } mStats.count.residues = static_cast(mResidues.size()); for (size_t i = 0; i + 1 < mResidues.size(); ++i) { auto &cur = mResidues[i]; auto &next = mResidues[i + 1]; next.mPrev = &cur; cur.mNext = &next; } for (size_t i = 0; i < mResidues.size(); ++i) { auto &cur = mResidues[i]; if (i >= 2 and i + 2 < mResidues.size()) { auto &prevPrev = mResidues[i - 2]; auto &nextNext = mResidues[i + 2]; if (NoChainBreak(prevPrev, nextNext) and prevPrev.mSeqID + 4 == nextNext.mSeqID) { float ckap = cosinus_angle( cur.mCAlpha, prevPrev.mCAlpha, nextNext.mCAlpha, cur.mCAlpha); float skap = std::sqrt(1 - ckap * ckap); auto kappa = std::atan2(skap, ckap) * static_cast(180 / kPI); if (not std::isnan(kappa)) cur.mKappa = kappa; } } if (i + 1 < mResidues.size()) { auto &next = mResidues[i + 1]; next.assignHydrogen(); if (NoChainBreak(cur, next)) { cur.mPsi = dihedral_angle(cur.mN, cur.mCAlpha, cur.mC, next.mN); cur.mOmega = dihedral_angle(cur.mCAlpha, cur.mC, next.mN, next.mCAlpha); } } if (i > 0) { auto &prev = mResidues[i - 1]; if (NoChainBreak(prev, cur)) { cur.mTCO = cosinus_angle(cur.mC, cur.mO, prev.mC, prev.mO); cur.mPhi = dihedral_angle(prev.mC, cur.mN, cur.mCAlpha, cur.mC); } } if (i >= 1 and i + 2 < mResidues.size()) { auto &prev = mResidues[i - 1]; auto &next = mResidues[i + 1]; auto &nextNext = mResidues[i + 2]; if (NoChainBreak(prev, nextNext)) cur.mAlpha = dihedral_angle(prev.mCAlpha, cur.mCAlpha, next.mCAlpha, nextNext.mCAlpha); } } } void DSSP_impl::calculateSecondaryStructure() { if (cif::VERBOSE) std::cerr << "calculating secondary structure\n"; using namespace cif::literals; for (auto [asym1, seq1, asym2, seq2] : mDB["struct_conn"].find("conn_type_id"_key == "disulf", "ptnr1_label_asym_id", "ptnr1_label_seq_id", "ptnr2_label_asym_id", "ptnr2_label_seq_id")) { auto r1 = findRes(asym1, seq1); if (r1 == mResidues.end()) { if (cif::VERBOSE > 0) std::cerr << "Missing (incomplete?) residue for SS bond when trying to find " << asym1 << '/' << seq1 << '\n'; continue; // throw std::runtime_error("Invalid file, missing residue for SS bond"); } auto r2 = findRes(asym2, seq2); if (r2 == mResidues.end()) { if (cif::VERBOSE > 0) std::cerr << "Missing (incomplete?) residue for SS bond when trying to find " << asym2 << '/' << seq2 << '\n'; continue; // throw std::runtime_error("Invalid file, missing residue for SS bond"); } mSSBonds.emplace_back(&*r1, &*r2); } // Prefetch the c-alpha positions. No, really, that might be the trick std::vector cAlphas; cAlphas.reserve(mResidues.size()); for (auto &r : mResidues) cAlphas.emplace_back(r.mCAlpha); std::unique_ptr progress; if (cif::VERBOSE >= 0) progress = std::make_unique((mResidues.size() * (mResidues.size() - 1)) / 2, "calculate distances"); // Calculate the HBond energies std::vector> near; for (uint32_t i = 0; i + 1 < mResidues.size(); ++i) { auto cai = cAlphas[i]; for (uint32_t j = i + 1; j < mResidues.size(); ++j) { auto caj = cAlphas[j]; if (distance_sq(cai, caj) > (kMinimalCADistance * kMinimalCADistance)) continue; near.emplace_back(i, j); } if (progress) progress->consumed(mResidues.size() - i - 1); } if (cif::VERBOSE > 0) std::cerr << "Considering " << near.size() << " pairs of residues\n"; progress.reset(nullptr); CalculateHBondEnergies(mResidues, near); CalculateBetaSheets(mResidues, mStats, near); CalculateAlphaHelices(mResidues, mStats); CalculatePPHelices(mResidues, mStats, m_min_poly_proline_stretch_length); if (cif::VERBOSE > 1) { for (auto &r : mResidues) { char helix[5] = {}; for (helix_type helixType : { helix_type::_3_10, helix_type::alpha, helix_type::pi, helix_type::pp }) { switch (r.GetHelixFlag(helixType)) { case helix_position_type::Start: helix[static_cast(helixType)] = '>'; break; case helix_position_type::Middle: helix[static_cast(helixType)] = helixType == helix_type::pp ? 'P' : '3' + static_cast(helixType); break; case helix_position_type::StartAndEnd: helix[static_cast(helixType)] = 'X'; break; case helix_position_type::End: helix[static_cast(helixType)] = '<'; break; case helix_position_type::None: helix[static_cast(helixType)] = ' '; break; } } auto id = r.mAsymID + ':' + std::to_string(r.mSeqID) + '/' + r.mCompoundID; std::cerr << id << std::string(12 - id.length(), ' ') << static_cast(r.mSecondaryStructure) << ' ' << helix << '\n'; } } // finish statistics mStats.count.SS_bridges = static_cast(mSSBonds.size()); mStats.count.intra_chain_SS_bridges = 0; uint8_t ssBondNr = 0; for (const auto &[a, b] : mSSBonds) { if (a == b) { if (cif::VERBOSE > 0) std::cerr << "In the SS bonds list, the residue " << a->mAsymID << ':' << a->mSeqID << " is bonded to itself\n"; continue; } if (a->mAsymID == b->mAsymID and NoChainBreak(a, b)) ++mStats.count.intra_chain_SS_bridges; a->mSSBridgeNr = b->mSSBridgeNr = ++ssBondNr; } mStats.count.H_bonds = 0; for (auto &r : mResidues) { auto donor = r.mHBondDonor; for (int i = 0; i < 2; ++i) { if (donor[i].res != nullptr and donor[i].energy < kMaxHBondEnergy) { ++mStats.count.H_bonds; auto k = donor[i].res->mNumber - r.mNumber; if (k >= -5 and k <= 5) mStats.count.H_Bonds_per_distance[k + 5] += 1; } } } } void DSSP_impl::calculateSurface() { CalculateAccessibilities(mResidues, mStats); } // -------------------------------------------------------------------- // Truncate lines in pseudo PDB format to this length const int kTruncateAt = 127; std::string FixStringLength(std::string s, std::string::size_type l = kTruncateAt) { if (s.length() > l) s = s.substr(0, l - 4) + "... "; else if (s.length() < l) s.append(l - s.length(), ' '); return s; } std::string cif2pdbDate(const std::string &d) { const std::regex rx(R"((\d{4})-(\d{2})(?:-(\d{2}))?)"); const char *kMonths[12] = { "JAN", "FEB", "MAR", "APR", "MAY", "JUN", "JUL", "AUG", "SEP", "OCT", "NOV", "DEC" }; std::smatch m; std::ostringstream os; if (std::regex_match(d, m, rx)) { int year = std::stoi(m[1].str()); int month = std::stoi(m[2].str()); if (m[3].matched) os << std::setw(2) << std::setfill('0') << stoi(m[3].str()) << '-'; os << kMonths[month - 1] << '-' << std::setw(2) << std::setfill('0') << (year % 100); } return os.str(); } std::string cif2pdbAuth(std::string name) { const std::regex rx(R"(([^,]+), (\S+))"); std::smatch m; if (std::regex_match(name, m, rx)) name = m[2].str() + m[1].str(); return name; } std::string DSSP_impl::GetPDBHEADERLine() { std::string keywords; auto &cat1 = mDB["struct_keywords"]; for (auto r : cat1) { keywords = FixStringLength(r["pdbx_keywords"].get(), 40); break; } std::string date; for (auto r : mDB["pdbx_database_status"]) { date = r["recvd_initial_deposition_date"].get(); if (date.empty()) continue; date = cif2pdbDate(date); break; } if (date.empty()) { for (auto r : mDB["database_PDB_rev"]) { date = r["date_original"].get(); if (date.empty()) continue; date = cif2pdbDate(date); break; } } date = FixStringLength(date, 9); // 0 1 2 3 4 5 6 7 8 // HEADER xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDDDDDDDDD IIII char header[] = "HEADER xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDDDDDDDDD IIII "; std::ranges::copy(keywords, header + 10); std::ranges::copy(date, header + 50); std::string id = mDB.name(); if (id.starts_with("pdb_")) id.erase(0, 4); if (id.length() < 4) id.insert(id.end(), 4 - id.length(), ' '); else if (id.length() > 8) id.erase(id.begin() + 8, id.end()); std::ranges::copy(id, header + 62); return FixStringLength(header); } std::string DSSP_impl::GetPDBCOMPNDLine() { // COMPND using namespace std::placeholders; using namespace cif::literals; int molID = 0; std::vector cmpnd; for (auto r : mDB["entity"].find("type"_key == "polymer")) { auto entityID = r["id"].get(); ++molID; cmpnd.push_back("MOL_ID: " + std::to_string(molID)); auto molecule = r["pdbx_description"].get(); cmpnd.push_back("MOLECULE: " + molecule); auto poly = mDB["entity_poly"].find("entity_id"_key == entityID); if (not poly.empty()) { auto chains = poly.front()["pdbx_strand_id"].get(); cif::replace_all(chains, ",", ", "); cmpnd.push_back("CHAIN: " + chains); } auto fragment = r["pdbx_fragment"].get(); if (not fragment.empty()) cmpnd.push_back("FRAGMENT: " + fragment); for (auto sr : mDB["entity_name_com"].find("entity_id"_key == entityID)) { auto syn = sr["name"].get(); if (not syn.empty()) cmpnd.push_back("SYNONYM: " + syn); } auto mutation = r["pdbx_mutation"].get(); if (not mutation.empty()) cmpnd.push_back("MUTATION: " + mutation); auto ec = r["pdbx_ec"].get(); if (not ec.empty()) cmpnd.push_back("EC: " + ec); if (r["src_method"] == "man" or r["src_method"] == "syn") cmpnd.emplace_back("ENGINEERED: YES"); auto details = r["details"].get(); if (not details.empty()) cmpnd.push_back("OTHER_DETAILS: " + details); } return FixStringLength("COMPND " + cif::join(cmpnd, "; "), kTruncateAt); } std::string DSSP_impl::GetPDBSOURCELine() { // SOURCE using namespace cif::literals; int molID = 0; std::vector source; for (auto r : mDB["entity"]) { if (r["type"] != "polymer") continue; auto entityID = r["id"].get(); ++molID; source.push_back("MOL_ID: " + std::to_string(molID)); if (r["src_method"] == "syn") source.emplace_back("SYNTHETIC: YES"); auto &gen = mDB["entity_src_gen"]; const std::pair kGenSourceMapping[] = { { "gene_src_common_name", "ORGANISM_COMMON" }, { "pdbx_gene_src_gene", "GENE" }, { "gene_src_strain", "STRAIN" }, { "pdbx_gene_src_cell_line", "CELL_LINE" }, { "pdbx_gene_src_organelle", "ORGANELLE" }, { "pdbx_gene_src_cellular_location", "CELLULAR_LOCATION" }, { "pdbx_gene_src_scientific_name", "ORGANISM_SCIENTIFIC" }, { "pdbx_gene_src_ncbi_taxonomy_id", "ORGANISM_TAXID" }, { "pdbx_host_org_scientific_name", "EXPRESSION_SYSTEM" }, { "pdbx_host_org_ncbi_taxonomy_id", "EXPRESSION_SYSTEM_TAXID" }, { "pdbx_host_org_strain", "EXPRESSION_SYSTEM_STRAIN" }, { "pdbx_host_org_variant", "EXPRESSION_SYSTEM_VARIANT" }, { "pdbx_host_org_cellular_location", "EXPRESSION_SYSTEM_CELLULAR_LOCATION" }, { "pdbx_host_org_vector_type", "EXPRESSION_SYSTEM_VECTOR_TYPE" }, { "pdbx_host_org_vector", "EXPRESSION_SYSTEM_VECTOR" }, { "pdbx_host_org_gene", "EXPRESSION_SYSTEM_GENE" }, { "plasmid_name", "EXPRESSION_SYSTEM_PLASMID" } }; for (auto gr : gen.find("entity_id"_key == entityID)) { for (auto m : kGenSourceMapping) { std::string cname, sname; tie(cname, sname) = m; auto s = gr[cname].get(); if (not s.empty()) source.push_back(sname + ": " + s); } } auto &nat = mDB["entity_src_nat"]; const std::pair kNatSourceMapping[] = { { "common_name", "ORGANISM_COMMON" }, { "strain", "STRAIN" }, { "pdbx_organism_scientific", "ORGANISM_SCIENTIFIC" }, { "pdbx_ncbi_taxonomy_id", "ORGANISM_TAXID" }, { "pdbx_cellular_location", "CELLULAR_LOCATION" }, { "pdbx_plasmid_name", "PLASMID" }, { "pdbx_organ", "ORGAN" }, { "details", "OTHER_DETAILS" } }; for (auto nr : nat.find("entity_id"_key == entityID)) { for (auto m : kNatSourceMapping) { std::string cname, sname; tie(cname, sname) = m; auto s = nr[cname].get(); if (not s.empty()) source.push_back(sname + ": " + s); } } } return FixStringLength("SOURCE " + cif::join(source, "; "), kTruncateAt); } std::string DSSP_impl::GetPDBAUTHORLine() { // AUTHOR std::vector author; for (auto r : mDB["audit_author"]) author.push_back(cif2pdbAuth(r["name"].get())); return FixStringLength("AUTHOR " + cif::join(author, "; "), kTruncateAt); } // -------------------------------------------------------------------- std::string dssp::residue_info::asym_id() const { return m_impl->mAsymID; } std::string dssp::residue_info::compound_id() const { return m_impl->mCompoundID; } char dssp::residue_info::compound_letter() const { return MapResidue(compound_id()); } int dssp::residue_info::seq_id() const { return m_impl->mSeqID; } std::string dssp::residue_info::alt_id() const { return m_impl->mAltID; } std::string dssp::residue_info::auth_asym_id() const { return m_impl->mAuthAsymID; } int dssp::residue_info::auth_seq_id() const { return m_impl->mAuthSeqID; } std::string dssp::residue_info::pdb_strand_id() const { return m_impl->mPDBStrandID; } int dssp::residue_info::pdb_seq_num() const { return m_impl->mPDBSeqNum; } std::string dssp::residue_info::pdb_ins_code() const { return m_impl->mPDBInsCode; } std::optional dssp::residue_info::alpha() const { return m_impl->mAlpha; } std::optional dssp::residue_info::kappa() const { return m_impl->mKappa; } std::optional dssp::residue_info::omega() const { return m_impl->mOmega; } std::optional dssp::residue_info::phi() const { return m_impl->mPhi; } std::optional dssp::residue_info::psi() const { return m_impl->mPsi; } std::optional dssp::residue_info::tco() const { return m_impl->mTCO; } bool dssp::residue_info::is_pre_pro() const { return m_impl->mType != kProline and m_impl->mNext != nullptr and m_impl->mNext->mType == kProline; } float dssp::residue_info::chiral_volume() const { return m_impl->mChiralVolume; } const std::map> kChiAtomsMap = { { MapResidue("ASP"), { "CG", "OD1" } }, { MapResidue("ASN"), { "CG", "OD1" } }, { MapResidue("ARG"), { "CG", "CD", "NE", "CZ" } }, { MapResidue("HIS"), { "CG", "ND1" } }, { MapResidue("GLN"), { "CG", "CD", "OE1" } }, { MapResidue("GLU"), { "CG", "CD", "OE1" } }, { MapResidue("SER"), { "OG" } }, { MapResidue("THR"), { "OG1" } }, { MapResidue("LYS"), { "CG", "CD", "CE", "NZ" } }, { MapResidue("TYR"), { "CG", "CD1" } }, { MapResidue("PHE"), { "CG", "CD1" } }, { MapResidue("LEU"), { "CG", "CD1" } }, { MapResidue("TRP"), { "CG", "CD1" } }, { MapResidue("CYS"), { "SG" } }, { MapResidue("ILE"), { "CG1", "CD1" } }, { MapResidue("MET"), { "CG", "SD", "CE" } }, { MapResidue("MSE"), { "CG", "SE", "CE" } }, { MapResidue("PRO"), { "CG", "CD" } }, { MapResidue("VAL"), { "CG1" } } }; std::size_t dssp::residue_info::nr_of_chis() const { auto i = kChiAtomsMap.find(m_impl->mType); return i != kChiAtomsMap.end() ? i->second.size() : 0; } float dssp::residue_info::chi(std::size_t index) const { float result = 0; auto type = m_impl->mType; auto i = kChiAtomsMap.find(type); if (i != kChiAtomsMap.end() and index < i->second.size()) { std::vector atoms{ "N", "CA", "CB" }; atoms.insert(atoms.end(), i->second.begin(), i->second.end()); // in case we have a positive chiral volume we need to swap atoms if (m_impl->mChiralVolume > 0) { if (type == kLeucine) atoms.back() = "CD2"; if (type == kValine) atoms.back() = "CG2"; } result = static_cast(dihedral_angle( m_impl->get_atom(atoms[index + 0]), m_impl->get_atom(atoms[index + 1]), m_impl->get_atom(atoms[index + 2]), m_impl->get_atom(atoms[index + 3]))); } return result; } std::tuple dssp::residue_info::ca_location() const { return { m_impl->mCAlpha.mX, m_impl->mCAlpha.mY, m_impl->mCAlpha.mZ }; } chain_break_type dssp::residue_info::chain_break() const { return m_impl->mChainBreak; } int dssp::residue_info::nr() const { return m_impl->mNumber; } structure_type dssp::residue_info::type() const { return m_impl->mSecondaryStructure; } int dssp::residue_info::ssBridgeNr() const { return m_impl->mSSBridgeNr; } helix_position_type dssp::residue_info::helix(helix_type helixType) const { return m_impl->GetHelixFlag(helixType); } bool dssp::residue_info::is_alpha_helix_end_before_start() const { bool result = false; if (m_impl->mNext != nullptr) result = m_impl->GetHelixFlag(helix_type::alpha) == helix_position_type::End and m_impl->mNext->GetHelixFlag(helix_type::alpha) == helix_position_type::Start; return result; } bool dssp::residue_info::bend() const { return m_impl->IsBend(); } double dssp::residue_info::accessibility() const { return m_impl->mAccessibility; } std::tuple dssp::residue_info::bridge_partner(int i) const { auto bp = m_impl->GetBetaPartner(i); residue_info ri(bp.m_residue); return std::make_tuple(std::move(ri), bp.ladder, bp.parallel); } int dssp::residue_info::sheet() const { return m_impl->GetSheet(); } int dssp::residue_info::strand() const { return m_impl->GetStrand(); } std::tuple dssp::residue_info::acceptor(int i) const { auto &a = m_impl->mHBondAcceptor[i]; return { residue_info(a.res), a.energy }; } std::tuple dssp::residue_info::donor(int i) const { auto &d = m_impl->mHBondDonor[i]; return { residue_info(d.res), d.energy }; } dssp::residue_info dssp::residue_info::next() const { return { m_impl ? m_impl->mNext : nullptr }; } // -------------------------------------------------------------------- dssp::iterator::iterator(residue *res) : m_current(res) { } dssp::iterator &dssp::iterator::operator++() { ++m_current.m_impl; return *this; } dssp::iterator &dssp::iterator::operator--() { --m_current.m_impl; return *this; } // -------------------------------------------------------------------- dssp::dssp(const cif::mm::structure &s, int min_poly_proline_stretch_length, bool calculateSurfaceAccessibility) : dssp(s.get_datablock(), static_cast(s.get_model_nr()), min_poly_proline_stretch_length, calculateSurfaceAccessibility) { } dssp::dssp(const cif::datablock &db, int model_nr, int min_poly_proline_stretch, bool calculateSurfaceAccessibility) : m_impl(new DSSP_impl(db, model_nr, min_poly_proline_stretch)) { if (calculateSurfaceAccessibility) { std::thread t([this] { m_impl->calculateSurface(); }); m_impl->calculateSecondaryStructure(); t.join(); } else m_impl->calculateSecondaryStructure(); } dssp::~dssp() { delete m_impl; } dssp::iterator dssp::begin() const { return { m_impl->mResidues.empty() ? nullptr : m_impl->mResidues.data() }; } dssp::iterator dssp::end() const { // careful now, MSVC is picky when it comes to dereferencing iterators that are at the end. residue *res = nullptr; if (not m_impl->mResidues.empty()) { res = m_impl->mResidues.data(); res += m_impl->mResidues.size(); } return { res }; } dssp::residue_info dssp::operator[](const key_type &key) const { auto i = std::ranges::find_if(*this, [key](const residue_info &res) { return res.asym_id() == std::get<0>(key) and res.seq_id() == std::get<1>(key); }); if (i == end()) throw std::out_of_range("Could not find residue with supplied key"); return *i; } dssp::statistics dssp::get_statistics() const { return m_impl->mStats; } std::string dssp::get_pdb_header_line(pdb_record_type pdb_record) const { switch (pdb_record) { case pdb_record_type::HEADER: return m_impl->GetPDBHEADERLine(); case pdb_record_type::COMPND: return m_impl->GetPDBCOMPNDLine(); case pdb_record_type::SOURCE: return m_impl->GetPDBSOURCELine(); case pdb_record_type::AUTHOR: return m_impl->GetPDBAUTHORLine(); default: return {}; } } // -------------------------------------------------------------------- void dssp::write_legacy_output(std::ostream &os) const { writeDSSP(*this, os); } void dssp::annotate(cif::datablock &db, bool writeOther, bool writeDSSPCategories) const { annotateDSSP(db, *this, writeOther, writeDSSPCategories); } PDB-REDO-dssp-ca06797/python-module/000077500000000000000000000000001516741327300167745ustar00rootroot00000000000000PDB-REDO-dssp-ca06797/python-module/CMakeLists.txt000066400000000000000000000050051516741327300215340ustar00rootroot00000000000000# SPDX-License-Identifier: BSD-2-Clause # # Copyright (c) 2025 NKI/AVL, Netherlands Cancer Institute # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions are met: # # 1. Redistributions of source code must retain the above copyright notice, this # list of conditions and the following disclaimer # 2. Redistributions in binary form must reproduce the above copyright notice, # this list of conditions and the following disclaimer in the documentation # and/or other materials provided with the distribution. # # THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS "AS IS" AND # ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED # WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE # DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS BE LIABLE FOR # ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES # (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; # LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND # ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS # SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. include(CPM) if(CMAKE_VERSION GREATER_EQUAL 3.30) cmake_policy(SET CMP0167 NEW) endif() find_package(Python 3.13 REQUIRED COMPONENTS Interpreter Development) if(NOT EXISTS ${Python_LIBRARIES}) message(FATAL_ERROR "The python library ${Python_LIBRARIES} does not seem to exist?") endif() find_package(Boost 1.86 REQUIRED COMPONENTS python) # --------- add_library(mkdssp_module SHARED dssp-python-plugin.cpp) target_compile_features(mkdssp_module PUBLIC cxx_std_20) target_include_directories(mkdssp_module PRIVATE ${Python_INCLUDE_DIRS}) target_link_libraries(mkdssp_module PRIVATE dssp::dssp ${Python_LIBRARIES} Boost::python) set_target_properties(mkdssp_module PROPERTIES PREFIX "" SUFFIX ".so" OUTPUT_NAME mkdssp LINKER_LANGUAGE CXX LIBRARY_OUTPUT_DIRECTORY ${CMAKE_BINARY_DIR}/lib) if(WIN32) # python modules use this on Windows set_target_properties( mkdssp_module PROPERTIES SUFFIX ".pyd" RUNTIME_OUTPUT_DIRECTORY ${CMAKE_BINARY_DIR}/bin) install(TARGETS mkdssp_module RUNTIME DESTINATION "${Python_SITELIB}") else() install(TARGETS mkdssp_module LIBRARY DESTINATION "${Python_SITELIB}") endif() PDB-REDO-dssp-ca06797/python-module/dssp-python-plugin.cpp000066400000000000000000000266321516741327300232750ustar00rootroot00000000000000#include #include #include #include struct statistics_wrapper { int get_residues() { return m_stats.count.residues; } int get_chains() { return m_stats.count.chains; } int get_SS_bridges() { return m_stats.count.SS_bridges; } int get_intra_chain_SS_bridges() { return m_stats.count.intra_chain_SS_bridges; } int get_H_bonds() { return m_stats.count.H_bonds; } int get_H_bonds_in_antiparallel_bridges() { return m_stats.count.H_bonds_in_antiparallel_bridges; } int get_H_bonds_in_parallel_bridges() { return m_stats.count.H_bonds_in_parallel_bridges; } dssp::statistics m_stats; }; enum class ladder_direction_type { parallel, antiparallel }; struct residue_info_wrapper { }; class dssp_wrapper { public: dssp_wrapper(std::string data, int model_nr = 1, int min_poly_proline_stretch_length = 3, bool calculateSurfaceAccessibility = false) { struct membuf : public std::streambuf { membuf(char *text, size_t length) { this->setg(text, text, text + length); } } buffer(const_cast(data.data()), data.length()); std::istream is(&buffer); auto f = cif::pdb::read(is); m_dssp = std::make_shared(f.front(), model_nr, min_poly_proline_stretch_length, calculateSurfaceAccessibility); } dssp_wrapper(const dssp_wrapper &) = default; dssp_wrapper &operator=(const dssp_wrapper &) = default; statistics_wrapper get_statistics() { statistics_wrapper result{ .m_stats = m_dssp->get_statistics() }; return result; } struct residue_info_handle { residue_info_handle(dssp::residue_info info) : m_info(info) { } operator dssp::residue_info &() { return m_info; } dssp::residue_info m_info; }; class iterator { public: using iterator_category = std::forward_iterator_tag; using value_type = dssp::residue_info; using difference_type = std::ptrdiff_t; using pointer = value_type *; using reference = residue_info_handle; iterator(dssp::residue_info info) : m_current(info) { } iterator(const iterator &i) = default; iterator &operator=(const iterator &i) = default; reference operator*() { return {m_current}; } pointer operator->() { return &m_current; } iterator &operator++() { m_current = m_current.next(); return *this; } iterator operator++(int) { auto tmp(*this); this->operator++(); return tmp; } bool operator==(const iterator &rhs) const { return m_current == rhs.m_current; } private: dssp::residue_info m_current; }; auto begin() { return iterator(*m_dssp->begin()); } auto end() { return iterator({}); } auto get(std::string asym_id, int nr) { return m_dssp->operator[]({ asym_id, nr }); } private: std::shared_ptr m_dssp; }; // shamelessly copied from a stack overflow comment // https://stackoverflow.com/questions/36485840/wrap-boostoptional-using-boostpython // Custom exceptions struct AttributeError : std::exception { [[nodiscard]] const char *what() const noexcept override { return "AttributeError exception"; } }; struct TypeError : std::exception { [[nodiscard]] const char *what() const noexcept override { return "TypeError exception"; } }; // Set python exceptions void translate(const std::exception &e) { if (dynamic_cast(&e)) PyErr_SetString(PyExc_AttributeError, e.what()); if (dynamic_cast(&e)) PyErr_SetString(PyExc_TypeError, e.what()); } struct to_python_optional { static PyObject *convert(const std::optional &obj) { if (obj) return boost::python::incref(boost::python::object(*obj).ptr()); else return boost::python::incref(boost::python::object().ptr()); } }; struct to_python_list_of_floats { static PyObject *convert(const std::vector &v) { boost::python::list list; for (auto value : v) list.append(value); return boost::python::incref(boost::python::object(list).ptr()); } }; struct to_python_point { static PyObject *convert(const std::tuple &v) { boost::python::dict p; p["x"] = std::get<0>(v); p["y"] = std::get<1>(v); p["z"] = std::get<2>(v); return boost::python::incref(boost::python::object(p).ptr()); } }; struct to_python_partner { static PyObject *convert(const std::tuple &v) { boost::python::type_info iv = boost::python::type_id(); const boost::python::converter::registration* cv = boost::python::converter::registry::query(iv); assert(cv != nullptr); if (cv == nullptr) throw std::runtime_error("Missing registration"); if (auto &[ri, e] = v; ri) { auto c = cv->to_python(&ri); return boost::python::incref(boost::python::make_tuple(boost::python::handle<>(c), e).ptr()); } else return boost::python::incref(boost::python::make_tuple(boost::python::object(), 0).ptr()); } }; struct to_python_bridge_partner { static PyObject *convert(const std::tuple &v) { if (auto &[ri, nr, parallel] = v; ri) { boost::python::type_info iv = boost::python::type_id(); const boost::python::converter::registration* cv = boost::python::converter::registry::query(iv); assert(cv != nullptr); boost::python::type_info dv = boost::python::type_id(); const boost::python::converter::registration* ev = boost::python::converter::registry::query(dv); assert(ev != nullptr); auto c = cv->to_python(&ri); ladder_direction_type direction = parallel ? ladder_direction_type::parallel : ladder_direction_type::antiparallel; auto e = ev->to_python(&direction); return boost::python::incref(boost::python::make_tuple( boost::python::handle<>(c), nr, boost::python::handle<>(e)).ptr()); } else return boost::python::incref(boost::python::make_tuple(boost::python::object(), 0, boost::python::object()).ptr()); } }; bool test_bond_between_residues(PyObject *a, PyObject *b) { const auto &a_ri = boost::python::extract(a); const auto &b_ri = boost::python::extract(b); return test_bond(a_ri, b_ri); } BOOST_PYTHON_MODULE(mkdssp) { using namespace boost::python; register_exception_translator(&translate); register_exception_translator(&translate); to_python_converter, to_python_optional>(); to_python_converter, to_python_list_of_floats>(); to_python_converter, to_python_point>(); to_python_converter, to_python_partner>(); to_python_converter, to_python_bridge_partner>(); enum_("structure_type") .value("Loop", dssp::structure_type::Loop) .value("Alphahelix", dssp::structure_type::Alphahelix) .value("Betabridge", dssp::structure_type::Betabridge) .value("Strand", dssp::structure_type::Strand) .value("Helix_3", dssp::structure_type::Helix_3) .value("Helix_5", dssp::structure_type::Helix_5) .value("Helix_PPII", dssp::structure_type::Helix_PPII) .value("Turn", dssp::structure_type::Turn) .value("Bend", dssp::structure_type::Bend); enum_("helix_type") .value("_3_10", dssp::helix_type::_3_10) .value("alpha", dssp::helix_type::alpha) .value("pi", dssp::helix_type::pi) .value("pp", dssp::helix_type::pp); enum_("helix_position_type") .value("NoHelix", dssp::helix_position_type::None) .value("Start", dssp::helix_position_type::Start) .value("End", dssp::helix_position_type::End) .value("StartAndEnd", dssp::helix_position_type::StartAndEnd) .value("Middle", dssp::helix_position_type::Middle); enum_("ladder_direction_type") .value("parallel", ladder_direction_type::parallel) .value("anti_parallel", ladder_direction_type::antiparallel); enum_("chain_break_type") .value("NoGap", dssp::chain_break_type::None) .value("NewChain", dssp::chain_break_type::NewChain) .value("Gap", dssp::chain_break_type::Gap); class_("statistic_counts") .add_property("residues", &statistics_wrapper::get_residues) .add_property("chains", &statistics_wrapper::get_chains) .add_property("SS_bridges", &statistics_wrapper::get_SS_bridges) .add_property("intra_chain_SS_bridges", &statistics_wrapper::get_intra_chain_SS_bridges) .add_property("H_bonds", &statistics_wrapper::get_H_bonds) .add_property("H_bonds_in_antiparallel_bridges", &statistics_wrapper::get_H_bonds_in_antiparallel_bridges) .add_property("H_bonds_in_parallel_bridges", &statistics_wrapper::get_H_bonds_in_parallel_bridges); class_("residue_info") .add_property("asym_id", &dssp::residue_info::asym_id) .add_property("seq_id", &dssp::residue_info::seq_id) .add_property("alt_id", &dssp::residue_info::alt_id) .add_property("compound_id", &dssp::residue_info::compound_id) .add_property("compound_letter", &dssp::residue_info::compound_letter) .add_property("auth_asym_id", &dssp::residue_info::auth_asym_id) .add_property("auth_seq_id", &dssp::residue_info::auth_seq_id) .add_property("pdb_strand_id", &dssp::residue_info::pdb_strand_id) .add_property("pdb_seq_num", &dssp::residue_info::pdb_seq_num) .add_property("pdb_ins_code", &dssp::residue_info::pdb_ins_code) .add_property("alpha", &dssp::residue_info::alpha) .add_property("kappa", &dssp::residue_info::kappa) .add_property("phi", &dssp::residue_info::phi) .add_property("psi", &dssp::residue_info::psi) .add_property("tco", &dssp::residue_info::tco) .add_property("omega", &dssp::residue_info::omega) .add_property("is_pre_pro", &dssp::residue_info::is_pre_pro) .add_property("is_cis", &dssp::residue_info::is_cis) .add_property("chiral_volume", &dssp::residue_info::chiral_volume) .add_property("chi", &dssp::residue_info::chis) .add_property("ca_location", &dssp::residue_info::ca_location) .add_property("chain_break", &dssp::residue_info::chain_break) .add_property("nr", &dssp::residue_info::nr) .add_property("type", &dssp::residue_info::type) .add_property("ssBridgeNr", &dssp::residue_info::ssBridgeNr) .def("helix", &dssp::residue_info::helix, args("helix_type"), "Return the position of this residue in a helix with type helix_type") .add_property("is_alpha_helix_end_before_start", &dssp::residue_info::is_alpha_helix_end_before_start) .add_property("bend", &dssp::residue_info::bend) .add_property("accessibility", &dssp::residue_info::accessibility) .def("bridge_partner", &dssp::residue_info::bridge_partner, args("indexnr"), "Return a tuple containing the residue, number and direction for the bridge partner with index indexnr") .add_property("sheet", &dssp::residue_info::sheet) .add_property("strand", &dssp::residue_info::strand) .def("acceptor", &dssp::residue_info::acceptor, args("indexnr"), "Return a tuple containing the residue and bond energy for the acceptor with index indexnr") .def("donor", &dssp::residue_info::donor, args("indexnr"), "Return a tuple containing the residue and bond energy for the donor with index indexnr"); class_("dssp", init>()) .add_property("statistics", &dssp_wrapper::get_statistics) .def("__iter__", iterator()) .def("get", &dssp_wrapper::get, args("asym_id", "seq_id"), "Return the residue info object for the residue with specified asym_id and seq_id"); def("TestBond", test_bond_between_residues, args("a", "b"), "Returns true if residues a and b are bonded according to DSSP"); }PDB-REDO-dssp-ca06797/python-module/test-mkdssp.py000066400000000000000000000047051516741327300216320ustar00rootroot00000000000000from mkdssp import dssp, helix_type, TestBond import os import gzip file_path = os.path.join("..", "test", "1cbs.cif.gz") with gzip.open(file_path, "rt") as f: file_content = f.read() dssp = dssp(file_content) print("residues: ", dssp.statistics.residues) print("chains: ", dssp.statistics.chains) print("SS_bridges: ", dssp.statistics.SS_bridges) print("intra_chain_SS_bridges: ", dssp.statistics.intra_chain_SS_bridges) print("H_bonds: ", dssp.statistics.H_bonds) print("H_bonds_in_antiparallel_bridges: ", dssp.statistics.H_bonds_in_antiparallel_bridges) print("H_bonds_in_parallel_bridges: ", dssp.statistics.H_bonds_in_parallel_bridges) count = 0 for res in dssp: count += 1 print(res.asym_id, res.seq_id, res.compound_id) print("alt_id", res.alt_id) print("compound_letter", res.compound_letter) print("auth_asym_id", res.auth_asym_id) print("auth_seq_id", res.auth_seq_id) print("pdb_strand_id", res.pdb_strand_id) print("pdb_seq_num", res.pdb_seq_num) print("pdb_ins_code", res.pdb_ins_code) print("alpha", res.alpha) print("kappa", res.kappa) print("phi", res.phi) print("psi", res.psi) print("tco", res.tco) print("omega", res.omega) print("is_pre_pro", res.is_pre_pro) print("is_cis", res.is_cis) print("chiral_volume", res.chiral_volume) print("chi", res.chi) print("ca_location", res.ca_location) print("chain_break", res.chain_break) print("nr", res.nr) print("type", res.type) print("ssBridgeNr", res.ssBridgeNr) print("helix(_3_10)", res.helix(helix_type._3_10)) print("helix(alpha)", res.helix(helix_type.alpha)) print("helix(pi)", res.helix(helix_type.pi)) print("helix(pp)", res.helix(helix_type.pp)) print("is_alpha_helix_end_before_start", res.is_alpha_helix_end_before_start) print("bend", res.bend) print("sheet", res.sheet) print("strand", res.strand) for i in range(0, 1): (ri, nr, dir) = res.bridge_partner(i) if ri != None: print("bridge partner ", i, ri.asym_id, ri.seq_id, ri.compound_id, nr, dir) for i in range(0, 1): (ri, e) = res.acceptor(i) if ri != None: print("acceptor ", i, ri.asym_id, ri.seq_id, ri.compound_id, e) print("test bond: ", TestBond(res, ri)) for i in range(0, 1): (ri, e) = res.donor(i) if ri != None: print("donor ", i, ri.asym_id, ri.seq_id, ri.compound_id, e) print("test bond: ", TestBond(res, ri)) print("accessibility", res.accessibility) break print("count: ", count) a = dssp.get('A', 137) b = dssp.get('A', 6) print ("a & b", a, b) assert(TestBond(a, b)) PDB-REDO-dssp-ca06797/src/000077500000000000000000000000001516741327300147575ustar00rootroot00000000000000PDB-REDO-dssp-ca06797/src/mkdssp.cpp000066400000000000000000000160631516741327300167720ustar00rootroot00000000000000/*- * SPDX-License-Identifier: BSD-2-Clause * * Copyright (c) 2020 NKI/AVL, Netherlands Cancer Institute * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions are met: * * 1. Redistributions of source code must retain the above copyright notice, this * list of conditions and the following disclaimer * 2. Redistributions in binary form must reproduce the above copyright notice, * this list of conditions and the following disclaimer in the documentation * and/or other materials provided with the distribution. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS "AS IS" AND * ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED * WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE * DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS BE LIABLE FOR * ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES * (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; * LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND * ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT * (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS * SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. */ #if __has_include("config.hpp") # include "config.hpp" #endif #include #include #include #include #include #include #include "dssp.hpp" #include "revision.hpp" namespace fs = std::filesystem; // -------------------------------------------------------------------- // recursively print exception whats: void print_what(const std::exception &e) { std::cerr << e.what() << '\n'; try { std::rethrow_if_nested(e); } catch (const std::exception &nested) { std::cerr << " >> "; print_what(nested); } } // -------------------------------------------------------------------- int d_main(int argc, const char *argv[]) { using namespace std::literals; auto &config = mcfp::config::instance(); config.init("Usage: mkdssp [options] input-file [output-file]", mcfp::make_option("output-format", "Output format, can be either 'dssp' for classic DSSP or 'mmcif' for annotated mmCIF. The default is chosen based on the extension of the output file, if any."), mcfp::make_option("min-pp-stretch", 3, "Minimal number of residues having PSI/PHI in range for a PP helix, default is 3"), mcfp::make_option("write-other", "If set, write the type OTHER for loops, default is to leave this out"), mcfp::make_option("no-dssp-categories", "If set, will suppress output of new DSSP output in mmCIF format"), mcfp::make_option("calculate-accessibility", "Default is to not calculate the surface accessibility when the output format is mmCIF"), mcfp::make_option("mmcif-dictionary", "Path to the mmcif_pdbx.dic file to use instead of default"), mcfp::make_option("help,h", "Display help message"), mcfp::make_option("version", "Print version"), mcfp::make_option("verbose,v", "verbose output"), mcfp::make_option("quiet", "Reduce verbose output to a minimum"), mcfp::make_hidden_option("debug,d", "Debug level (for even more verbose output)")); config.parse(argc, argv); // -------------------------------------------------------------------- if (config.has("version")) { write_version_string(std::cout, config.has("verbose")); exit(0); } if (config.has("help") or config.operands().empty()) { std::cerr << config << '\n'; exit(config.has("help") ? 0 : 1); } if (config.has("output-format") and config.get("output-format") != "dssp" and config.get("output-format") != "mmcif") { std::cerr << "Output format should be one of 'dssp' or 'mmcif'\n"; exit(1); } if (config.count("quiet")) cif::VERBOSE = -1; else cif::VERBOSE = config.count("verbose"); // -------------------------------------------------------------------- // private mmcif_pdbx dictionary? if (config.has("mmcif-dictionary")) { fs::path mmcif_dict = config.get("mmcif-dictionary"); cif::add_file_resource("mmcif_pdbx.dic", mmcif_dict); // Try to be smart, maybe dssp-extension.dic is at that location as well? auto dir = fs::canonical(mmcif_dict.parent_path()); if (auto dssp_dict = cif::load_resource("dssp-extension.dic"); dssp_dict == nullptr and fs::exists(dir / "dssp-extension.dic")) cif::add_data_directory(dir); } cif::file f; try { cif::gzio::ifstream in(config.operands().front()); if (not in.is_open()) { std::cerr << "Could not open file\n"; exit(1); } if (cif::VERBOSE > 0) std::cerr << "Loading file..."; f.load(in); if (cif::VERBOSE > 0) std::cerr << " fixup file..."; cif::pdb::fixup_pdbx(f); if (cif::VERBOSE > 0) std::cerr << " done\n"; } catch (const std::exception &e) { std::cerr << e.what() << '\n'; f = cif::pdb::read(config.operands().front()); } // -------------------------------------------------------------------- short pp_stretch = 3; if (config.has("min-pp-stretch")) pp_stretch = config.get("min-pp-stretch"); bool writeOther = config.has("write-other"); std::string fmt; if (config.has("output-format")) fmt = config.get("output-format"); fs::path output; if (config.operands().size() > 1) output = config.operands()[1]; if (fmt.empty() and not output.empty()) { if (output.extension() == ".gz" or output.extension() == ".xz") { if (output.stem().extension() == ".dssp") fmt = "dssp"; else fmt = "cif"; } else if (output.extension() == ".dssp") fmt = "dssp"; else fmt = "cif"; } if (fmt == "dssp") { // See if the data will fit at all auto &db = f.front(); for (const auto &[chain_id, seq_nr] : db["pdbx_poly_seq_scheme"].rows("pdb_strand_id", "pdb_seq_num")) { if (chain_id.length() > 1 or seq_nr > 99999) { std::cerr << "The data in this file won't fit in the old DSSP format, please use the mmCIF format instead.\n"; exit(2); } } } dssp dssp(f.front(), 1, pp_stretch, fmt == "dssp" or config.has("calculate-accessibility")); if (not output.empty()) { cif::gzio::ofstream out(output); if (not out.is_open()) { std::cerr << "Could not open output file\n"; exit(1); } if (fmt == "dssp") dssp.write_legacy_output(out); else { dssp.annotate(f.front(), writeOther, not config.has("no-dssp-categories")); out << f.front(); } } else { if (fmt == "dssp") dssp.write_legacy_output(std::cout); else { dssp.annotate(f.front(), writeOther, not config.has("no-dssp-categories")); std::cout << f.front(); } } return 0; } // -------------------------------------------------------------------- int main(int argc, const char *argv[]) { int result = 0; try { #if defined(DATA_DIR) cif::add_data_directory(DATA_DIR); #endif result = d_main(argc, argv); } catch (const std::exception &ex) { print_what(ex); exit(1); } return result; } PDB-REDO-dssp-ca06797/test/000077500000000000000000000000001516741327300151475ustar00rootroot00000000000000PDB-REDO-dssp-ca06797/test/1cbs-dssp-test.tsv000066400000000000000000000017341516741327300204660ustar00rootroot000000000000001 A _ 2 A _ 3 A _ 4 A _ 5 A E 6 A E 7 A E 8 A E 9 A E 10 A E 11 A E 12 A E 13 A E 14 A S 15 A H 16 A H 17 A H 18 A H 19 A H 20 A H 21 A H 22 A T 23 A T 24 A _ 25 A _ 26 A H 27 A H 28 A H 29 A H 30 A H 31 A H 32 A H 33 A H 34 A H 35 A H 36 A H 37 A T 38 A S 39 A _ 40 A E 41 A E 42 A E 43 A E 44 A E 45 A E 46 A E 47 A T 48 A T 49 A E 50 A E 51 A E 52 A E 53 A E 54 A E 55 A E 56 A _ 57 A S 58 A S 59 A _ 60 A E 61 A E 62 A E 63 A E 64 A E 65 A E 66 A E 67 A T 68 A T 69 A S 70 A _ 71 A E 72 A E 73 A E 74 A E 75 A _ 76 A T 77 A T 78 A S 79 A _ 80 A E 81 A E 82 A E 83 A E 84 A E 85 A E 86 A E 87 A E 88 A E 89 A E 90 A T 91 A T 92 A E 93 A E 94 A E 95 A E 96 A E 97 A E 98 A E 99 A E 100 A S 101 A S 102 A S 103 A _ 104 A _ 105 A _ 106 A _ 107 A E 108 A E 109 A E 110 A E 111 A E 112 A E 113 A E 114 A _ 115 A T 116 A T 117 A S 118 A _ 119 A E 120 A E 121 A E 122 A E 123 A E 124 A E 125 A E 126 A T 127 A T 128 A E 129 A E 130 A E 131 A E 132 A E 133 A E 134 A E 135 A E 136 A E 137 A _ PDB-REDO-dssp-ca06797/test/1cbs-dssp.cif000066400000000000000000005412011516741327300174340ustar00rootroot00000000000000data_1CBS # _entry.id 1CBS # loop_ _audit_conform.dict_name _audit_conform.dict_version _audit_conform.dict_location mmcif_pdbx.dic 5.279 http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic dssp-extension.dic 1.1.1 https://pdb-redo.eu/dssp/dssp-extension.dic # _struct_biol.id 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CELLULAR RETINOIC ACID BINDING PROTEIN TYPE II' 15581.802 1 ? ? ? ? 2 non-polymer syn 'RETINOIC ACID' 300.435 1 ? ? ? ? 3 water nat water 18.015 100 ? ? ? ? # _symmetry.entry_id 1CBS _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 10 _struct_site.details 'BINDING SITE FOR RESIDUE REA A 200' # _struct_sheet.id A _struct_sheet.number_strands 10 # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RABP2_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P29373 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRP CKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE ; _struct_ref.pdbx_db_isoform ? # _struct_keywords.entry_id 1CBS _struct_keywords.pdbx_keywords 'RETINOIC-ACID TRANSPORT' _struct_keywords.text 'RETINOIC-ACID TRANSPORT' # loop_ _struct_conf_type.id _struct_conf_type.criteria _struct_conf_type.reference OTHER DSSP . STRN DSSP . BEND DSSP . HELX_RH_AL_P DSSP . TURN_TY1_P DSSP . # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct.entry_id 1CBS _struct.title ;CRYSTAL STRUCTURE OF CELLULAR RETINOIC-ACID-BINDING PROTEINS I AND II IN COMPLEX WITH ALL-TRANS-RETINOIC ACID AND A SYNTHETIC RETINOID ; _struct.pdbx_descriptor 'CELLULAR RETINOIC-ACID-BINDING PROTEIN TYPE II COMPLEXED WITH ALL-TRANS-RETINOIC ACID (THE PRESUMED PHYSIOLOGICAL LIGAND)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1091 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 22 _refine_hist.number_atoms_solvent 100 _refine_hist.number_atoms_total 1213 _refine_hist.d_res_high 1.8 _refine_hist.d_res_low 8.0 # _refine.entry_id 1CBS _refine.ls_number_reflns_obs 14312 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 8.0 _refine.ls_d_res_high 1.8 _refine.ls_percent_reflns_obs 90.3 _refine.ls_R_factor_obs 0.2000000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2000000 _refine.ls_R_factor_R_free 0.2370000 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 16.6 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1CBS _pdbx_database_status.recvd_initial_deposition_date 1994-09-28 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site ? _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1995-01-26 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.70 _exptl_crystal.density_percent_sol 54.49 _exptl_crystal.description ? # _exptl.entry_id 1CBS _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'HUMAN CRABP-II' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line BL21 _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET-3A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _entity_poly.entity_id 1 _entity_poly.type polypeptide(L) _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRP CKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE ; _entity_poly.pdbx_seq_one_letter_code_can ;PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRP CKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _dssp_struct_summary.entry_id _dssp_struct_summary.label_asym_id _dssp_struct_summary.label_seq_id _dssp_struct_summary.label_comp_id _dssp_struct_summary.secondary_structure _dssp_struct_summary.ss_bridge _dssp_struct_summary.helix_3_10 _dssp_struct_summary.helix_alpha _dssp_struct_summary.helix_pi _dssp_struct_summary.helix_pp _dssp_struct_summary.bend _dssp_struct_summary.chirality _dssp_struct_summary.sheet _dssp_struct_summary.strand _dssp_struct_summary.ladder_1 _dssp_struct_summary.ladder_2 _dssp_struct_summary.accessibility _dssp_struct_summary.TCO _dssp_struct_summary.kappa _dssp_struct_summary.alpha _dssp_struct_summary.phi _dssp_struct_summary.psi _dssp_struct_summary.x_ca _dssp_struct_summary.y_ca _dssp_struct_summary.z_ca 1CBS A 1 PRO . . . . . . . . . . . . 64.2 . . . . 151.2 18.1 13.5 43.7 1CBS A 2 ASN . . . . . . . + . . . . 88.7 -0.903 . 172.5 -124.5 100.5 20.6 16.5 43.6 1CBS A 3 PHE . . . . . . . + . . . . 1.0 0.524 40.0 127.0 -80.0 -9.9 21.1 17.8 40.1 1CBS A 4 SER . . . . . . . + . . . . 28.4 -0.158 37.2 69.9 -55.6 140.2 23.2 20.8 41.5 1CBS A 5 GLY E . . . . . S - A A A . 19.5 -0.868 82.5 -67.6 145.0 177.2 26.6 21.5 40.1 1CBS A 6 ASN E . . . . . . - A A A . 77.7 -0.958 54.1 -159.8 -104.9 115.8 28.8 22.7 37.2 1CBS A 7 TRP E . . . . . . - A A A B 0.7 -0.824 13.0 -164.1 -107.0 141.0 28.5 20.1 34.4 1CBS A 8 LYS E . . . . . . - A A . B 92.2 -0.933 28.2 -112.8 -119.6 141.9 30.8 19.4 31.5 1CBS A 9 ILE E . . . . . . + A A . B 26.3 -0.449 32.7 170.7 -78.1 144.9 29.7 17.4 28.4 1CBS A 10 ILE E . . . . . . + A A . . 86.4 0.456 69.4 21.2 -126.0 -12.2 31.3 14.0 27.7 1CBS A 11 ARG E . . . . . . - A A . B 140.5 -0.954 53.6 -178.8 -159.0 138.7 29.0 12.7 24.9 1CBS A 12 SER E . . . . . . - A A . B 48.5 -0.982 9.1 -177.7 -140.7 127.1 26.6 14.2 22.3 1CBS A 13 GLU E . . . . . . - A A . B 95.4 -0.986 62.7 -1.8 -128.8 138.0 24.6 12.3 19.8 1CBS A 14 ASN S . . > . . S + . . . . 64.1 0.655 75.6 137.6 65.5 22.9 22.2 13.4 17.0 1CBS A 15 PHE H . . > . . S + . . . . 23.1 0.940 73.9 44.8 -66.9 -48.6 22.4 17.2 17.7 1CBS A 16 GLU H . . > . . S + . . . . 66.8 0.902 111.2 55.1 -61.6 -39.6 22.6 18.3 14.1 1CBS A 17 GLU H . . > . . S + . . . . 90.5 0.857 106.0 52.0 -60.9 -36.1 19.8 15.9 13.1 1CBS A 18 LEU H . . X . . S + . . . . 1.3 0.921 109.6 49.8 -65.5 -43.2 17.5 17.5 15.8 1CBS A 19 LEU H . . < > . S + . . . . 5.5 0.852 106.3 56.4 -65.4 -32.2 18.3 20.9 14.3 1CBS A 20 LYS H . > < 5 . S + . . . . 103.0 0.929 106.5 48.6 -65.1 -45.5 17.4 19.6 10.8 1CBS A 21 VAL H . 3 < 5 . S + . . . . 52.9 0.860 107.3 56.5 -62.3 -36.0 14.0 18.5 11.9 1CBS A 22 LEU T . 3 < 5 . S - . . . . 9.7 0.481 120.3 -112.1 -75.2 -4.6 13.4 21.9 13.6 1CBS A 23 GLY T . < . 5 . . + . . . . 63.3 0.696 58.8 158.5 84.0 20.3 14.1 23.5 10.2 1CBS A 24 VAL . . . . < . . - . . . . 27.8 -0.661 41.2 -117.3 -79.6 130.0 17.4 25.2 10.9 1CBS A 25 ASN . . . > . . . - . . . . 91.5 -0.143 25.5 -100.1 -67.0 161.3 19.4 25.9 7.6 1CBS A 26 VAL H . . > . . S + . . . . 96.6 0.835 117.9 43.9 -47.2 -52.0 22.8 24.4 6.7 1CBS A 27 MET H . . > . . S + . . . . 148.2 0.862 114.2 48.8 -67.6 -38.7 24.9 27.4 7.6 1CBS A 28 LEU H . . > . . S + . . . . 97.1 0.872 110.3 54.0 -68.8 -34.0 23.2 28.2 10.9 1CBS A 29 ARG H . . X . . S + . . . . 25.7 0.924 104.0 54.4 -63.4 -44.3 23.5 24.5 11.8 1CBS A 30 LYS H . . X . . S + . . . . 164.2 0.928 111.7 44.7 -54.8 -47.3 27.2 24.6 11.2 1CBS A 31 ILE H . . X . . S + . . . . 93.1 0.935 114.7 48.3 -62.9 -48.6 27.6 27.5 13.7 1CBS A 32 ALA H . . X . . S + . . . . 28.3 0.914 109.1 51.5 -61.0 -48.3 25.3 25.9 16.3 1CBS A 33 VAL H . . X . . S + . . . . 48.9 0.880 110.3 48.7 -59.1 -41.5 26.9 22.5 16.3 1CBS A 34 ALA H . > < . . S + . . . . 61.1 0.933 115.2 43.9 -65.9 -45.8 30.4 23.9 16.8 1CBS A 35 ALA H . > < . . S + . . . . 4.4 0.878 110.0 56.3 -68.1 -36.3 29.4 26.1 19.7 1CBS A 36 ALA H . 3 < . . S + . . . . 10.2 0.552 88.7 76.5 -73.9 -8.6 27.3 23.4 21.3 1CBS A 37 SER T . < < . . S + . . . . 74.1 0.667 103.3 35.9 -76.7 -14.7 30.2 21.0 21.5 1CBS A 38 LYS S . < . . . S + . . . . 128.6 -0.500 80.2 163.6 -135.8 65.0 31.7 22.9 24.5 1CBS A 39 PRO . . . . . . . - . . . . 13.2 -0.429 32.9 -139.6 -84.3 157.8 28.9 24.2 26.7 1CBS A 40 ALA E . . . . . . - A B . C 56.2 -0.988 25.8 -169.0 -111.4 121.5 29.2 25.4 30.3 1CBS A 41 VAL E . . . . . . - A B A C 7.4 -0.976 9.8 -176.7 -119.1 128.1 26.2 24.2 32.3 1CBS A 42 GLU E . . . . . . - A B A C 55.8 -0.984 2.8 -175.2 -124.9 124.3 25.3 25.3 35.8 1CBS A 43 ILE E . . . . . . - A B A C 3.3 -0.963 6.0 -174.1 -121.0 134.3 22.4 23.9 37.8 1CBS A 44 LYS E . . . . . . - A B . C 113.9 -0.998 10.8 -174.0 -126.7 121.9 21.1 25.1 41.2 1CBS A 45 GLN E . . . . . . + A B . C 29.0 -0.969 17.1 177.2 -122.2 135.7 18.4 23.0 42.9 1CBS A 46 GLU E . > . . . S - A B . C 166.4 -0.849 71.6 -60.6 -134.0 90.9 16.4 23.7 46.1 1CBS A 47 GLY T . 3 . . . S - . . . . 50.7 -0.529 121.1 -13.7 71.2 -119.2 13.9 21.0 46.5 1CBS A 48 ASP T . 3 . . . S + . . . . 67.4 0.233 116.9 99.1 -101.2 12.8 11.6 21.1 43.4 1CBS A 49 THR E . < . . . . - A C C D 68.9 -0.888 54.3 -172.5 -104.0 129.6 12.9 24.6 42.3 1CBS A 50 PHE E . . . . . . - A C C D 1.9 -0.901 22.3 -170.5 -127.8 149.5 15.5 24.7 39.6 1CBS A 51 TYR E . . . . . . - A C C D 40.8 -0.995 16.4 -175.9 -132.3 124.9 17.7 27.3 37.9 1CBS A 52 ILE E . . . . . . - A C C D 2.4 -0.980 5.8 -174.6 -131.1 119.3 19.5 26.0 34.8 1CBS A 53 LYS E . . . . . . - A C C D 71.2 -0.967 0.6 -175.0 -115.1 121.8 22.0 28.1 32.9 1CBS A 54 THR E . . . . . . - A C C D 32.3 -0.969 11.8 -170.1 -118.9 119.0 23.5 26.7 29.6 1CBS A 55 SER E . . . . . . + A C C D 40.3 -0.888 16.2 157.5 -120.5 137.5 26.2 28.9 28.0 1CBS A 56 THR . . . . . . . - . . . . 29.0 -0.899 55.0 -98.1 -140.6 168.5 28.0 28.8 24.7 1CBS A 57 THR S . . . . . S + . . . . 112.8 0.701 122.9 34.9 -62.8 -20.9 29.9 31.5 22.6 1CBS A 58 VAL S . . . . . S + . . . . 84.7 0.543 126.6 14.3 -112.4 -10.4 26.7 32.1 20.5 1CBS A 59 ARG . . . . . . . - . . . . 96.7 -0.899 52.0 -169.3 -169.0 135.3 23.8 31.7 22.9 1CBS A 60 THR E . . . . . . - A D D . 67.2 -0.986 9.4 -169.0 -129.9 134.7 23.1 31.5 26.6 1CBS A 61 THR E . . . . . . - A D D . 51.0 -0.957 4.9 -170.6 -124.3 144.3 19.8 30.4 28.2 1CBS A 62 GLU E . . . . . . - A D D . 111.9 -0.978 10.4 -175.8 -133.9 117.2 18.7 30.7 31.8 1CBS A 63 ILE E . . . . . . - A D D . 20.1 -0.892 10.3 -166.6 -118.8 147.4 15.5 29.0 32.9 1CBS A 64 ASN E . . . . . . + A D D . 108.7 -0.987 23.9 152.5 -130.4 122.4 13.8 29.1 36.3 1CBS A 65 PHE E . . . . . . - A D D . 10.0 -0.977 38.3 -140.1 -149.7 160.9 11.1 26.6 37.1 1CBS A 66 LYS E . > . . . . - A D D . 82.3 -0.972 44.0 -104.7 -117.8 132.7 9.3 24.7 39.8 1CBS A 67 VAL T . 3 . . . S + . . . . 16.5 -0.410 107.2 20.4 -59.2 130.3 8.3 21.1 39.0 1CBS A 68 GLY T . 3 . . . S + . . . . 48.4 0.378 103.5 101.8 91.4 -2.6 4.6 21.0 38.3 1CBS A 69 GLU S . < . . . S - . . . . 111.1 -0.957 74.5 -116.4 -119.7 127.6 4.2 24.7 37.6 1CBS A 70 GLU . . . . . . . + . . . . 126.0 -0.295 39.9 168.6 -62.3 140.7 3.9 26.1 34.1 1CBS A 71 PHE E . . . . . . - A E E . 24.7 -0.902 30.8 -112.1 -143.5 174.1 6.6 28.4 32.8 1CBS A 72 GLU E . . . . . . + A E E . 111.6 -0.936 45.1 135.3 -119.4 132.7 7.8 30.1 29.6 1CBS A 73 GLU E . . . . . . - A E E . 25.4 -0.644 46.1 -93.1 -144.9 -154.3 11.1 29.3 27.8 1CBS A 74 GLN E . . . . . . - A E E . 82.8 -0.963 28.5 -111.5 -135.1 153.8 12.2 28.7 24.2 1CBS A 75 THR . . > . . . . - . . . . 0.6 -0.283 47.6 -93.9 -71.7 171.4 12.7 25.7 22.1 1CBS A 76 VAL T . 3 . . . S + . . . . 54.3 0.849 128.4 51.8 -56.9 -37.1 16.3 24.8 21.0 1CBS A 77 ASP T . 3 . . . S - . . . . 48.7 0.327 127.9 -97.4 -83.5 6.0 15.9 26.7 17.8 1CBS A 78 GLY S . < . . . S + . . . . 23.3 0.611 72.7 141.1 93.1 16.9 14.7 29.8 19.7 1CBS A 79 ARG . . . . . . . - . . . . 63.6 -0.765 54.5 -109.8 -96.9 133.7 10.9 29.8 19.6 1CBS A 80 PRO E . . . . . . + A F E . 49.8 -0.292 46.8 167.2 -58.4 138.3 8.8 30.9 22.7 1CBS A 81 CYS E . . . . . . - A F E F 0.6 -0.957 38.3 -118.4 -150.0 160.5 6.9 28.1 24.3 1CBS A 82 LYS E . . . . . . - A F E F 60.4 -0.910 38.2 -165.0 -100.8 129.3 5.0 27.2 27.5 1CBS A 83 SER E . . . . . . - A F E F 0.6 -0.889 17.2 -169.4 -121.5 152.9 6.6 24.4 29.4 1CBS A 84 LEU E . . . . . . - A F . F 42.9 -0.956 10.3 -159.2 -142.2 117.6 5.6 22.0 32.2 1CBS A 85 VAL E . . . . . . + A F . F 0.0 -0.800 14.0 174.8 -100.5 138.7 8.0 19.7 34.0 1CBS A 86 LYS E . . . . . . - A F . F 128.7 -0.944 39.0 -104.1 -136.9 158.9 6.9 16.6 35.9 1CBS A 87 TRP E . . . . . . - A F . F 77.3 -0.765 29.3 -178.2 -84.3 111.9 8.8 13.8 37.7 1CBS A 88 GLU E . . . . . S - A F . . 120.5 0.875 78.2 -15.4 -73.2 -40.5 8.5 10.8 35.4 1CBS A 89 SER E . > . . . S - A F . F 60.4 -0.870 89.8 -77.8 -147.6 178.8 10.4 9.0 38.2 1CBS A 90 GLU T . 3 . . . S + . . . . 147.8 0.832 129.7 27.0 -53.9 -37.5 12.4 9.8 41.3 1CBS A 91 ASN T . 3 . . . S + . . . . 58.7 0.218 112.5 75.7 -112.6 15.7 15.6 10.8 39.3 1CBS A 92 LYS E . < . . . . - A G F G 38.2 -0.974 53.0 -169.2 -137.7 122.3 14.0 11.8 36.0 1CBS A 93 MET E . . . . . . - A G F G 0.3 -0.837 8.1 -161.9 -106.2 143.0 12.2 15.0 35.0 1CBS A 94 VAL E . . . . . . - A G F G 39.4 -0.986 1.9 -157.3 -125.6 138.7 10.3 15.3 31.7 1CBS A 95 CYS E . . . . . . - A G F G 0.0 -0.966 1.7 -159.1 -122.0 124.5 9.2 18.6 30.1 1CBS A 96 GLU E . . . . . . - A G F G 123.0 -0.855 15.7 -156.1 -99.8 132.1 6.3 19.0 27.6 1CBS A 97 GLN E . . . . . . - A G F . 12.2 -0.895 10.9 -169.7 -114.4 144.9 6.5 22.1 25.4 1CBS A 98 LYS E . . . . . . - A G F . 131.2 -0.988 28.2 -118.8 -134.2 119.6 3.7 24.0 23.6 1CBS A 99 LEU E . . . . . . - A G F . 36.8 -0.354 11.5 -147.7 -60.2 132.2 4.4 26.7 21.0 1CBS A 100 LEU S . . . . . S + . . . . 52.2 0.859 84.4 11.3 -67.3 -37.4 2.9 30.1 22.1 1CBS A 101 LYS S . . . . . S + . . . . 147.9 -0.997 113.0 4.8 -144.1 142.6 2.3 31.0 18.4 1CBS A 102 GLY S . . . . . S - . . . . 59.5 -0.340 76.5 -76.8 87.0 -168.2 2.4 29.0 15.2 1CBS A 103 GLU . . . . . . . + . . . . 183.8 -0.879 52.2 128.8 -132.0 164.5 3.0 25.3 14.4 1CBS A 104 GLY . . . . . . . - . . . . 44.4 -0.963 58.5 -33.3 169.2 -177.6 6.0 23.0 14.2 1CBS A 105 PRO . . . . . . . - . . . . 23.4 -0.225 67.0 -102.9 -59.3 151.2 7.3 19.6 15.4 1CBS A 106 LYS . . . . . . . - . . . . 95.9 -0.674 48.7 -165.6 -76.9 125.9 6.3 18.5 18.9 1CBS A 107 THR E . . . . . . + A H . H 10.5 -0.856 18.9 154.7 -118.8 155.7 9.2 19.1 21.2 1CBS A 108 SER E . . . . . . - A H G H 32.2 -0.947 19.8 -150.9 -161.2 170.5 10.2 18.0 24.7 1CBS A 109 TRP E . . . . . . - A H G H 14.1 -0.975 4.3 -163.0 -149.0 154.2 13.2 17.4 26.9 1CBS A 110 THR E . . . . . . - A H G H 12.8 -0.971 1.6 -163.6 -137.0 150.2 14.2 15.2 29.8 1CBS A 111 ARG E . . . . . . + A H G H 25.4 -0.997 16.0 174.7 -134.8 130.2 17.0 15.4 32.4 1CBS A 112 GLU E . . . . . . - A H G H 52.0 -1.000 28.6 -136.1 -142.5 143.9 18.0 12.4 34.5 1CBS A 113 LEU E . . . . . . - A H . H 27.5 -0.866 30.0 -148.1 -95.8 122.9 20.6 11.5 37.1 1CBS A 114 THR . . > . . . . - . . . . 40.4 -0.402 26.2 -103.8 -89.5 168.1 22.1 8.1 36.5 1CBS A 115 ASN T . 3 . . . S + . . . . 178.7 0.705 117.8 58.2 -62.1 -23.8 23.4 5.5 39.0 1CBS A 116 ASP T . 3 . . . S - . . . . 107.7 0.354 122.5 -100.0 -88.4 4.3 27.1 6.4 38.1 1CBS A 117 GLY S . < . . . S + . . . . 37.0 0.513 82.4 124.3 91.4 6.2 26.7 10.0 39.0 1CBS A 118 GLU . . . . . . . - . . . . 52.9 -0.405 55.4 -126.8 -95.6 171.5 26.2 11.4 35.5 1CBS A 119 LEU E . . . . . . - A I H I 2.2 -0.980 15.1 -160.0 -121.9 126.8 23.5 13.5 33.9 1CBS A 120 ILE E . . . . . . - A I H I 37.9 -0.956 6.4 -170.8 -109.9 123.8 21.6 12.5 30.7 1CBS A 121 LEU E . . . . . . - A I H I 10.3 -0.932 3.2 -171.6 -108.9 129.8 19.8 15.2 28.8 1CBS A 122 THR E . . . . . . - A I H I 22.1 -0.970 3.8 -167.5 -121.6 141.7 17.5 14.2 25.9 1CBS A 123 MET E . . . . . . - A I H I 24.1 -0.998 9.6 -161.5 -125.0 135.5 15.9 16.6 23.5 1CBS A 124 THR E . . . . . . + A I H I 29.6 -0.935 19.0 178.7 -124.9 143.7 13.1 15.5 21.1 1CBS A 125 ALA E . > . . . S - A I H I 0.0 -0.925 73.9 -54.0 -140.0 107.7 11.6 17.0 17.9 1CBS A 126 ASP T . 3 . . . S - . . . . 88.2 -0.384 123.7 -18.3 55.7 -116.0 8.9 14.7 16.5 1CBS A 127 ASP T . 3 . . . S + . . . . 160.0 0.444 114.9 98.5 -100.3 2.3 10.7 11.3 16.3 1CBS A 128 VAL E . < . . . . - A J . I 36.7 -0.776 54.5 -163.7 -93.6 129.4 14.3 12.5 16.4 1CBS A 129 VAL E . . . . . . - A J . I 64.8 -0.950 7.7 -158.5 -118.4 128.4 16.1 12.3 19.8 1CBS A 130 CYS E . . . . . . - A J . I 0.0 -0.908 11.2 -160.7 -103.2 129.9 19.3 14.0 20.8 1CBS A 131 THR E . . . . . . + A J B I 49.4 -0.947 11.6 176.6 -116.6 123.9 21.2 12.5 23.7 1CBS A 132 ARG E . . . . . . - A J B I 13.8 -0.990 10.2 -160.7 -128.1 136.6 23.9 14.4 25.7 1CBS A 133 VAL E . . . . . . - A J B I 15.7 -0.947 10.3 -175.8 -120.4 137.5 25.7 13.1 28.7 1CBS A 134 TYR E . . . . . . - A J B I 10.6 -0.896 12.9 -164.0 -131.0 162.0 27.5 15.2 31.3 1CBS A 135 VAL E . . . . . . - A J B . 51.3 -0.938 40.8 -90.9 -137.8 151.6 29.7 14.8 34.4 1CBS A 136 ARG E . . . . . . . A J B . 96.4 -0.432 . . -67.1 146.1 30.5 17.4 37.0 1CBS A 137 GLU . . . . . . . . . . . . 182.5 -0.363 . . -61.5 . 33.6 19.4 36.4 # loop_ _dssp_struct_ladder.id _dssp_struct_ladder.sheet_id _dssp_struct_ladder.range_id_1 _dssp_struct_ladder.range_id_2 _dssp_struct_ladder.type _dssp_struct_ladder.beg_1_label_comp_id _dssp_struct_ladder.beg_1_label_asym_id _dssp_struct_ladder.beg_1_label_seq_id _dssp_struct_ladder.pdbx_beg_1_PDB_ins_code _dssp_struct_ladder.end_1_label_comp_id _dssp_struct_ladder.end_1_label_asym_id _dssp_struct_ladder.end_1_label_seq_id _dssp_struct_ladder.pdbx_end_1_PDB_ins_code _dssp_struct_ladder.beg_1_auth_comp_id _dssp_struct_ladder.beg_1_auth_asym_id _dssp_struct_ladder.beg_1_auth_seq_id _dssp_struct_ladder.end_1_auth_comp_id _dssp_struct_ladder.end_1_auth_asym_id _dssp_struct_ladder.end_1_auth_seq_id _dssp_struct_ladder.beg_2_label_comp_id _dssp_struct_ladder.beg_2_label_asym_id _dssp_struct_ladder.beg_2_label_seq_id _dssp_struct_ladder.pdbx_beg_2_PDB_ins_code _dssp_struct_ladder.end_2_label_comp_id _dssp_struct_ladder.end_2_label_asym_id _dssp_struct_ladder.end_2_label_seq_id _dssp_struct_ladder.pdbx_end_2_PDB_ins_code _dssp_struct_ladder.beg_2_auth_comp_id _dssp_struct_ladder.beg_2_auth_asym_id _dssp_struct_ladder.beg_2_auth_seq_id _dssp_struct_ladder.end_2_auth_comp_id _dssp_struct_ladder.end_2_auth_asym_id _dssp_struct_ladder.end_2_auth_seq_id A A A B anti-parallel GLY A 5 ? TRP A 7 ? GLY A 5 TRP A 7 ILE A 43 ? VAL A 41 ? ILE A 43 VAL A 41 B A A J anti-parallel TRP A 7 ? GLU A 13 ? TRP A 7 GLU A 13 ARG A 136 ? THR A 131 ? ARG A 136 THR A 131 C A B C anti-parallel ALA A 40 ? GLU A 46 ? ALA A 40 GLU A 46 SER A 55 ? THR A 49 ? SER A 55 THR A 49 D A C D anti-parallel THR A 49 ? SER A 55 ? THR A 49 SER A 55 LYS A 66 ? THR A 60 ? LYS A 66 THR A 60 E A E F anti-parallel PHE A 71 ? GLN A 74 ? PHE A 71 GLN A 74 SER A 83 ? PRO A 80 ? SER A 83 PRO A 80 F A F G anti-parallel CYS A 81 ? SER A 89 ? CYS A 81 SER A 89 LEU A 99 ? LYS A 92 ? LEU A 99 LYS A 92 G A G H anti-parallel LYS A 92 ? GLU A 96 ? LYS A 92 GLU A 96 GLU A 112 ? SER A 108 ? GLU A 112 SER A 108 H A H I anti-parallel THR A 107 ? LEU A 113 ? THR A 107 LEU A 113 ALA A 125 ? LEU A 119 ? ALA A 125 LEU A 119 I A I J anti-parallel LEU A 119 ? ALA A 125 ? LEU A 119 ALA A 125 TYR A 134 ? VAL A 128 ? TYR A 134 VAL A 128 # loop_ _dssp_struct_bridge_pairs.id _dssp_struct_bridge_pairs.label_comp_id _dssp_struct_bridge_pairs.label_seq_id _dssp_struct_bridge_pairs.label_asym_id _dssp_struct_bridge_pairs.auth_seq_id _dssp_struct_bridge_pairs.auth_asym_id _dssp_struct_bridge_pairs.pdbx_PDB_ins_code _dssp_struct_bridge_pairs.acceptor_1_label_comp_id _dssp_struct_bridge_pairs.acceptor_1_label_seq_id _dssp_struct_bridge_pairs.acceptor_1_label_asym_id _dssp_struct_bridge_pairs.acceptor_1_auth_seq_id _dssp_struct_bridge_pairs.acceptor_1_auth_asym_id _dssp_struct_bridge_pairs.acceptor_1_pdbx_PDB_ins_code _dssp_struct_bridge_pairs.acceptor_1_energy _dssp_struct_bridge_pairs.acceptor_2_label_comp_id _dssp_struct_bridge_pairs.acceptor_2_label_seq_id _dssp_struct_bridge_pairs.acceptor_2_label_asym_id _dssp_struct_bridge_pairs.acceptor_2_auth_seq_id _dssp_struct_bridge_pairs.acceptor_2_auth_asym_id _dssp_struct_bridge_pairs.acceptor_2_pdbx_PDB_ins_code _dssp_struct_bridge_pairs.acceptor_2_energy _dssp_struct_bridge_pairs.donor_1_label_comp_id _dssp_struct_bridge_pairs.donor_1_label_seq_id _dssp_struct_bridge_pairs.donor_1_label_asym_id _dssp_struct_bridge_pairs.donor_1_auth_seq_id _dssp_struct_bridge_pairs.donor_1_auth_asym_id _dssp_struct_bridge_pairs.donor_1_pdbx_PDB_ins_code _dssp_struct_bridge_pairs.donor_1_energy _dssp_struct_bridge_pairs.donor_2_label_comp_id _dssp_struct_bridge_pairs.donor_2_label_seq_id _dssp_struct_bridge_pairs.donor_2_label_asym_id _dssp_struct_bridge_pairs.donor_2_auth_seq_id _dssp_struct_bridge_pairs.donor_2_auth_asym_id _dssp_struct_bridge_pairs.donor_2_pdbx_PDB_ins_code _dssp_struct_bridge_pairs.donor_2_energy 1 PRO 1 A 1 A ? . . . . . . . . . . . . . . PHE 3 A 3 A ? -0.5 LYS 92 A 92 A ? -0.0 2 ASN 2 A 2 A ? PHE 3 A 3 A ? -0.1 SER 4 A 4 A ? -0.1 ASN 91 A 91 A ? -0.0 GLU 46 A 46 A ? -0.0 3 PHE 3 A 3 A ? PRO 1 A 1 A ? -0.5 LEU 113 A 113 A ? -0.0 ILE 43 A 43 A ? -0.2 ASN 2 A 2 A ? -0.1 4 SER 4 A 4 A ? GLN 45 A 45 A ? -0.1 GLU 42 A 42 A ? -0.1 ASN 6 A 6 A ? -0.3 LYS 44 A 44 A ? -0.2 5 GLY 5 A 5 A ? ILE 43 A 43 A ? -2.5 TRP 7 A 7 A ? -0.1 ILE 43 A 43 A ? -2.6 TRP 7 A 7 A ? -0.6 6 ASN 6 A 6 A ? SER 4 A 4 A ? -0.3 GLU 42 A 42 A ? -0.2 GLU 137 A 137 A ? -2.8 LYS 8 A 8 A ? -0.4 7 TRP 7 A 7 A ? VAL 41 A 41 A ? -2.8 GLY 5 A 5 A ? -0.6 VAL 41 A 41 A ? -1.4 ILE 9 A 9 A ? -0.4 8 LYS 8 A 8 A ? VAL 135 A 135 A ? -3.0 ASN 6 A 6 A ? -0.4 VAL 135 A 135 A ? -2.3 ILE 10 A 10 A ? -0.1 9 ILE 9 A 9 A ? PRO 39 A 39 A ? -0.4 TRP 7 A 7 A ? -0.4 TYR 134 A 134 A ? -0.3 SER 12 A 12 A ? -0.1 10 ILE 10 A 10 A ? VAL 133 A 133 A ? -3.1 ARG 11 A 11 A ? -0.4 SER 12 A 12 A ? -0.3 TYR 134 A 134 A ? -0.2 11 ARG 11 A 11 A ? VAL 133 A 133 A ? -1.3 GLU 13 A 13 A ? -0.0 VAL 133 A 133 A ? -2.5 ILE 10 A 10 A ? -0.4 12 SER 12 A 12 A ? ILE 10 A 10 A ? -0.3 ARG 132 A 132 A ? -0.2 ASN 14 A 14 A ? -0.4 ARG 132 A 132 A ? -0.2 13 GLU 13 A 13 A ? THR 131 A 131 A ? -2.5 ARG 11 A 11 A ? -0.4 THR 131 A 131 A ? -1.5 ARG 11 A 11 A ? -0.0 14 ASN 14 A 14 A ? SER 12 A 12 A ? -0.4 CYS 130 A 130 A ? -0.2 LEU 18 A 18 A ? -1.6 LEU 19 A 19 A ? -0.1 15 PHE 15 A 15 A ? GLU 17 A 17 A ? -0.2 GLU 16 A 16 A ? -0.2 LEU 19 A 19 A ? -1.9 LYS 20 A 20 A ? -0.1 16 GLU 16 A 16 A ? GLU 17 A 17 A ? -0.2 LEU 18 A 18 A ? -0.2 LYS 20 A 20 A ? -2.0 PHE 15 A 15 A ? -0.2 17 GLU 17 A 17 A ? LEU 18 A 18 A ? -0.2 LEU 19 A 19 A ? -0.2 VAL 21 A 21 A ? -1.8 GLU 16 A 16 A ? -0.2 18 LEU 18 A 18 A ? ASN 14 A 14 A ? -1.6 LEU 19 A 19 A ? -0.2 LEU 22 A 22 A ? -1.7 GLU 17 A 17 A ? -0.2 19 LEU 19 A 19 A ? PHE 15 A 15 A ? -1.9 LYS 20 A 20 A ? -0.2 VAL 24 A 24 A ? -2.4 GLU 17 A 17 A ? -0.2 20 LYS 20 A 20 A ? GLU 16 A 16 A ? -2.0 VAL 21 A 21 A ? -0.2 GLY 23 A 23 A ? -1.5 LEU 19 A 19 A ? -0.2 21 VAL 21 A 21 A ? GLU 17 A 17 A ? -1.8 LEU 22 A 22 A ? -0.3 LYS 20 A 20 A ? -0.2 LEU 19 A 19 A ? -0.2 22 LEU 22 A 22 A ? LEU 18 A 18 A ? -1.7 GLU 17 A 17 A ? -0.1 VAL 21 A 21 A ? -0.3 LYS 20 A 20 A ? -0.2 23 GLY 23 A 23 A ? LYS 20 A 20 A ? -1.5 VAL 24 A 24 A ? -0.2 ASN 25 A 25 A ? -0.4 LYS 20 A 20 A ? -0.2 24 VAL 24 A 24 A ? LEU 19 A 19 A ? -2.4 ASN 25 A 25 A ? -0.1 GLY 23 A 23 A ? -0.2 LEU 22 A 22 A ? -0.1 25 ASN 25 A 25 A ? GLY 23 A 23 A ? -0.4 VAL 26 A 26 A ? -0.1 ARG 29 A 29 A ? -2.5 LEU 28 A 28 A ? -0.2 26 VAL 26 A 26 A ? MET 27 A 27 A ? -0.2 LEU 28 A 28 A ? -0.2 LYS 30 A 30 A ? -1.9 ILE 31 A 31 A ? -0.1 27 MET 27 A 27 A ? ARG 29 A 29 A ? -0.2 LEU 28 A 28 A ? -0.2 ILE 31 A 31 A ? -1.7 VAL 26 A 26 A ? -0.2 28 LEU 28 A 28 A ? ASN 25 A 25 A ? -0.2 LYS 30 A 30 A ? -0.2 ALA 32 A 32 A ? -2.6 MET 27 A 27 A ? -0.2 29 ARG 29 A 29 A ? ASN 25 A 25 A ? -2.5 ILE 31 A 31 A ? -0.2 VAL 33 A 33 A ? -3.0 ALA 34 A 34 A ? -0.3 30 LYS 30 A 30 A ? VAL 26 A 26 A ? -1.9 ILE 31 A 31 A ? -0.2 ALA 34 A 34 A ? -1.6 ARG 29 A 29 A ? -0.2 31 ILE 31 A 31 A ? MET 27 A 27 A ? -1.7 ALA 32 A 32 A ? -0.2 ALA 35 A 35 A ? -1.9 ARG 29 A 29 A ? -0.2 32 ALA 32 A 32 A ? LEU 28 A 28 A ? -2.6 VAL 33 A 33 A ? -0.2 ALA 36 A 36 A ? -2.6 LYS 30 A 30 A ? -0.2 33 VAL 33 A 33 A ? ARG 29 A 29 A ? -3.0 ALA 34 A 34 A ? -0.2 SER 37 A 37 A ? -0.5 ALA 32 A 32 A ? -0.2 34 ALA 34 A 34 A ? LYS 30 A 30 A ? -1.6 ARG 29 A 29 A ? -0.3 SER 37 A 37 A ? -0.8 LYS 38 A 38 A ? -0.2 35 ALA 35 A 35 A ? ILE 31 A 31 A ? -1.9 ALA 36 A 36 A ? -0.2 LYS 38 A 38 A ? -1.2 THR 57 A 57 A ? -0.2 36 ALA 36 A 36 A ? ALA 32 A 32 A ? -2.6 SER 37 A 37 A ? -0.2 ALA 35 A 35 A ? -0.2 ALA 34 A 34 A ? -0.2 37 SER 37 A 37 A ? ALA 34 A 34 A ? -0.8 VAL 33 A 33 A ? -0.5 ALA 36 A 36 A ? -0.2 ALA 35 A 35 A ? -0.1 38 LYS 38 A 38 A ? ALA 35 A 35 A ? -1.2 ALA 34 A 34 A ? -0.2 SER 37 A 37 A ? -0.2 THR 57 A 57 A ? -0.1 39 PRO 39 A 39 A ? . . . . . . . . . . . . . . VAL 41 A 41 A ? -0.5 ILE 9 A 9 A ? -0.4 40 ALA 40 A 40 A ? SER 55 A 55 A ? -2.1 LYS 38 A 38 A ? -0.1 SER 55 A 55 A ? -3.0 GLU 42 A 42 A ? -0.5 41 VAL 41 A 41 A ? TRP 7 A 7 A ? -1.4 PRO 39 A 39 A ? -0.5 TRP 7 A 7 A ? -2.8 ILE 43 A 43 A ? -0.5 42 GLU 42 A 42 A ? LYS 53 A 53 A ? -2.5 ALA 40 A 40 A ? -0.5 LYS 53 A 53 A ? -2.6 LYS 44 A 44 A ? -0.4 43 ILE 43 A 43 A ? GLY 5 A 5 A ? -2.6 VAL 41 A 41 A ? -0.5 GLY 5 A 5 A ? -2.5 GLN 45 A 45 A ? -0.4 44 LYS 44 A 44 A ? TYR 51 A 51 A ? -2.2 GLU 42 A 42 A ? -0.4 TYR 51 A 51 A ? -1.8 GLU 46 A 46 A ? -0.4 45 GLN 45 A 45 A ? ILE 43 A 43 A ? -0.4 PHE 50 A 50 A ? -0.2 GLY 47 A 47 A ? -0.4 PHE 50 A 50 A ? -0.2 46 GLU 46 A 46 A ? THR 49 A 49 A ? -2.5 LYS 44 A 44 A ? -0.4 THR 49 A 49 A ? -1.7 ASP 48 A 48 A ? -0.5 47 GLY 47 A 47 A ? GLN 45 A 45 A ? -0.4 ASP 48 A 48 A ? -0.3 GLU 46 A 46 A ? -0.0 LYS 66 A 66 A ? -0.0 48 ASP 48 A 48 A ? GLU 46 A 46 A ? -0.5 GLN 45 A 45 A ? -0.1 VAL 67 A 67 A ? -2.4 PHE 50 A 50 A ? -0.5 49 THR 49 A 49 A ? GLU 46 A 46 A ? -1.7 LYS 66 A 66 A ? -0.2 GLU 46 A 46 A ? -2.5 TYR 51 A 51 A ? -0.3 50 PHE 50 A 50 A ? PHE 65 A 65 A ? -3.0 ASP 48 A 48 A ? -0.5 PHE 65 A 65 A ? -2.1 ILE 52 A 52 A ? -0.4 51 TYR 51 A 51 A ? LYS 44 A 44 A ? -1.8 THR 49 A 49 A ? -0.3 LYS 44 A 44 A ? -2.2 LYS 53 A 53 A ? -0.4 52 ILE 52 A 52 A ? ILE 63 A 63 A ? -2.3 PHE 50 A 50 A ? -0.4 ILE 63 A 63 A ? -2.5 THR 54 A 54 A ? -0.5 53 LYS 53 A 53 A ? GLU 42 A 42 A ? -2.6 TYR 51 A 51 A ? -0.4 GLU 42 A 42 A ? -2.5 SER 55 A 55 A ? -0.5 54 THR 54 A 54 A ? THR 61 A 61 A ? -2.5 ILE 52 A 52 A ? -0.5 THR 61 A 61 A ? -2.3 THR 56 A 56 A ? -0.4 55 SER 55 A 55 A ? ALA 40 A 40 A ? -3.0 LYS 53 A 53 A ? -0.5 ALA 40 A 40 A ? -2.1 THR 57 A 57 A ? -0.3 56 THR 56 A 56 A ? ARG 59 A 59 A ? -0.9 THR 54 A 54 A ? -0.4 ARG 59 A 59 A ? -0.3 ALA 36 A 36 A ? -0.1 57 THR 57 A 57 A ? SER 55 A 55 A ? -0.3 ALA 35 A 35 A ? -0.2 THR 60 A 60 A ? -0.1 ALA 36 A 36 A ? -0.0 58 VAL 58 A 58 A ? ARG 59 A 59 A ? -0.3 ALA 32 A 32 A ? -0.1 THR 60 A 60 A ? -0.3 THR 57 A 57 A ? -0.2 59 ARG 59 A 59 A ? THR 56 A 56 A ? -0.3 ALA 35 A 35 A ? -0.1 THR 56 A 56 A ? -0.9 THR 61 A 61 A ? -0.4 60 THR 60 A 60 A ? VAL 58 A 58 A ? -0.3 SER 55 A 55 A ? -0.2 GLU 62 A 62 A ? -0.4 SER 55 A 55 A ? -0.2 61 THR 61 A 61 A ? THR 54 A 54 A ? -2.3 ARG 59 A 59 A ? -0.4 THR 54 A 54 A ? -2.5 ILE 63 A 63 A ? -0.4 62 GLU 62 A 62 A ? THR 60 A 60 A ? -0.4 LYS 53 A 53 A ? -0.2 ASN 64 A 64 A ? -0.3 LYS 53 A 53 A ? -0.2 63 ILE 63 A 63 A ? ILE 52 A 52 A ? -2.5 THR 61 A 61 A ? -0.4 ILE 52 A 52 A ? -2.3 PHE 65 A 65 A ? -0.4 64 ASN 64 A 64 A ? GLU 62 A 62 A ? -0.3 TYR 51 A 51 A ? -0.2 LYS 66 A 66 A ? -0.3 TYR 51 A 51 A ? -0.2 65 PHE 65 A 65 A ? PHE 50 A 50 A ? -2.1 ILE 63 A 63 A ? -0.4 PHE 50 A 50 A ? -3.0 VAL 67 A 67 A ? -0.4 66 LYS 66 A 66 A ? GLU 69 A 69 A ? -0.4 ASN 64 A 64 A ? -0.3 GLU 69 A 69 A ? -2.0 VAL 85 A 85 A ? -0.3 67 VAL 67 A 67 A ? ASP 48 A 48 A ? -2.4 PHE 65 A 65 A ? -0.4 LYS 86 A 86 A ? -0.2 GLU 70 A 70 A ? -0.1 68 GLY 68 A 68 A ? VAL 85 A 85 A ? -2.7 GLU 69 A 69 A ? -0.2 GLU 70 A 70 A ? -0.5 VAL 67 A 67 A ? -0.3 69 GLU 69 A 69 A ? LYS 66 A 66 A ? -2.0 VAL 85 A 85 A ? -0.1 LYS 66 A 66 A ? -0.4 VAL 85 A 85 A ? -0.4 70 GLU 70 A 70 A ? GLY 68 A 68 A ? -0.5 LEU 84 A 84 A ? -0.1 GLU 72 A 72 A ? -0.3 LEU 84 A 84 A ? -0.2 71 PHE 71 A 71 A ? SER 83 A 83 A ? -2.4 PHE 65 A 65 A ? -0.1 SER 83 A 83 A ? -3.2 GLU 73 A 73 A ? -0.4 72 GLU 72 A 72 A ? GLU 70 A 70 A ? -0.3 LYS 82 A 82 A ? -0.2 LYS 82 A 82 A ? -0.2 GLN 74 A 74 A ? -0.2 73 GLU 73 A 73 A ? CYS 81 A 81 A ? -2.1 PHE 71 A 71 A ? -0.4 CYS 81 A 81 A ? -2.4 THR 75 A 75 A ? -0.3 74 GLN 74 A 74 A ? PRO 80 A 80 A ? -0.3 GLU 72 A 72 A ? -0.2 LEU 99 A 99 A ? -0.0 VAL 76 A 76 A ? -0.0 75 THR 75 A 75 A ? ARG 79 A 79 A ? -2.6 GLU 73 A 73 A ? -0.3 GLY 78 A 78 A ? -2.1 CYS 81 A 81 A ? -0.0 76 VAL 76 A 76 A ? ASP 77 A 77 A ? -0.3 GLY 78 A 78 A ? -0.1 THR 75 A 75 A ? -0.1 LEU 19 A 19 A ? -0.0 77 ASP 77 A 77 A ? ARG 79 A 79 A ? -0.1 GLY 78 A 78 A ? -0.0 VAL 76 A 76 A ? -0.3 THR 75 A 75 A ? -0.0 78 GLY 78 A 78 A ? THR 75 A 75 A ? -2.1 ARG 79 A 79 A ? -0.2 VAL 76 A 76 A ? -0.1 ASP 77 A 77 A ? -0.0 79 ARG 79 A 79 A ? PRO 80 A 80 A ? -0.1 LEU 100 A 100 A ? -0.0 THR 75 A 75 A ? -2.6 GLY 78 A 78 A ? -0.2 80 PRO 80 A 80 A ? . . . . . . . . . . . . . . LEU 100 A 100 A ? -1.6 LYS 101 A 101 A ? -0.5 81 CYS 81 A 81 A ? GLU 73 A 73 A ? -2.4 LEU 99 A 99 A ? -0.2 GLU 73 A 73 A ? -2.1 SER 83 A 83 A ? -0.5 82 LYS 82 A 82 A ? LYS 98 A 98 A ? -2.5 PRO 80 A 80 A ? -0.3 LYS 98 A 98 A ? -2.1 LEU 84 A 84 A ? -0.3 83 SER 83 A 83 A ? PHE 71 A 71 A ? -3.2 CYS 81 A 81 A ? -0.5 PHE 71 A 71 A ? -2.4 VAL 85 A 85 A ? -0.4 84 LEU 84 A 84 A ? GLU 96 A 96 A ? -1.4 LYS 82 A 82 A ? -0.3 GLU 96 A 96 A ? -2.0 LYS 86 A 86 A ? -0.4 85 VAL 85 A 85 A ? GLU 69 A 69 A ? -0.4 SER 83 A 83 A ? -0.4 GLY 68 A 68 A ? -2.7 TRP 87 A 87 A ? -0.3 86 LYS 86 A 86 A ? VAL 94 A 94 A ? -2.4 LEU 84 A 84 A ? -0.4 VAL 94 A 94 A ? -2.6 GLU 88 A 88 A ? -0.8 87 TRP 87 A 87 A ? VAL 85 A 85 A ? -0.3 MET 93 A 93 A ? -0.2 MET 93 A 93 A ? -0.2 GLU 90 A 90 A ? -0.1 88 GLU 88 A 88 A ? LYS 92 A 92 A ? -2.5 LYS 86 A 86 A ? -0.8 GLU 90 A 90 A ? -0.3 TRP 87 A 87 A ? -0.2 89 SER 89 A 89 A ? LYS 92 A 92 A ? -1.7 LYS 86 A 86 A ? -0.2 LYS 92 A 92 A ? -1.2 GLU 88 A 88 A ? -0.3 90 GLU 90 A 90 A ? GLU 88 A 88 A ? -0.3 ASN 91 A 91 A ? -0.2 MET 93 A 93 A ? -0.0 TRP 87 A 87 A ? -0.0 91 ASN 91 A 91 A ? LYS 92 A 92 A ? -0.1 LEU 113 A 113 A ? -0.0 LEU 113 A 113 A ? -2.1 MET 93 A 93 A ? -0.4 92 LYS 92 A 92 A ? SER 89 A 89 A ? -1.2 GLU 112 A 112 A ? -0.2 GLU 88 A 88 A ? -2.5 SER 89 A 89 A ? -1.7 93 MET 93 A 93 A ? ARG 111 A 111 A ? -2.6 ASN 91 A 91 A ? -0.4 ARG 111 A 111 A ? -2.0 CYS 95 A 95 A ? -0.4 94 VAL 94 A 94 A ? LYS 86 A 86 A ? -2.6 LYS 92 A 92 A ? -0.4 LYS 86 A 86 A ? -2.4 GLU 96 A 96 A ? -0.5 95 CYS 95 A 95 A ? TRP 109 A 109 A ? -3.1 MET 93 A 93 A ? -0.4 TRP 109 A 109 A ? -1.5 GLN 97 A 97 A ? -0.4 96 GLU 96 A 96 A ? LEU 84 A 84 A ? -2.0 VAL 94 A 94 A ? -0.5 LEU 84 A 84 A ? -1.4 LYS 98 A 98 A ? -0.4 97 GLN 97 A 97 A ? THR 107 A 107 A ? -1.5 CYS 95 A 95 A ? -0.4 THR 107 A 107 A ? -0.4 LEU 99 A 99 A ? -0.4 98 LYS 98 A 98 A ? LYS 82 A 82 A ? -2.1 GLU 96 A 96 A ? -0.4 LYS 82 A 82 A ? -2.5 LEU 100 A 100 A ? -0.1 99 LEU 99 A 99 A ? GLN 97 A 97 A ? -0.4 CYS 81 A 81 A ? -0.2 CYS 81 A 81 A ? -0.2 GLY 102 A 102 A ? -0.1 100 LEU 100 A 100 A ? PRO 80 A 80 A ? -1.6 LYS 101 A 101 A ? -0.2 GLY 102 A 102 A ? -0.3 LEU 99 A 99 A ? -0.1 101 LYS 101 A 101 A ? PRO 80 A 80 A ? -0.5 GLU 103 A 103 A ? -0.0 LEU 100 A 100 A ? -0.2 GLU 103 A 103 A ? -0.1 102 GLY 102 A 102 A ? LEU 100 A 100 A ? -0.3 LEU 99 A 99 A ? -0.1 GLY 104 A 104 A ? -0.3 LEU 99 A 99 A ? -0.1 103 GLU 103 A 103 A ? LYS 101 A 101 A ? -0.1 LYS 106 A 106 A ? -0.0 LYS 101 A 101 A ? -0.0 LYS 106 A 106 A ? -0.0 104 GLY 104 A 104 A ? GLY 102 A 102 A ? -0.3 LEU 99 A 99 A ? -0.0 LEU 99 A 99 A ? -0.1 LEU 22 A 22 A ? -0.1 105 PRO 105 A 105 A ? . . . . . . . . . . . . . . THR 107 A 107 A ? -0.4 LEU 22 A 22 A ? -0.0 106 LYS 106 A 106 A ? LYS 98 A 98 A ? -0.1 GLU 103 A 103 A ? -0.0 ASP 126 A 126 A ? -2.7 SER 108 A 108 A ? -0.3 107 THR 107 A 107 A ? PRO 105 A 105 A ? -0.4 GLN 97 A 97 A ? -0.4 GLN 97 A 97 A ? -1.5 TRP 109 A 109 A ? -0.3 108 SER 108 A 108 A ? THR 124 A 124 A ? -1.4 LYS 106 A 106 A ? -0.3 THR 124 A 124 A ? -2.7 THR 110 A 110 A ? -0.3 109 TRP 109 A 109 A ? CYS 95 A 95 A ? -1.5 THR 107 A 107 A ? -0.3 CYS 95 A 95 A ? -3.1 ARG 111 A 111 A ? -0.3 110 THR 110 A 110 A ? THR 122 A 122 A ? -2.0 SER 108 A 108 A ? -0.3 THR 122 A 122 A ? -2.3 GLU 112 A 112 A ? -0.4 111 ARG 111 A 111 A ? MET 93 A 93 A ? -2.0 TRP 109 A 109 A ? -0.3 MET 93 A 93 A ? -2.6 LEU 113 A 113 A ? -0.3 112 GLU 112 A 112 A ? ILE 120 A 120 A ? -2.0 THR 110 A 110 A ? -0.4 ILE 120 A 120 A ? -2.7 THR 114 A 114 A ? -0.6 113 LEU 113 A 113 A ? ASN 91 A 91 A ? -2.1 ARG 111 A 111 A ? -0.3 LEU 119 A 119 A ? -0.2 ASN 115 A 115 A ? -0.1 114 THR 114 A 114 A ? GLU 118 A 118 A ? -2.4 GLU 112 A 112 A ? -0.6 GLY 117 A 117 A ? -1.7 LYS 92 A 92 A ? -0.0 115 ASN 115 A 115 A ? ASP 116 A 116 A ? -0.3 GLY 117 A 117 A ? -0.1 THR 114 A 114 A ? -0.1 LEU 113 A 113 A ? -0.0 116 ASP 116 A 116 A ? GLU 118 A 118 A ? -0.0 . . . . . . . ASN 115 A 115 A ? -0.3 LEU 113 A 113 A ? -0.0 117 GLY 117 A 117 A ? THR 114 A 114 A ? -1.7 GLU 118 A 118 A ? -0.3 ARG 136 A 136 A ? -0.3 ASN 115 A 115 A ? -0.1 118 GLU 118 A 118 A ? VAL 135 A 135 A ? -0.1 VAL 133 A 133 A ? -0.0 THR 114 A 114 A ? -2.4 ILE 120 A 120 A ? -0.4 119 LEU 119 A 119 A ? TYR 134 A 134 A ? -2.3 LEU 113 A 113 A ? -0.2 TYR 134 A 134 A ? -2.7 LEU 121 A 121 A ? -0.5 120 ILE 120 A 120 A ? GLU 112 A 112 A ? -2.7 GLU 118 A 118 A ? -0.4 GLU 112 A 112 A ? -2.0 THR 122 A 122 A ? -0.4 121 LEU 121 A 121 A ? ARG 132 A 132 A ? -3.1 LEU 119 A 119 A ? -0.5 ARG 132 A 132 A ? -2.7 MET 123 A 123 A ? -0.4 122 THR 122 A 122 A ? THR 110 A 110 A ? -2.3 ILE 120 A 120 A ? -0.4 THR 110 A 110 A ? -2.0 THR 124 A 124 A ? -0.4 123 MET 123 A 123 A ? CYS 130 A 130 A ? -2.0 LEU 121 A 121 A ? -0.4 CYS 130 A 130 A ? -3.1 ALA 125 A 125 A ? -0.4 124 THR 124 A 124 A ? SER 108 A 108 A ? -2.7 THR 122 A 122 A ? -0.4 SER 108 A 108 A ? -1.4 ASP 126 A 126 A ? -0.4 125 ALA 125 A 125 A ? VAL 128 A 128 A ? -2.1 MET 123 A 123 A ? -0.4 VAL 128 A 128 A ? -2.5 THR 107 A 107 A ? -0.2 126 ASP 126 A 126 A ? LYS 106 A 106 A ? -2.7 THR 124 A 124 A ? -0.4 SER 108 A 108 A ? -0.0 ALA 125 A 125 A ? -0.0 127 ASP 127 A 127 A ? ALA 125 A 125 A ? -0.2 THR 124 A 124 A ? -0.1 VAL 129 A 129 A ? -0.5 ASP 126 A 126 A ? -0.3 128 VAL 128 A 128 A ? ALA 125 A 125 A ? -2.5 LEU 18 A 18 A ? -0.1 ALA 125 A 125 A ? -2.1 CYS 130 A 130 A ? -0.4 129 VAL 129 A 129 A ? ASP 127 A 127 A ? -0.5 THR 124 A 124 A ? -0.2 THR 131 A 131 A ? -0.5 THR 124 A 124 A ? -0.2 130 CYS 130 A 130 A ? MET 123 A 123 A ? -3.1 VAL 128 A 128 A ? -0.4 MET 123 A 123 A ? -2.0 ARG 132 A 132 A ? -0.5 131 THR 131 A 131 A ? GLU 13 A 13 A ? -1.5 VAL 129 A 129 A ? -0.5 GLU 13 A 13 A ? -2.5 VAL 133 A 133 A ? -0.4 132 ARG 132 A 132 A ? LEU 121 A 121 A ? -2.7 CYS 130 A 130 A ? -0.5 LEU 121 A 121 A ? -3.1 TYR 134 A 134 A ? -0.4 133 VAL 133 A 133 A ? ARG 11 A 11 A ? -2.5 THR 131 A 131 A ? -0.4 ILE 10 A 10 A ? -3.1 ARG 11 A 11 A ? -1.3 134 TYR 134 A 134 A ? LEU 119 A 119 A ? -2.7 ARG 132 A 132 A ? -0.4 LEU 119 A 119 A ? -2.3 ARG 136 A 136 A ? -0.3 135 VAL 135 A 135 A ? LYS 8 A 8 A ? -2.3 VAL 133 A 133 A ? -0.3 LYS 8 A 8 A ? -3.0 GLU 118 A 118 A ? -0.1 136 ARG 136 A 136 A ? GLY 117 A 117 A ? -0.3 TYR 134 A 134 A ? -0.3 TRP 7 A 7 A ? -0.3 GLY 5 A 5 A ? -0.0 137 GLU 137 A 137 A ? ASN 6 A 6 A ? -2.8 VAL 135 A 135 A ? -0.1 ASN 6 A 6 A ? -0.2 ARG 136 A 136 A ? -0.1 # loop_ _dssp_statistics_histogram.entry_id _dssp_statistics_histogram.type _dssp_statistics_histogram.1 _dssp_statistics_histogram.2 _dssp_statistics_histogram.3 _dssp_statistics_histogram.4 _dssp_statistics_histogram.5 _dssp_statistics_histogram.6 _dssp_statistics_histogram.7 _dssp_statistics_histogram.8 _dssp_statistics_histogram.9 _dssp_statistics_histogram.10 _dssp_statistics_histogram.11 _dssp_statistics_histogram.12 _dssp_statistics_histogram.13 _dssp_statistics_histogram.14 _dssp_statistics_histogram.15 _dssp_statistics_histogram.16 _dssp_statistics_histogram.17 _dssp_statistics_histogram.18 _dssp_statistics_histogram.19 _dssp_statistics_histogram.20 _dssp_statistics_histogram.21 _dssp_statistics_histogram.22 _dssp_statistics_histogram.23 _dssp_statistics_histogram.24 _dssp_statistics_histogram.25 _dssp_statistics_histogram.26 _dssp_statistics_histogram.27 _dssp_statistics_histogram.28 _dssp_statistics_histogram.29 _dssp_statistics_histogram.30 1CBS residues_per_alpha_helix 0 0 0 0 0 0 1 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1CBS parallel_bridges_per_ladder 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1CBS antiparallel_bridges_per_ladder 0 0 1 1 1 1 4 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1CBS ladders_per_sheet 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 # loop_ _dssp_statistics_hbond.entry_id _dssp_statistics_hbond.type _dssp_statistics_hbond.count _dssp_statistics_hbond.count_per_100 1CBS O(I)-->H-N(J) 94 68.6 1CBS 'PARALLEL BRIDGES' 0 0.0 1CBS 'ANTIPARALLEL BRIDGES' 65 47.4 1CBS O(I)-->H-N(I-5) 0 0.0 1CBS O(I)-->H-N(I-4) 3 2.2 1CBS O(I)-->H-N(I-3) 4 2.9 1CBS O(I)-->H-N(I-2) 0 0.0 1CBS O(I)-->H-N(I-1) 0 0.0 1CBS O(I)-->H-N(I+0) 0 0.0 1CBS O(I)-->H-N(I+1) 0 0.0 1CBS O(I)-->H-N(I+2) 7 5.1 1CBS O(I)-->H-N(I+3) 9 6.6 1CBS O(I)-->H-N(I+4) 14 10.2 1CBS O(I)-->H-N(I+5) 1 0.7 # _dssp_statistics.entry_id 1CBS _dssp_statistics.nr_of_residues 137 _dssp_statistics.nr_of_chains 1 _dssp_statistics.nr_of_ss_bridges_total 0 _dssp_statistics.nr_of_ss_bridges_intra_chain 0 _dssp_statistics.nr_of_ss_bridges_inter_chain 0 _dssp_statistics.accessible_surface_of_protein 7905.01 # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1CBS _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # loop_ _database_2.database_id _database_2.database_code PDB 1CBS WWPDB D_1000172215 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Crystal structures of cellular retinoic acid binding proteins I and II in complex with all-trans-retinoic acid and a synthetic retinoid. ; Structure 2 1241 1258 1994 STRUE6 UK 0969-2126 2005 ? 7704533 10.1016/S0969-2126(94)00125-1 1 'Lipid-Binding Proteins: A Family of Fatty Acid and Retinoid Transport Proteins' 'Adv.Protein Chem.' 45 89 ? 1994 APCHA2 US 0065-3233 0433 ? ? ? 2 'Crystallisation and Preliminary X-Ray Analysis of Recombinant Bovine Cellular Retinoic Acid-Binding Protein' 'Acta Crystallogr.,Sect.D' 50 370 ? 1994 ABCRE6 DK 0907-4449 0766 ? ? ? 3 ;Crystallographic Studies on a Family of Lipophilic Transport Proteins. Refinement of P2 Myelin Protein and the Structure Determination and Refinement of Cellular Retinol-Binding Protein in Complex with All-Trans-Retinol ; J.Mol.Biol. 230 1225 ? 1993 JMOBAK UK 0022-2836 0070 ? ? ? 4 'The Three-Dimensional Structure of P2 Myelin Protein' 'Embo J.' 7 1597 ? 1988 EMJODG UK 0261-4189 0897 ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 REA non-polymer . 'RETINOIC ACID' ? 'C20 H28 O2' 300.435 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _cell.entry_id 1CBS _cell.length_a 45.650 _cell.length_b 47.560 _cell.length_c 77.610 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kleywegt, G.J.' 1 'Bergfors, T.' 2 'Jones, T.A.' 3 # loop_ _atom_type.symbol C N O S # _atom_sites.entry_id 1CBS _atom_sites.fract_transf_matrix[1][1] 0.021906 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021026 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012885 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal _software.date X-PLOR 'model building' . ? 1 . X-PLOR refinement . ? 2 . X-PLOR phasing . ? 3 . DSSP 'model annotation' 4.6.0 . 4 2026-04-14T07:56:21Z # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.010 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.51 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 27.4 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d 1.32 ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_analyze.entry_id 1CBS _refine_analyze.Luzzati_coordinate_error_obs 0.2 _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Kleywegt, G.J.' 1 primary 'Bergfors, T.' 2 primary 'Senn, H.' 3 primary 'Le Motte, P.' 4 primary 'Gsell, B.' 5 primary 'Shudo, K.' 6 primary 'Jones, T.A.' 7 1 'Banaszak, L.' 8 1 'Winter, N.' 9 1 'Xu, Z.' 10 1 'Bernlohr, D.A.' 11 1 'Cowan, S.W.' 12 1 'Jones, T.A.' 13 2 'Bergfors, T.' 14 2 'Kleywegt, G.J.' 15 2 'Jones, T.A.' 16 3 'Cowan, S.W.' 17 3 'Newcomer, M.E.' 18 3 'Jones, T.A.' 19 4 'Jones, T.A.' 20 4 'Bergfors, T.' 21 4 'Sedzik, J.' 22 4 'Unge, T.' 23 # _reflns.entry_id 1CBS _reflns.observed_criterion_sigma_I 3 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low ? _reflns.d_resolution_high ? _reflns.number_obs 14678 _reflns.number_all ? _reflns.percent_possible_obs 90.3 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 ASN n 1 3 PHE n 1 4 SER n 1 5 GLY n 1 6 ASN n 1 7 TRP n 1 8 LYS n 1 9 ILE n 1 10 ILE n 1 11 ARG n 1 12 SER n 1 13 GLU n 1 14 ASN n 1 15 PHE n 1 16 GLU n 1 17 GLU n 1 18 LEU n 1 19 LEU n 1 20 LYS n 1 21 VAL n 1 22 LEU n 1 23 GLY n 1 24 VAL n 1 25 ASN n 1 26 VAL n 1 27 MET n 1 28 LEU n 1 29 ARG n 1 30 LYS n 1 31 ILE n 1 32 ALA n 1 33 VAL n 1 34 ALA n 1 35 ALA n 1 36 ALA n 1 37 SER n 1 38 LYS n 1 39 PRO n 1 40 ALA n 1 41 VAL n 1 42 GLU n 1 43 ILE n 1 44 LYS n 1 45 GLN n 1 46 GLU n 1 47 GLY n 1 48 ASP n 1 49 THR n 1 50 PHE n 1 51 TYR n 1 52 ILE n 1 53 LYS n 1 54 THR n 1 55 SER n 1 56 THR n 1 57 THR n 1 58 VAL n 1 59 ARG n 1 60 THR n 1 61 THR n 1 62 GLU n 1 63 ILE n 1 64 ASN n 1 65 PHE n 1 66 LYS n 1 67 VAL n 1 68 GLY n 1 69 GLU n 1 70 GLU n 1 71 PHE n 1 72 GLU n 1 73 GLU n 1 74 GLN n 1 75 THR n 1 76 VAL n 1 77 ASP n 1 78 GLY n 1 79 ARG n 1 80 PRO n 1 81 CYS n 1 82 LYS n 1 83 SER n 1 84 LEU n 1 85 VAL n 1 86 LYS n 1 87 TRP n 1 88 GLU n 1 89 SER n 1 90 GLU n 1 91 ASN n 1 92 LYS n 1 93 MET n 1 94 VAL n 1 95 CYS n 1 96 GLU n 1 97 GLN n 1 98 LYS n 1 99 LEU n 1 100 LEU n 1 101 LYS n 1 102 GLY n 1 103 GLU n 1 104 GLY n 1 105 PRO n 1 106 LYS n 1 107 THR n 1 108 SER n 1 109 TRP n 1 110 THR n 1 111 ARG n 1 112 GLU n 1 113 LEU n 1 114 THR n 1 115 ASN n 1 116 ASP n 1 117 GLY n 1 118 GLU n 1 119 LEU n 1 120 ILE n 1 121 LEU n 1 122 THR n 1 123 MET n 1 124 THR n 1 125 ALA n 1 126 ASP n 1 127 ASP n 1 128 VAL n 1 129 VAL n 1 130 CYS n 1 131 THR n 1 132 ARG n 1 133 VAL n 1 134 TYR n 1 135 VAL n 1 136 ARG n 1 137 GLU n # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l ? _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 1 1 PRO PRO A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 PHE 3 3 3 PHE PHE A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 TRP 7 7 7 TRP TRP A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 MET 27 27 27 MET MET A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 CYS 81 81 81 CYS CYS A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 TRP 87 87 87 TRP TRP A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 ASN 91 91 91 ASN ASN A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 MET 93 93 93 MET MET A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 CYS 95 95 95 CYS CYS A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 TRP 109 109 109 TRP TRP A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 ARG 111 111 111 ARG ARG A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 ASN 115 115 115 ASN ASN A . n A 1 116 ASP 116 116 116 ASP ASP A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 ILE 120 120 120 ILE ILE A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 THR 122 122 122 THR THR A . n A 1 123 MET 123 123 123 MET MET A . n A 1 124 THR 124 124 124 THR THR A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 VAL 129 129 129 VAL VAL A . n A 1 130 CYS 130 130 130 CYS CYS A . n A 1 131 THR 131 131 131 THR THR A . n A 1 132 ARG 132 132 132 ARG ARG A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 TYR 134 134 134 TYR TYR A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 ARG 136 136 136 ARG ARG A . n A 1 137 GLU 137 137 137 GLU GLU A . n # loop_ _atom_site.group_PDB _atom_site.id _atom_site.type_symbol _atom_site.label_atom_id _atom_site.label_alt_id _atom_site.label_comp_id _atom_site.label_asym_id _atom_site.label_entity_id _atom_site.label_seq_id _atom_site.pdbx_PDB_ins_code _atom_site.Cartn_x _atom_site.Cartn_y _atom_site.Cartn_z _atom_site.occupancy _atom_site.B_iso_or_equiv _atom_site.pdbx_formal_charge _atom_site.auth_seq_id _atom_site.auth_comp_id _atom_site.auth_asym_id _atom_site.auth_atom_id _atom_site.pdbx_PDB_model_num ATOM 1 N N . PRO A 1 1 ? 16.979 13.301 44.555 1.00 30.05 ? 1 PRO A N 1 ATOM 2 C CA . PRO A 1 1 ? 18.150 13.525 43.680 1.00 28.82 ? 1 PRO A CA 1 ATOM 3 C C . PRO A 1 1 ? 18.656 14.966 43.784 1.00 26.59 ? 1 PRO A C 1 ATOM 4 O O . PRO A 1 1 ? 17.890 15.889 44.078 1.00 26.84 ? 1 PRO A O 1 ATOM 5 C CB . PRO A 1 1 ? 17.678 13.270 42.255 1.00 29.24 ? 1 PRO A CB 1 ATOM 6 C CG . PRO A 1 1 ? 16.248 13.734 42.347 1.00 29.29 ? 1 PRO A CG 1 ATOM 7 C CD . PRO A 1 1 ? 15.762 13.216 43.724 1.00 30.71 ? 1 PRO A CD 1 ATOM 8 N N . ASN A 1 2 ? 19.957 15.139 43.558 1.00 24.04 ? 2 ASN A N 1 ATOM 9 C CA . ASN A 1 2 ? 20.576 16.457 43.578 1.00 20.79 ? 2 ASN A CA 1 ATOM 10 C C . ASN A 1 2 ? 21.301 16.714 42.262 1.00 16.75 ? 2 ASN A C 1 ATOM 11 O O . ASN A 1 2 ? 22.402 16.215 42.028 1.00 15.23 ? 2 ASN A O 1 ATOM 12 C CB . ASN A 1 2 ? 21.559 16.620 44.724 1.00 22.81 ? 2 ASN A CB 1 ATOM 13 C CG . ASN A 1 2 ? 22.240 17.968 44.685 1.00 24.29 ? 2 ASN A CG 1 ATOM 14 O OD1 . ASN A 1 2 ? 21.612 18.984 44.358 1.00 21.87 ? 2 ASN A OD1 1 ATOM 15 N ND2 . ASN A 1 2 ? 23.537 17.983 44.966 1.00 27.94 ? 2 ASN A ND2 1 ATOM 16 N N . PHE A 1 3 ? 20.637 17.477 41.402 1.00 14.69 ? 3 PHE A N 1 ATOM 17 C CA . PHE A 1 3 ? 21.144 17.838 40.087 1.00 12.62 ? 3 PHE A CA 1 ATOM 18 C C . PHE A 1 3 ? 22.152 18.987 40.140 1.00 12.43 ? 3 PHE A C 1 ATOM 19 O O . PHE A 1 3 ? 22.796 19.289 39.136 1.00 12.12 ? 3 PHE A O 1 ATOM 20 C CB . PHE A 1 3 ? 19.970 18.262 39.188 1.00 10.74 ? 3 PHE A CB 1 ATOM 21 C CG . PHE A 1 3 ? 19.073 17.128 38.750 1.00 11.85 ? 3 PHE A CG 1 ATOM 22 C CD1 . PHE A 1 3 ? 18.066 16.646 39.581 1.00 10.90 ? 3 PHE A CD1 1 ATOM 23 C CD2 . PHE A 1 3 ? 19.189 16.588 37.475 1.00 13.26 ? 3 PHE A CD2 1 ATOM 24 C CE1 . PHE A 1 3 ? 17.200 15.662 39.149 1.00 9.12 ? 3 PHE A CE1 1 ATOM 25 C CE2 . PHE A 1 3 ? 18.312 15.594 37.041 1.00 11.76 ? 3 PHE A CE2 1 ATOM 26 C CZ . PHE A 1 3 ? 17.324 15.137 37.878 1.00 10.30 ? 3 PHE A CZ 1 ATOM 27 N N . SER A 1 4 ? 22.282 19.630 41.299 1.00 11.24 ? 4 SER A N 1 ATOM 28 C CA . SER A 1 4 ? 23.170 20.780 41.464 1.00 11.30 ? 4 SER A CA 1 ATOM 29 C C . SER A 1 4 ? 24.627 20.568 41.091 1.00 10.39 ? 4 SER A C 1 ATOM 30 O O . SER A 1 4 ? 25.201 19.532 41.384 1.00 10.24 ? 4 SER A O 1 ATOM 31 C CB . SER A 1 4 ? 23.112 21.301 42.906 1.00 13.53 ? 4 SER A CB 1 ATOM 32 O OG . SER A 1 4 ? 21.821 21.787 43.240 1.00 16.76 ? 4 SER A OG 1 ATOM 33 N N . GLY A 1 5 ? 25.224 21.572 40.460 1.00 9.87 ? 5 GLY A N 1 ATOM 34 C CA . GLY A 1 5 ? 26.628 21.486 40.103 1.00 10.86 ? 5 GLY A CA 1 ATOM 35 C C . GLY A 1 5 ? 26.985 22.158 38.794 1.00 11.21 ? 5 GLY A C 1 ATOM 36 O O . GLY A 1 5 ? 26.123 22.761 38.142 1.00 9.91 ? 5 GLY A O 1 ATOM 37 N N . ASN A 1 6 ? 28.277 22.142 38.475 1.00 10.41 ? 6 ASN A N 1 ATOM 38 C CA . ASN A 1 6 ? 28.796 22.676 37.211 1.00 11.06 ? 6 ASN A CA 1 ATOM 39 C C . ASN A 1 6 ? 29.117 21.435 36.378 1.00 10.33 ? 6 ASN A C 1 ATOM 40 O O . ASN A 1 6 ? 29.947 20.603 36.754 1.00 11.28 ? 6 ASN A O 1 ATOM 41 C CB . ASN A 1 6 ? 30.023 23.548 37.445 1.00 12.95 ? 6 ASN A CB 1 ATOM 42 C CG . ASN A 1 6 ? 29.675 24.816 38.200 1.00 18.08 ? 6 ASN A CG 1 ATOM 43 O OD1 . ASN A 1 6 ? 29.022 25.708 37.665 1.00 19.52 ? 6 ASN A OD1 1 ATOM 44 N ND2 . ASN A 1 6 ? 30.047 24.872 39.467 1.00 21.23 ? 6 ASN A ND2 1 ATOM 45 N N . TRP A 1 7 ? 28.399 21.289 35.272 1.00 8.66 ? 7 TRP A N 1 ATOM 46 C CA . TRP A 1 7 ? 28.518 20.119 34.424 1.00 8.74 ? 7 TRP A CA 1 ATOM 47 C C . TRP A 1 7 ? 29.246 20.352 33.092 1.00 9.63 ? 7 TRP A C 1 ATOM 48 O O . TRP A 1 7 ? 29.064 21.389 32.440 1.00 9.45 ? 7 TRP A O 1 ATOM 49 C CB . TRP A 1 7 ? 27.115 19.563 34.152 1.00 8.00 ? 7 TRP A CB 1 ATOM 50 C CG . TRP A 1 7 ? 26.325 19.198 35.391 1.00 8.01 ? 7 TRP A CG 1 ATOM 51 C CD1 . TRP A 1 7 ? 25.556 20.031 36.159 1.00 8.29 ? 7 TRP A CD1 1 ATOM 52 C CD2 . TRP A 1 7 ? 26.174 17.885 35.947 1.00 7.60 ? 7 TRP A CD2 1 ATOM 53 N NE1 . TRP A 1 7 ? 24.922 19.308 37.156 1.00 9.20 ? 7 TRP A NE1 1 ATOM 54 C CE2 . TRP A 1 7 ? 25.286 17.987 37.046 1.00 8.73 ? 7 TRP A CE2 1 ATOM 55 C CE3 . TRP A 1 7 ? 26.694 16.625 35.618 1.00 6.99 ? 7 TRP A CE3 1 ATOM 56 C CZ2 . TRP A 1 7 ? 24.909 16.876 37.815 1.00 7.67 ? 7 TRP A CZ2 1 ATOM 57 C CZ3 . TRP A 1 7 ? 26.320 15.527 36.380 1.00 7.58 ? 7 TRP A CZ3 1 ATOM 58 C CH2 . TRP A 1 7 ? 25.433 15.663 37.468 1.00 5.92 ? 7 TRP A CH2 1 ATOM 59 N N . LYS A 1 8 ? 30.052 19.368 32.702 1.00 9.39 ? 8 LYS A N 1 ATOM 60 C CA . LYS A 1 8 ? 30.802 19.424 31.450 1.00 11.56 ? 8 LYS A CA 1 ATOM 61 C C . LYS A 1 8 ? 30.342 18.243 30.611 1.00 10.56 ? 8 LYS A C 1 ATOM 62 O O . LYS A 1 8 ? 30.091 17.158 31.138 1.00 10.14 ? 8 LYS A O 1 ATOM 63 C CB . LYS A 1 8 ? 32.308 19.360 31.710 1.00 15.20 ? 8 LYS A CB 1 ATOM 64 C CG . LYS A 1 8 ? 32.785 18.080 32.313 1.00 18.52 ? 8 LYS A CG 1 ATOM 65 C CD . LYS A 1 8 ? 34.263 18.182 32.618 1.00 26.26 ? 8 LYS A CD 1 ATOM 66 C CE . LYS A 1 8 ? 35.091 18.499 31.378 1.00 29.22 ? 8 LYS A CE 1 ATOM 67 N NZ . LYS A 1 8 ? 35.067 17.393 30.369 1.00 32.48 ? 8 LYS A NZ 1 ATOM 68 N N . ILE A 1 9 ? 30.222 18.447 29.308 1.00 8.21 ? 9 ILE A N 1 ATOM 69 C CA . ILE A 1 9 ? 29.739 17.384 28.441 1.00 8.08 ? 9 ILE A CA 1 ATOM 70 C C . ILE A 1 9 ? 30.798 16.325 28.117 1.00 7.86 ? 9 ILE A C 1 ATOM 71 O O . ILE A 1 9 ? 31.990 16.635 28.028 1.00 8.38 ? 9 ILE A O 1 ATOM 72 C CB . ILE A 1 9 ? 29.148 17.997 27.144 1.00 10.70 ? 9 ILE A CB 1 ATOM 73 C CG1 . ILE A 1 9 ? 28.285 16.981 26.401 1.00 10.95 ? 9 ILE A CG1 1 ATOM 74 C CG2 . ILE A 1 9 ? 30.261 18.500 26.243 1.00 10.70 ? 9 ILE A CG2 1 ATOM 75 C CD1 . ILE A 1 9 ? 27.586 17.597 25.207 1.00 13.23 ? 9 ILE A CD1 1 ATOM 76 N N . ILE A 1 10 ? 30.373 15.067 27.995 1.00 7.08 ? 10 ILE A N 1 ATOM 77 C CA . ILE A 1 10 ? 31.288 13.988 27.656 1.00 7.45 ? 10 ILE A CA 1 ATOM 78 C C . ILE A 1 10 ? 30.812 13.201 26.441 1.00 8.49 ? 10 ILE A C 1 ATOM 79 O O . ILE A 1 10 ? 31.561 12.397 25.892 1.00 9.49 ? 10 ILE A O 1 ATOM 80 C CB . ILE A 1 10 ? 31.586 13.023 28.847 1.00 10.28 ? 10 ILE A CB 1 ATOM 81 C CG1 . ILE A 1 10 ? 30.304 12.393 29.382 1.00 10.51 ? 10 ILE A CG1 1 ATOM 82 C CG2 . ILE A 1 10 ? 32.349 13.756 29.963 1.00 10.10 ? 10 ILE A CG2 1 ATOM 83 C CD1 . ILE A 1 10 ? 30.578 11.242 30.325 1.00 12.18 ? 10 ILE A CD1 1 ATOM 84 N N . ARG A 1 11 ? 29.566 13.419 26.030 1.00 7.59 ? 11 ARG A N 1 ATOM 85 C CA . ARG A 1 11 ? 29.015 12.742 24.851 1.00 8.70 ? 11 ARG A CA 1 ATOM 86 C C . ARG A 1 11 ? 27.821 13.500 24.290 1.00 9.41 ? 11 ARG A C 1 ATOM 87 O O . ARG A 1 11 ? 26.990 14.004 25.043 1.00 9.84 ? 11 ARG A O 1 ATOM 88 C CB . ARG A 1 11 ? 28.563 11.316 25.184 1.00 8.07 ? 11 ARG A CB 1 ATOM 89 C CG . ARG A 1 11 ? 27.912 10.616 23.998 1.00 12.26 ? 11 ARG A CG 1 ATOM 90 C CD . ARG A 1 11 ? 27.234 9.340 24.394 1.00 13.46 ? 11 ARG A CD 1 ATOM 91 N NE . ARG A 1 11 ? 28.157 8.304 24.847 1.00 15.44 ? 11 ARG A NE 1 ATOM 92 C CZ . ARG A 1 11 ? 28.815 7.470 24.037 1.00 19.59 ? 11 ARG A CZ 1 ATOM 93 N NH1 . ARG A 1 11 ? 28.677 7.559 22.714 1.00 19.40 ? 11 ARG A NH1 1 ATOM 94 N NH2 . ARG A 1 11 ? 29.521 6.467 24.547 1.00 17.50 ? 11 ARG A NH2 1 ATOM 95 N N . SER A 1 12 ? 27.748 13.594 22.965 1.00 8.84 ? 12 SER A N 1 ATOM 96 C CA . SER A 1 12 ? 26.621 14.245 22.310 1.00 8.61 ? 12 SER A CA 1 ATOM 97 C C . SER A 1 12 ? 26.278 13.431 21.063 1.00 9.48 ? 12 SER A C 1 ATOM 98 O O . SER A 1 12 ? 27.159 13.147 20.250 1.00 9.84 ? 12 SER A O 1 ATOM 99 C CB . SER A 1 12 ? 26.966 15.676 21.925 1.00 9.02 ? 12 SER A CB 1 ATOM 100 O OG . SER A 1 12 ? 25.863 16.285 21.273 1.00 11.97 ? 12 SER A OG 1 ATOM 101 N N . GLU A 1 13 ? 25.016 13.038 20.924 1.00 7.59 ? 13 GLU A N 1 ATOM 102 C CA . GLU A 1 13 ? 24.586 12.258 19.768 1.00 9.67 ? 13 GLU A CA 1 ATOM 103 C C . GLU A 1 13 ? 23.368 12.887 19.118 1.00 9.06 ? 13 GLU A C 1 ATOM 104 O O . GLU A 1 13 ? 22.457 13.343 19.815 1.00 7.34 ? 13 GLU A O 1 ATOM 105 C CB . GLU A 1 13 ? 24.185 10.833 20.184 1.00 9.72 ? 13 GLU A CB 1 ATOM 106 C CG . GLU A 1 13 ? 25.257 10.018 20.895 1.00 15.17 ? 13 GLU A CG 1 ATOM 107 C CD . GLU A 1 13 ? 26.262 9.340 19.954 1.00 18.75 ? 13 GLU A CD 1 ATOM 108 O OE1 . GLU A 1 13 ? 26.031 9.310 18.726 1.00 18.53 ? 13 GLU A OE1 1 ATOM 109 O OE2 . GLU A 1 13 ? 27.286 8.822 20.457 1.00 19.23 ? 13 GLU A OE2 1 ATOM 110 N N . ASN A 1 14 ? 23.363 12.919 17.786 1.00 8.79 ? 14 ASN A N 1 ATOM 111 C CA . ASN A 1 14 ? 22.202 13.408 17.025 1.00 8.29 ? 14 ASN A CA 1 ATOM 112 C C . ASN A 1 14 ? 21.813 14.896 17.153 1.00 7.35 ? 14 ASN A C 1 ATOM 113 O O . ASN A 1 14 ? 20.681 15.245 16.860 1.00 7.00 ? 14 ASN A O 1 ATOM 114 C CB . ASN A 1 14 ? 20.989 12.522 17.383 1.00 7.23 ? 14 ASN A CB 1 ATOM 115 C CG . ASN A 1 14 ? 20.358 11.833 16.172 1.00 9.38 ? 14 ASN A CG 1 ATOM 116 O OD1 . ASN A 1 14 ? 20.996 11.670 15.128 1.00 10.37 ? 14 ASN A OD1 1 ATOM 117 N ND2 . ASN A 1 14 ? 19.106 11.436 16.310 1.00 6.35 ? 14 ASN A ND2 1 ATOM 118 N N . PHE A 1 15 ? 22.734 15.777 17.536 1.00 7.26 ? 15 PHE A N 1 ATOM 119 C CA . PHE A 1 15 ? 22.385 17.198 17.681 1.00 9.06 ? 15 PHE A CA 1 ATOM 120 C C . PHE A 1 15 ? 22.041 17.878 16.358 1.00 9.15 ? 15 PHE A C 1 ATOM 121 O O . PHE A 1 15 ? 21.041 18.578 16.265 1.00 8.64 ? 15 PHE A O 1 ATOM 122 C CB . PHE A 1 15 ? 23.497 17.990 18.379 1.00 10.05 ? 15 PHE A CB 1 ATOM 123 C CG . PHE A 1 15 ? 23.102 19.397 18.746 1.00 10.57 ? 15 PHE A CG 1 ATOM 124 C CD1 . PHE A 1 15 ? 22.032 19.633 19.605 1.00 13.39 ? 15 PHE A CD1 1 ATOM 125 C CD2 . PHE A 1 15 ? 23.813 20.485 18.254 1.00 11.47 ? 15 PHE A CD2 1 ATOM 126 C CE1 . PHE A 1 15 ? 21.678 20.929 19.968 1.00 13.52 ? 15 PHE A CE1 1 ATOM 127 C CE2 . PHE A 1 15 ? 23.467 21.784 18.609 1.00 11.60 ? 15 PHE A CE2 1 ATOM 128 C CZ . PHE A 1 15 ? 22.399 22.006 19.469 1.00 13.52 ? 15 PHE A CZ 1 ATOM 129 N N . GLU A 1 16 ? 22.878 17.699 15.342 1.00 11.17 ? 16 GLU A N 1 ATOM 130 C CA . GLU A 1 16 ? 22.583 18.313 14.053 1.00 12.58 ? 16 GLU A CA 1 ATOM 131 C C . GLU A 1 16 ? 21.271 17.797 13.468 1.00 11.71 ? 16 GLU A C 1 ATOM 132 O O . GLU A 1 16 ? 20.503 18.567 12.888 1.00 12.66 ? 16 GLU A O 1 ATOM 133 C CB . GLU A 1 16 ? 23.711 18.081 13.060 1.00 15.91 ? 16 GLU A CB 1 ATOM 134 C CG . GLU A 1 16 ? 23.274 18.337 11.626 1.00 21.31 ? 16 GLU A CG 1 ATOM 135 C CD . GLU A 1 16 ? 24.376 18.878 10.757 1.00 25.39 ? 16 GLU A CD 1 ATOM 136 O OE1 . GLU A 1 16 ? 25.526 18.984 11.240 1.00 27.92 ? 16 GLU A OE1 1 ATOM 137 O OE2 . GLU A 1 16 ? 24.084 19.213 9.588 1.00 28.60 ? 16 GLU A OE2 1 ATOM 138 N N . GLU A 1 17 ? 21.018 16.497 13.619 1.00 11.67 ? 17 GLU A N 1 ATOM 139 C CA . GLU A 1 17 ? 19.785 15.878 13.116 1.00 13.65 ? 17 GLU A CA 1 ATOM 140 C C . GLU A 1 17 ? 18.529 16.490 13.767 1.00 13.48 ? 17 GLU A C 1 ATOM 141 O O . GLU A 1 17 ? 17.490 16.662 13.115 1.00 11.68 ? 17 GLU A O 1 ATOM 142 C CB . GLU A 1 17 ? 19.811 14.361 13.325 1.00 17.06 ? 17 GLU A CB 1 ATOM 143 C CG . GLU A 1 17 ? 20.806 13.602 12.430 1.00 23.45 ? 17 GLU A CG 1 ATOM 144 C CD . GLU A 1 17 ? 22.279 13.624 12.909 1.00 27.80 ? 17 GLU A CD 1 ATOM 145 O OE1 . GLU A 1 17 ? 22.637 14.338 13.881 1.00 26.52 ? 17 GLU A OE1 1 ATOM 146 O OE2 . GLU A 1 17 ? 23.097 12.897 12.291 1.00 31.80 ? 17 GLU A OE2 1 ATOM 147 N N . LEU A 1 18 ? 18.640 16.834 15.048 1.00 10.82 ? 18 LEU A N 1 ATOM 148 C CA . LEU A 1 18 ? 17.547 17.468 15.777 1.00 9.45 ? 18 LEU A CA 1 ATOM 149 C C . LEU A 1 18 ? 17.302 18.849 15.155 1.00 9.27 ? 18 LEU A C 1 ATOM 150 O O . LEU A 1 18 ? 16.153 19.246 14.927 1.00 9.04 ? 18 LEU A O 1 ATOM 151 C CB . LEU A 1 18 ? 17.931 17.644 17.253 1.00 9.77 ? 18 LEU A CB 1 ATOM 152 C CG . LEU A 1 18 ? 16.921 18.358 18.163 1.00 11.36 ? 18 LEU A CG 1 ATOM 153 C CD1 . LEU A 1 18 ? 15.817 17.402 18.554 1.00 13.85 ? 18 LEU A CD1 1 ATOM 154 C CD2 . LEU A 1 18 ? 17.616 18.876 19.409 1.00 12.69 ? 18 LEU A CD2 1 ATOM 155 N N . LEU A 1 19 ? 18.387 19.568 14.864 1.00 10.75 ? 19 LEU A N 1 ATOM 156 C CA . LEU A 1 19 ? 18.275 20.906 14.276 1.00 11.15 ? 19 LEU A CA 1 ATOM 157 C C . LEU A 1 19 ? 17.671 20.873 12.874 1.00 12.52 ? 19 LEU A C 1 ATOM 158 O O . LEU A 1 19 ? 16.932 21.777 12.485 1.00 10.05 ? 19 LEU A O 1 ATOM 159 C CB . LEU A 1 19 ? 19.631 21.616 14.263 1.00 12.01 ? 19 LEU A CB 1 ATOM 160 C CG . LEU A 1 19 ? 20.282 21.963 15.614 1.00 10.42 ? 19 LEU A CG 1 ATOM 161 C CD1 . LEU A 1 19 ? 21.560 22.763 15.369 1.00 13.01 ? 19 LEU A CD1 1 ATOM 162 C CD2 . LEU A 1 19 ? 19.312 22.742 16.513 1.00 11.45 ? 19 LEU A CD2 1 ATOM 163 N N . LYS A 1 20 ? 17.944 19.795 12.150 1.00 14.41 ? 20 LYS A N 1 ATOM 164 C CA . LYS A 1 20 ? 17.427 19.628 10.800 1.00 16.54 ? 20 LYS A CA 1 ATOM 165 C C . LYS A 1 20 ? 15.902 19.512 10.832 1.00 16.17 ? 20 LYS A C 1 ATOM 166 O O . LYS A 1 20 ? 15.201 20.164 10.053 1.00 15.90 ? 20 LYS A O 1 ATOM 167 C CB . LYS A 1 20 ? 18.048 18.390 10.157 1.00 20.07 ? 20 LYS A CB 1 ATOM 168 C CG . LYS A 1 20 ? 18.592 18.643 8.765 1.00 26.61 ? 20 LYS A CG 1 ATOM 169 C CD . LYS A 1 20 ? 18.960 17.349 8.027 1.00 30.95 ? 20 LYS A CD 1 ATOM 170 C CE . LYS A 1 20 ? 20.226 16.690 8.579 1.00 35.68 ? 20 LYS A CE 1 ATOM 171 N NZ . LYS A 1 20 ? 21.485 17.466 8.342 1.00 39.27 ? 20 LYS A NZ 1 ATOM 172 N N . VAL A 1 21 ? 15.395 18.700 11.759 1.00 15.31 ? 21 VAL A N 1 ATOM 173 C CA . VAL A 1 21 ? 13.958 18.508 11.927 1.00 14.41 ? 21 VAL A CA 1 ATOM 174 C C . VAL A 1 21 ? 13.275 19.831 12.316 1.00 15.02 ? 21 VAL A C 1 ATOM 175 O O . VAL A 1 21 ? 12.150 20.119 11.878 1.00 13.59 ? 21 VAL A O 1 ATOM 176 C CB . VAL A 1 21 ? 13.674 17.422 12.998 1.00 14.93 ? 21 VAL A CB 1 ATOM 177 C CG1 . VAL A 1 21 ? 12.194 17.383 13.364 1.00 17.29 ? 21 VAL A CG1 1 ATOM 178 C CG2 . VAL A 1 21 ? 14.115 16.082 12.482 1.00 15.09 ? 21 VAL A CG2 1 ATOM 179 N N . LEU A 1 22 ? 13.966 20.643 13.119 1.00 14.52 ? 22 LEU A N 1 ATOM 180 C CA . LEU A 1 22 ? 13.432 21.938 13.569 1.00 14.42 ? 22 LEU A CA 1 ATOM 181 C C . LEU A 1 22 ? 13.478 22.984 12.467 1.00 15.49 ? 22 LEU A C 1 ATOM 182 O O . LEU A 1 22 ? 13.038 24.115 12.666 1.00 16.81 ? 22 LEU A O 1 ATOM 183 C CB . LEU A 1 22 ? 14.180 22.440 14.818 1.00 13.61 ? 22 LEU A CB 1 ATOM 184 C CG . LEU A 1 22 ? 13.986 21.565 16.069 1.00 13.97 ? 22 LEU A CG 1 ATOM 185 C CD1 . LEU A 1 22 ? 14.852 22.047 17.225 1.00 13.25 ? 22 LEU A CD1 1 ATOM 186 C CD2 . LEU A 1 22 ? 12.525 21.580 16.467 1.00 14.62 ? 22 LEU A CD2 1 ATOM 187 N N . GLY A 1 23 ? 14.062 22.618 11.328 1.00 16.41 ? 23 GLY A N 1 ATOM 188 C CA . GLY A 1 23 ? 14.123 23.516 10.183 1.00 17.05 ? 23 GLY A CA 1 ATOM 189 C C . GLY A 1 23 ? 15.241 24.539 10.125 1.00 18.00 ? 23 GLY A C 1 ATOM 190 O O . GLY A 1 23 ? 15.112 25.545 9.425 1.00 19.45 ? 23 GLY A O 1 ATOM 191 N N . VAL A 1 24 ? 16.320 24.315 10.869 1.00 14.78 ? 24 VAL A N 1 ATOM 192 C CA . VAL A 1 24 ? 17.440 25.241 10.860 1.00 13.71 ? 24 VAL A CA 1 ATOM 193 C C . VAL A 1 24 ? 18.289 24.983 9.607 1.00 15.09 ? 24 VAL A C 1 ATOM 194 O O . VAL A 1 24 ? 18.679 23.840 9.334 1.00 14.12 ? 24 VAL A O 1 ATOM 195 C CB . VAL A 1 24 ? 18.297 25.081 12.139 1.00 12.19 ? 24 VAL A CB 1 ATOM 196 C CG1 . VAL A 1 24 ? 19.465 26.054 12.109 1.00 8.69 ? 24 VAL A CG1 1 ATOM 197 C CG2 . VAL A 1 24 ? 17.416 25.294 13.388 1.00 11.37 ? 24 VAL A CG2 1 ATOM 198 N N . ASN A 1 25 ? 18.595 26.047 8.866 1.00 15.37 ? 25 ASN A N 1 ATOM 199 C CA . ASN A 1 25 ? 19.360 25.914 7.635 1.00 17.74 ? 25 ASN A CA 1 ATOM 200 C C . ASN A 1 25 ? 20.808 25.466 7.819 1.00 18.29 ? 25 ASN A C 1 ATOM 201 O O . ASN A 1 25 ? 21.377 25.592 8.903 1.00 18.05 ? 25 ASN A O 1 ATOM 202 C CB . ASN A 1 25 ? 19.230 27.172 6.742 1.00 19.41 ? 25 ASN A CB 1 ATOM 203 C CG . ASN A 1 25 ? 20.090 28.351 7.200 1.00 22.35 ? 25 ASN A CG 1 ATOM 204 O OD1 . ASN A 1 25 ? 21.207 28.189 7.698 1.00 22.64 ? 25 ASN A OD1 1 ATOM 205 N ND2 . ASN A 1 25 ? 19.602 29.558 6.933 1.00 24.15 ? 25 ASN A ND2 1 ATOM 206 N N . VAL A 1 26 ? 21.398 24.971 6.733 1.00 18.67 ? 26 VAL A N 1 ATOM 207 C CA . VAL A 1 26 ? 22.755 24.444 6.742 1.00 19.24 ? 26 VAL A CA 1 ATOM 208 C C . VAL A 1 26 ? 23.825 25.280 7.421 1.00 18.39 ? 26 VAL A C 1 ATOM 209 O O . VAL A 1 26 ? 24.558 24.764 8.261 1.00 18.50 ? 26 VAL A O 1 ATOM 210 C CB . VAL A 1 26 ? 23.223 24.088 5.320 1.00 20.77 ? 26 VAL A CB 1 ATOM 211 C CG1 . VAL A 1 26 ? 24.624 23.523 5.378 1.00 22.39 ? 26 VAL A CG1 1 ATOM 212 C CG2 . VAL A 1 26 ? 22.276 23.084 4.698 1.00 21.28 ? 26 VAL A CG2 1 ATOM 213 N N . MET A 1 27 ? 23.932 26.556 7.052 1.00 19.00 ? 27 MET A N 1 ATOM 214 C CA . MET A 1 27 ? 24.948 27.433 7.628 1.00 19.54 ? 27 MET A CA 1 ATOM 215 C C . MET A 1 27 ? 24.734 27.741 9.099 1.00 19.04 ? 27 MET A C 1 ATOM 216 O O . MET A 1 27 ? 25.702 27.820 9.849 1.00 18.28 ? 27 MET A O 1 ATOM 217 C CB . MET A 1 27 ? 25.104 28.736 6.830 1.00 23.31 ? 27 MET A CB 1 ATOM 218 C CG . MET A 1 27 ? 25.955 28.602 5.552 1.00 29.99 ? 27 MET A CG 1 ATOM 219 S SD . MET A 1 27 ? 24.975 28.527 4.010 1.00 37.48 ? 27 MET A SD 1 ATOM 220 C CE . MET A 1 27 ? 26.198 29.150 2.776 1.00 35.24 ? 27 MET A CE 1 ATOM 221 N N . LEU A 1 28 ? 23.480 27.932 9.507 1.00 16.74 ? 28 LEU A N 1 ATOM 222 C CA . LEU A 1 28 ? 23.190 28.209 10.912 1.00 16.39 ? 28 LEU A CA 1 ATOM 223 C C . LEU A 1 28 ? 23.477 26.954 11.722 1.00 16.86 ? 28 LEU A C 1 ATOM 224 O O . LEU A 1 28 ? 23.954 27.038 12.852 1.00 15.09 ? 28 LEU A O 1 ATOM 225 C CB . LEU A 1 28 ? 21.739 28.679 11.111 1.00 15.94 ? 28 LEU A CB 1 ATOM 226 C CG . LEU A 1 28 ? 21.490 30.154 10.741 1.00 16.72 ? 28 LEU A CG 1 ATOM 227 C CD1 . LEU A 1 28 ? 20.008 30.496 10.780 1.00 14.38 ? 28 LEU A CD1 1 ATOM 228 C CD2 . LEU A 1 28 ? 22.302 31.074 11.665 1.00 12.81 ? 28 LEU A CD2 1 ATOM 229 N N . ARG A 1 29 ? 23.228 25.791 11.121 1.00 16.05 ? 29 ARG A N 1 ATOM 230 C CA . ARG A 1 29 ? 23.498 24.524 11.798 1.00 18.43 ? 29 ARG A CA 1 ATOM 231 C C . ARG A 1 29 ? 24.980 24.377 12.076 1.00 19.22 ? 29 ARG A C 1 ATOM 232 O O . ARG A 1 29 ? 25.383 23.987 13.171 1.00 17.97 ? 29 ARG A O 1 ATOM 233 C CB . ARG A 1 29 ? 23.030 23.334 10.969 1.00 18.63 ? 29 ARG A CB 1 ATOM 234 C CG . ARG A 1 29 ? 21.596 22.983 11.189 1.00 21.26 ? 29 ARG A CG 1 ATOM 235 C CD . ARG A 1 29 ? 21.339 21.572 10.739 1.00 24.71 ? 29 ARG A CD 1 ATOM 236 N NE . ARG A 1 29 ? 20.571 21.564 9.513 1.00 29.88 ? 29 ARG A NE 1 ATOM 237 C CZ . ARG A 1 29 ? 21.019 21.147 8.340 1.00 29.19 ? 29 ARG A CZ 1 ATOM 238 N NH1 . ARG A 1 29 ? 22.248 20.682 8.205 1.00 30.52 ? 29 ARG A NH1 1 ATOM 239 N NH2 . ARG A 1 29 ? 20.232 21.233 7.295 1.00 31.61 ? 29 ARG A NH2 1 ATOM 240 N N . LYS A 1 30 ? 25.790 24.709 11.078 1.00 19.76 ? 30 LYS A N 1 ATOM 241 C CA . LYS A 1 30 ? 27.235 24.619 11.198 1.00 21.96 ? 30 LYS A CA 1 ATOM 242 C C . LYS A 1 30 ? 27.706 25.418 12.417 1.00 20.91 ? 30 LYS A C 1 ATOM 243 O O . LYS A 1 30 ? 28.470 24.916 13.239 1.00 22.15 ? 30 LYS A O 1 ATOM 244 C CB . LYS A 1 30 ? 27.894 25.143 9.915 1.00 25.07 ? 30 LYS A CB 1 ATOM 245 C CG . LYS A 1 30 ? 29.404 25.031 9.905 1.00 30.48 ? 30 LYS A CG 1 ATOM 246 C CD . LYS A 1 30 ? 30.013 25.631 8.639 1.00 35.43 ? 30 LYS A CD 1 ATOM 247 C CE . LYS A 1 30 ? 31.533 25.759 8.778 1.00 37.96 ? 30 LYS A CE 1 ATOM 248 N NZ . LYS A 1 30 ? 32.180 26.388 7.584 1.00 41.61 ? 30 LYS A NZ 1 ATOM 249 N N . ILE A 1 31 ? 27.208 26.643 12.544 1.00 18.38 ? 31 ILE A N 1 ATOM 250 C CA . ILE A 1 31 ? 27.557 27.527 13.652 1.00 16.41 ? 31 ILE A CA 1 ATOM 251 C C . ILE A 1 31 ? 27.105 26.932 14.989 1.00 15.39 ? 31 ILE A C 1 ATOM 252 O O . ILE A 1 31 ? 27.888 26.855 15.930 1.00 14.90 ? 31 ILE A O 1 ATOM 253 C CB . ILE A 1 31 ? 26.881 28.920 13.471 1.00 16.63 ? 31 ILE A CB 1 ATOM 254 C CG1 . ILE A 1 31 ? 27.419 29.606 12.208 1.00 18.74 ? 31 ILE A CG1 1 ATOM 255 C CG2 . ILE A 1 31 ? 27.071 29.791 14.713 1.00 15.71 ? 31 ILE A CG2 1 ATOM 256 C CD1 . ILE A 1 31 ? 26.735 30.946 11.858 1.00 17.27 ? 31 ILE A CD1 1 ATOM 257 N N . ALA A 1 32 ? 25.853 26.487 15.048 1.00 13.39 ? 32 ALA A N 1 ATOM 258 C CA . ALA A 1 32 ? 25.271 25.930 16.267 1.00 12.76 ? 32 ALA A CA 1 ATOM 259 C C . ALA A 1 32 ? 25.994 24.685 16.775 1.00 12.11 ? 32 ALA A C 1 ATOM 260 O O . ALA A 1 32 ? 26.325 24.598 17.946 1.00 10.54 ? 32 ALA A O 1 ATOM 261 C CB . ALA A 1 32 ? 23.790 25.638 16.040 1.00 12.45 ? 32 ALA A CB 1 ATOM 262 N N . VAL A 1 33 ? 26.252 23.731 15.886 1.00 11.95 ? 33 VAL A N 1 ATOM 263 C CA . VAL A 1 33 ? 26.932 22.490 16.256 1.00 13.80 ? 33 VAL A CA 1 ATOM 264 C C . VAL A 1 33 ? 28.328 22.701 16.855 1.00 14.00 ? 33 VAL A C 1 ATOM 265 O O . VAL A 1 33 ? 28.693 22.048 17.832 1.00 14.07 ? 33 VAL A O 1 ATOM 266 C CB . VAL A 1 33 ? 27.016 21.504 15.044 1.00 13.56 ? 33 VAL A CB 1 ATOM 267 C CG1 . VAL A 1 33 ? 27.909 20.318 15.375 1.00 16.07 ? 33 VAL A CG1 1 ATOM 268 C CG2 . VAL A 1 33 ? 25.621 21.006 14.684 1.00 14.96 ? 33 VAL A CG2 1 ATOM 269 N N . ALA A 1 34 ? 29.101 23.620 16.281 1.00 14.73 ? 34 ALA A N 1 ATOM 270 C CA . ALA A 1 34 ? 30.443 23.898 16.780 1.00 14.95 ? 34 ALA A CA 1 ATOM 271 C C . ALA A 1 34 ? 30.381 24.505 18.178 1.00 15.59 ? 34 ALA A C 1 ATOM 272 O O . ALA A 1 34 ? 31.120 24.085 19.065 1.00 16.65 ? 34 ALA A O 1 ATOM 273 C CB . ALA A 1 34 ? 31.191 24.844 15.833 1.00 16.10 ? 34 ALA A CB 1 ATOM 274 N N . ALA A 1 35 ? 29.495 25.480 18.375 1.00 13.20 ? 35 ALA A N 1 ATOM 275 C CA . ALA A 1 35 ? 29.371 26.134 19.671 1.00 13.04 ? 35 ALA A CA 1 ATOM 276 C C . ALA A 1 35 ? 28.807 25.200 20.749 1.00 12.91 ? 35 ALA A C 1 ATOM 277 O O . ALA A 1 35 ? 29.245 25.239 21.895 1.00 12.32 ? 35 ALA A O 1 ATOM 278 C CB . ALA A 1 35 ? 28.517 27.387 19.552 1.00 12.14 ? 35 ALA A CB 1 ATOM 279 N N . ALA A 1 36 ? 27.878 24.332 20.362 1.00 11.40 ? 36 ALA A N 1 ATOM 280 C CA . ALA A 1 36 ? 27.253 23.416 21.312 1.00 12.63 ? 36 ALA A CA 1 ATOM 281 C C . ALA A 1 36 ? 28.128 22.256 21.770 1.00 13.40 ? 36 ALA A C 1 ATOM 282 O O . ALA A 1 36 ? 27.743 21.512 22.668 1.00 13.47 ? 36 ALA A O 1 ATOM 283 C CB . ALA A 1 36 ? 25.952 22.883 20.744 1.00 11.79 ? 36 ALA A CB 1 ATOM 284 N N . SER A 1 37 ? 29.286 22.080 21.148 1.00 13.86 ? 37 SER A N 1 ATOM 285 C CA . SER A 1 37 ? 30.169 20.983 21.520 1.00 15.95 ? 37 SER A CA 1 ATOM 286 C C . SER A 1 37 ? 30.938 21.245 22.818 1.00 16.46 ? 37 SER A C 1 ATOM 287 O O . SER A 1 37 ? 31.488 20.320 23.406 1.00 18.23 ? 37 SER A O 1 ATOM 288 C CB . SER A 1 37 ? 31.145 20.689 20.388 1.00 16.93 ? 37 SER A CB 1 ATOM 289 O OG . SER A 1 37 ? 32.100 21.729 20.293 1.00 21.65 ? 37 SER A OG 1 ATOM 290 N N . LYS A 1 38 ? 30.957 22.496 23.272 1.00 16.91 ? 38 LYS A N 1 ATOM 291 C CA . LYS A 1 38 ? 31.657 22.869 24.502 1.00 18.36 ? 38 LYS A CA 1 ATOM 292 C C . LYS A 1 38 ? 30.817 23.809 25.382 1.00 15.90 ? 38 LYS A C 1 ATOM 293 O O . LYS A 1 38 ? 31.175 24.975 25.591 1.00 16.72 ? 38 LYS A O 1 ATOM 294 C CB . LYS A 1 38 ? 33.004 23.539 24.156 1.00 23.99 ? 38 LYS A CB 1 ATOM 295 C CG . LYS A 1 38 ? 32.907 24.607 23.046 1.00 30.97 ? 38 LYS A CG 1 ATOM 296 C CD . LYS A 1 38 ? 34.250 25.320 22.792 1.00 36.44 ? 38 LYS A CD 1 ATOM 297 C CE . LYS A 1 38 ? 34.266 26.098 21.456 1.00 38.70 ? 38 LYS A CE 1 ATOM 298 N NZ . LYS A 1 38 ? 33.193 27.131 21.321 1.00 39.37 ? 38 LYS A NZ 1 ATOM 299 N N . PRO A 1 39 ? 29.669 23.321 25.906 1.00 13.53 ? 39 PRO A N 1 ATOM 300 C CA . PRO A 1 39 ? 28.851 24.201 26.747 1.00 11.87 ? 39 PRO A CA 1 ATOM 301 C C . PRO A 1 39 ? 29.292 24.248 28.211 1.00 12.05 ? 39 PRO A C 1 ATOM 302 O O . PRO A 1 39 ? 30.027 23.380 28.676 1.00 12.12 ? 39 PRO A O 1 ATOM 303 C CB . PRO A 1 39 ? 27.469 23.560 26.649 1.00 9.34 ? 39 PRO A CB 1 ATOM 304 C CG . PRO A 1 39 ? 27.779 22.131 26.593 1.00 10.32 ? 39 PRO A CG 1 ATOM 305 C CD . PRO A 1 39 ? 29.009 22.020 25.703 1.00 10.86 ? 39 PRO A CD 1 ATOM 306 N N . ALA A 1 40 ? 28.921 25.316 28.898 1.00 11.52 ? 40 ALA A N 1 ATOM 307 C CA . ALA A 1 40 ? 29.192 25.423 30.329 1.00 11.84 ? 40 ALA A CA 1 ATOM 308 C C . ALA A 1 40 ? 27.773 25.329 30.894 1.00 10.23 ? 40 ALA A C 1 ATOM 309 O O . ALA A 1 40 ? 26.894 26.080 30.478 1.00 10.42 ? 40 ALA A O 1 ATOM 310 C CB . ALA A 1 40 ? 29.830 26.767 30.673 1.00 11.40 ? 40 ALA A CB 1 ATOM 311 N N . VAL A 1 41 ? 27.518 24.345 31.750 1.00 10.73 ? 41 VAL A N 1 ATOM 312 C CA . VAL A 1 41 ? 26.185 24.169 32.333 1.00 9.92 ? 41 VAL A CA 1 ATOM 313 C C . VAL A 1 41 ? 26.226 24.295 33.854 1.00 11.64 ? 41 VAL A C 1 ATOM 314 O O . VAL A 1 41 ? 27.026 23.627 34.514 1.00 11.40 ? 41 VAL A O 1 ATOM 315 C CB . VAL A 1 41 ? 25.594 22.772 31.987 1.00 10.67 ? 41 VAL A CB 1 ATOM 316 C CG1 . VAL A 1 41 ? 24.204 22.596 32.612 1.00 11.34 ? 41 VAL A CG1 1 ATOM 317 C CG2 . VAL A 1 41 ? 25.507 22.583 30.475 1.00 11.31 ? 41 VAL A CG2 1 ATOM 318 N N . GLU A 1 42 ? 25.364 25.147 34.399 1.00 10.94 ? 42 GLU A N 1 ATOM 319 C CA . GLU A 1 42 ? 25.271 25.327 35.845 1.00 12.40 ? 42 GLU A CA 1 ATOM 320 C C . GLU A 1 42 ? 23.837 25.095 36.316 1.00 11.42 ? 42 GLU A C 1 ATOM 321 O O . GLU A 1 42 ? 22.898 25.720 35.825 1.00 10.46 ? 42 GLU A O 1 ATOM 322 C CB . GLU A 1 42 ? 25.711 26.721 36.270 1.00 16.26 ? 42 GLU A CB 1 ATOM 323 C CG . GLU A 1 42 ? 25.495 26.947 37.768 1.00 23.78 ? 42 GLU A CG 1 ATOM 324 C CD . GLU A 1 42 ? 25.944 28.311 38.242 1.00 27.94 ? 42 GLU A CD 1 ATOM 325 O OE1 . GLU A 1 42 ? 25.308 29.329 37.872 1.00 29.92 ? 42 GLU A OE1 1 ATOM 326 O OE2 . GLU A 1 42 ? 26.935 28.351 39.002 1.00 32.64 ? 42 GLU A OE2 1 ATOM 327 N N . ILE A 1 43 ? 23.673 24.176 37.261 1.00 10.55 ? 43 ILE A N 1 ATOM 328 C CA . ILE A 1 43 ? 22.362 23.864 37.794 1.00 10.69 ? 43 ILE A CA 1 ATOM 329 C C . ILE A 1 43 ? 22.360 24.120 39.300 1.00 11.07 ? 43 ILE A C 1 ATOM 330 O O . ILE A 1 43 ? 23.307 23.764 39.992 1.00 10.83 ? 43 ILE A O 1 ATOM 331 C CB . ILE A 1 43 ? 21.996 22.374 37.552 1.00 10.47 ? 43 ILE A CB 1 ATOM 332 C CG1 . ILE A 1 43 ? 21.974 22.072 36.056 1.00 10.46 ? 43 ILE A CG1 1 ATOM 333 C CG2 . ILE A 1 43 ? 20.636 22.031 38.186 1.00 10.34 ? 43 ILE A CG2 1 ATOM 334 C CD1 . ILE A 1 43 ? 21.607 20.639 35.726 1.00 9.00 ? 43 ILE A CD1 1 ATOM 335 N N . LYS A 1 44 ? 21.315 24.784 39.778 1.00 12.26 ? 44 LYS A N 1 ATOM 336 C CA . LYS A 1 44 ? 21.127 25.051 41.201 1.00 13.96 ? 44 LYS A CA 1 ATOM 337 C C . LYS A 1 44 ? 19.729 24.528 41.516 1.00 14.16 ? 44 LYS A C 1 ATOM 338 O O . LYS A 1 44 ? 18.749 24.920 40.873 1.00 14.12 ? 44 LYS A O 1 ATOM 339 C CB . LYS A 1 44 ? 21.220 26.545 41.503 1.00 16.58 ? 44 LYS A CB 1 ATOM 340 C CG . LYS A 1 44 ? 22.580 27.150 41.170 1.00 22.90 ? 44 LYS A CG 1 ATOM 341 C CD . LYS A 1 44 ? 22.571 28.654 41.385 1.00 29.01 ? 44 LYS A CD 1 ATOM 342 C CE . LYS A 1 44 ? 23.890 29.293 40.982 1.00 31.56 ? 44 LYS A CE 1 ATOM 343 N NZ . LYS A 1 44 ? 23.818 30.781 41.111 1.00 34.70 ? 44 LYS A NZ 1 ATOM 344 N N . GLN A 1 45 ? 19.649 23.594 42.460 1.00 15.66 ? 45 GLN A N 1 ATOM 345 C CA . GLN A 1 45 ? 18.377 22.993 42.852 1.00 16.03 ? 45 GLN A CA 1 ATOM 346 C C . GLN A 1 45 ? 18.098 23.182 44.342 1.00 17.60 ? 45 GLN A C 1 ATOM 347 O O . GLN A 1 45 ? 18.989 23.024 45.164 1.00 17.17 ? 45 GLN A O 1 ATOM 348 C CB . GLN A 1 45 ? 18.397 21.498 42.544 1.00 15.51 ? 45 GLN A CB 1 ATOM 349 C CG . GLN A 1 45 ? 17.168 20.744 43.015 1.00 13.62 ? 45 GLN A CG 1 ATOM 350 C CD . GLN A 1 45 ? 17.312 19.256 42.838 1.00 15.68 ? 45 GLN A CD 1 ATOM 351 O OE1 . GLN A 1 45 ? 18.348 18.769 42.397 1.00 18.84 ? 45 GLN A OE1 1 ATOM 352 N NE2 . GLN A 1 45 ? 16.276 18.521 43.177 1.00 16.73 ? 45 GLN A NE2 1 ATOM 353 N N . GLU A 1 46 ? 16.868 23.551 44.670 1.00 18.48 ? 46 GLU A N 1 ATOM 354 C CA . GLU A 1 46 ? 16.441 23.718 46.062 1.00 21.26 ? 46 GLU A CA 1 ATOM 355 C C . GLU A 1 46 ? 15.108 23.004 46.105 1.00 19.06 ? 46 GLU A C 1 ATOM 356 O O . GLU A 1 46 ? 14.080 23.589 45.784 1.00 20.08 ? 46 GLU A O 1 ATOM 357 C CB . GLU A 1 46 ? 16.239 25.194 46.408 1.00 26.45 ? 46 GLU A CB 1 ATOM 358 C CG . GLU A 1 46 ? 17.284 25.787 47.361 1.00 37.46 ? 46 GLU A CG 1 ATOM 359 C CD . GLU A 1 46 ? 17.093 25.374 48.832 1.00 42.24 ? 46 GLU A CD 1 ATOM 360 O OE1 . GLU A 1 46 ? 16.192 25.944 49.501 1.00 44.05 ? 46 GLU A OE1 1 ATOM 361 O OE2 . GLU A 1 46 ? 17.867 24.507 49.320 1.00 44.14 ? 46 GLU A OE2 1 ATOM 362 N N . GLY A 1 47 ? 15.131 21.720 46.429 1.00 18.35 ? 47 GLY A N 1 ATOM 363 C CA . GLY A 1 47 ? 13.893 20.970 46.463 1.00 18.96 ? 47 GLY A CA 1 ATOM 364 C C . GLY A 1 47 ? 13.382 20.755 45.053 1.00 18.27 ? 47 GLY A C 1 ATOM 365 O O . GLY A 1 47 ? 14.067 20.157 44.238 1.00 18.05 ? 47 GLY A O 1 ATOM 366 N N . ASP A 1 48 ? 12.194 21.262 44.755 1.00 16.66 ? 48 ASP A N 1 ATOM 367 C CA . ASP A 1 48 ? 11.617 21.107 43.420 1.00 16.86 ? 48 ASP A CA 1 ATOM 368 C C . ASP A 1 48 ? 11.771 22.378 42.566 1.00 15.92 ? 48 ASP A C 1 ATOM 369 O O . ASP A 1 48 ? 11.139 22.511 41.504 1.00 14.50 ? 48 ASP A O 1 ATOM 370 C CB . ASP A 1 48 ? 10.136 20.694 43.513 1.00 19.00 ? 48 ASP A CB 1 ATOM 371 C CG . ASP A 1 48 ? 9.943 19.221 43.897 1.00 21.49 ? 48 ASP A CG 1 ATOM 372 O OD1 . ASP A 1 48 ? 10.901 18.406 43.840 1.00 23.51 ? 48 ASP A OD1 1 ATOM 373 O OD2 . ASP A 1 48 ? 8.802 18.868 44.243 1.00 25.04 ? 48 ASP A OD2 1 ATOM 374 N N . THR A 1 49 ? 12.610 23.299 43.042 1.00 13.75 ? 49 THR A N 1 ATOM 375 C CA . THR A 1 49 ? 12.870 24.551 42.348 1.00 13.82 ? 49 THR A CA 1 ATOM 376 C C . THR A 1 49 ? 14.231 24.460 41.678 1.00 13.22 ? 49 THR A C 1 ATOM 377 O O . THR A 1 49 ? 15.235 24.152 42.322 1.00 12.56 ? 49 THR A O 1 ATOM 378 C CB . THR A 1 49 ? 12.847 25.741 43.316 1.00 16.10 ? 49 THR A CB 1 ATOM 379 O OG1 . THR A 1 49 ? 11.556 25.815 43.941 1.00 17.94 ? 49 THR A OG1 1 ATOM 380 C CG2 . THR A 1 49 ? 13.100 27.037 42.571 1.00 16.15 ? 49 THR A CG2 1 ATOM 381 N N . PHE A 1 50 ? 14.266 24.794 40.392 1.00 12.20 ? 50 PHE A N 1 ATOM 382 C CA . PHE A 1 50 ? 15.485 24.704 39.602 1.00 10.82 ? 50 PHE A CA 1 ATOM 383 C C . PHE A 1 50 ? 15.842 25.979 38.855 1.00 10.40 ? 50 PHE A C 1 ATOM 384 O O . PHE A 1 50 ? 14.968 26.758 38.460 1.00 9.90 ? 50 PHE A O 1 ATOM 385 C CB . PHE A 1 50 ? 15.338 23.591 38.547 1.00 10.78 ? 50 PHE A CB 1 ATOM 386 C CG . PHE A 1 50 ? 15.316 22.192 39.107 1.00 13.13 ? 50 PHE A CG 1 ATOM 387 C CD1 . PHE A 1 50 ? 14.146 21.653 39.634 1.00 11.97 ? 50 PHE A CD1 1 ATOM 388 C CD2 . PHE A 1 50 ? 16.464 21.401 39.079 1.00 14.34 ? 50 PHE A CD2 1 ATOM 389 C CE1 . PHE A 1 50 ? 14.113 20.367 40.120 1.00 12.69 ? 50 PHE A CE1 1 ATOM 390 C CE2 . PHE A 1 50 ? 16.439 20.098 39.569 1.00 14.64 ? 50 PHE A CE2 1 ATOM 391 C CZ . PHE A 1 50 ? 15.258 19.582 40.092 1.00 13.15 ? 50 PHE A CZ 1 ATOM 392 N N . TYR A 1 51 ? 17.147 26.165 38.678 1.00 10.37 ? 51 TYR A N 1 ATOM 393 C CA . TYR A 1 51 ? 17.709 27.258 37.910 1.00 10.95 ? 51 TYR A CA 1 ATOM 394 C C . TYR A 1 51 ? 18.714 26.513 37.039 1.00 9.84 ? 51 TYR A C 1 ATOM 395 O O . TYR A 1 51 ? 19.540 25.761 37.547 1.00 9.78 ? 51 TYR A O 1 ATOM 396 C CB . TYR A 1 51 ? 18.436 28.284 38.790 1.00 12.57 ? 51 TYR A CB 1 ATOM 397 C CG . TYR A 1 51 ? 19.396 29.178 38.014 1.00 12.91 ? 51 TYR A CG 1 ATOM 398 C CD1 . TYR A 1 51 ? 18.939 30.302 37.327 1.00 15.83 ? 51 TYR A CD1 1 ATOM 399 C CD2 . TYR A 1 51 ? 20.762 28.896 37.974 1.00 14.05 ? 51 TYR A CD2 1 ATOM 400 C CE1 . TYR A 1 51 ? 19.822 31.126 36.621 1.00 16.52 ? 51 TYR A CE1 1 ATOM 401 C CE2 . TYR A 1 51 ? 21.655 29.705 37.275 1.00 14.62 ? 51 TYR A CE2 1 ATOM 402 C CZ . TYR A 1 51 ? 21.179 30.818 36.604 1.00 16.59 ? 51 TYR A CZ 1 ATOM 403 O OH . TYR A 1 51 ? 22.060 31.633 35.932 1.00 17.52 ? 51 TYR A OH 1 ATOM 404 N N . ILE A 1 52 ? 18.610 26.676 35.726 1.00 10.57 ? 52 ILE A N 1 ATOM 405 C CA . ILE A 1 52 ? 19.520 26.004 34.801 1.00 9.09 ? 52 ILE A CA 1 ATOM 406 C C . ILE A 1 52 ? 20.066 27.020 33.801 1.00 8.55 ? 52 ILE A C 1 ATOM 407 O O . ILE A 1 52 ? 19.296 27.652 33.086 1.00 10.49 ? 52 ILE A O 1 ATOM 408 C CB . ILE A 1 52 ? 18.807 24.859 34.026 1.00 8.96 ? 52 ILE A CB 1 ATOM 409 C CG1 . ILE A 1 52 ? 18.242 23.814 35.013 1.00 9.15 ? 52 ILE A CG1 1 ATOM 410 C CG2 . ILE A 1 52 ? 19.792 24.189 33.070 1.00 10.39 ? 52 ILE A CG2 1 ATOM 411 C CD1 . ILE A 1 52 ? 17.585 22.616 34.366 1.00 8.10 ? 52 ILE A CD1 1 ATOM 412 N N . LYS A 1 53 ? 21.388 27.197 33.791 1.00 8.61 ? 53 LYS A N 1 ATOM 413 C CA . LYS A 1 53 ? 22.049 28.115 32.868 1.00 9.66 ? 53 LYS A CA 1 ATOM 414 C C . LYS A 1 53 ? 22.939 27.319 31.924 1.00 8.71 ? 53 LYS A C 1 ATOM 415 O O . LYS A 1 53 ? 23.815 26.583 32.362 1.00 7.58 ? 53 LYS A O 1 ATOM 416 C CB . LYS A 1 53 ? 22.909 29.120 33.611 1.00 10.60 ? 53 LYS A CB 1 ATOM 417 C CG . LYS A 1 53 ? 23.580 30.135 32.688 1.00 14.21 ? 53 LYS A CG 1 ATOM 418 C CD . LYS A 1 53 ? 24.496 31.006 33.505 1.00 20.27 ? 53 LYS A CD 1 ATOM 419 C CE . LYS A 1 53 ? 24.831 32.319 32.828 1.00 26.91 ? 53 LYS A CE 1 ATOM 420 N NZ . LYS A 1 53 ? 25.878 33.009 33.659 1.00 29.12 ? 53 LYS A NZ 1 ATOM 421 N N . THR A 1 54 ? 22.686 27.445 30.625 1.00 8.49 ? 54 THR A N 1 ATOM 422 C CA . THR A 1 54 ? 23.478 26.747 29.628 1.00 7.98 ? 54 THR A CA 1 ATOM 423 C C . THR A 1 54 ? 24.118 27.820 28.764 1.00 8.23 ? 54 THR A C 1 ATOM 424 O O . THR A 1 54 ? 23.433 28.584 28.087 1.00 8.40 ? 54 THR A O 1 ATOM 425 C CB . THR A 1 54 ? 22.621 25.817 28.789 1.00 8.33 ? 54 THR A CB 1 ATOM 426 O OG1 . THR A 1 54 ? 21.896 24.946 29.660 1.00 9.95 ? 54 THR A OG1 1 ATOM 427 C CG2 . THR A 1 54 ? 23.505 24.976 27.873 1.00 4.95 ? 54 THR A CG2 1 ATOM 428 N N . SER A 1 55 ? 25.444 27.840 28.758 1.00 8.75 ? 55 SER A N 1 ATOM 429 C CA . SER A 1 55 ? 26.171 28.865 28.047 1.00 10.50 ? 55 SER A CA 1 ATOM 430 C C . SER A 1 55 ? 27.116 28.382 26.950 1.00 9.24 ? 55 SER A C 1 ATOM 431 O O . SER A 1 55 ? 27.802 27.370 27.101 1.00 8.98 ? 55 SER A O 1 ATOM 432 C CB . SER A 1 55 ? 26.934 29.694 29.082 1.00 13.09 ? 55 SER A CB 1 ATOM 433 O OG . SER A 1 55 ? 27.781 30.646 28.473 1.00 23.11 ? 55 SER A OG 1 ATOM 434 N N . THR A 1 56 ? 27.091 29.094 25.825 1.00 8.86 ? 56 THR A N 1 ATOM 435 C CA . THR A 1 56 ? 27.978 28.831 24.684 1.00 8.05 ? 56 THR A CA 1 ATOM 436 C C . THR A 1 56 ? 28.393 30.215 24.138 1.00 8.09 ? 56 THR A C 1 ATOM 437 O O . THR A 1 56 ? 27.834 31.237 24.525 1.00 7.17 ? 56 THR A O 1 ATOM 438 C CB . THR A 1 56 ? 27.296 28.024 23.534 1.00 6.70 ? 56 THR A CB 1 ATOM 439 O OG1 . THR A 1 56 ? 26.294 28.829 22.909 1.00 9.76 ? 56 THR A OG1 1 ATOM 440 C CG2 . THR A 1 56 ? 26.653 26.751 24.049 1.00 7.76 ? 56 THR A CG2 1 ATOM 441 N N . THR A 1 57 ? 29.381 30.242 23.249 1.00 9.17 ? 57 THR A N 1 ATOM 442 C CA . THR A 1 57 ? 29.871 31.485 22.644 1.00 8.49 ? 57 THR A CA 1 ATOM 443 C C . THR A 1 57 ? 28.820 32.222 21.802 1.00 7.50 ? 57 THR A C 1 ATOM 444 O O . THR A 1 57 ? 28.952 33.412 21.565 1.00 9.40 ? 57 THR A O 1 ATOM 445 C CB . THR A 1 57 ? 31.091 31.205 21.716 1.00 9.12 ? 57 THR A CB 1 ATOM 446 O OG1 . THR A 1 57 ? 30.758 30.171 20.786 1.00 9.41 ? 57 THR A OG1 1 ATOM 447 C CG2 . THR A 1 57 ? 32.297 30.775 22.516 1.00 11.48 ? 57 THR A CG2 1 ATOM 448 N N . VAL A 1 58 ? 27.786 31.510 21.356 1.00 8.04 ? 58 VAL A N 1 ATOM 449 C CA . VAL A 1 58 ? 26.733 32.090 20.500 1.00 9.09 ? 58 VAL A CA 1 ATOM 450 C C . VAL A 1 58 ? 25.328 32.224 21.102 1.00 8.67 ? 58 VAL A C 1 ATOM 451 O O . VAL A 1 58 ? 24.466 32.892 20.531 1.00 6.97 ? 58 VAL A O 1 ATOM 452 C CB . VAL A 1 58 ? 26.602 31.287 19.155 1.00 9.96 ? 58 VAL A CB 1 ATOM 453 C CG1 . VAL A 1 58 ? 27.976 31.161 18.454 1.00 11.08 ? 58 VAL A CG1 1 ATOM 454 C CG2 . VAL A 1 58 ? 26.010 29.890 19.404 1.00 9.41 ? 58 VAL A CG2 1 ATOM 455 N N . ARG A 1 59 ? 25.100 31.620 22.266 1.00 8.88 ? 59 ARG A N 1 ATOM 456 C CA . ARG A 1 59 ? 23.783 31.655 22.882 1.00 9.95 ? 59 ARG A CA 1 ATOM 457 C C . ARG A 1 59 ? 23.843 31.140 24.303 1.00 10.14 ? 59 ARG A C 1 ATOM 458 O O . ARG A 1 59 ? 24.440 30.108 24.556 1.00 10.10 ? 59 ARG A O 1 ATOM 459 C CB . ARG A 1 59 ? 22.837 30.751 22.074 1.00 13.11 ? 59 ARG A CB 1 ATOM 460 C CG . ARG A 1 59 ? 21.417 30.569 22.623 1.00 16.80 ? 59 ARG A CG 1 ATOM 461 C CD . ARG A 1 59 ? 20.521 29.961 21.535 1.00 18.74 ? 59 ARG A CD 1 ATOM 462 N NE . ARG A 1 59 ? 19.250 29.440 22.032 1.00 20.63 ? 59 ARG A NE 1 ATOM 463 C CZ . ARG A 1 59 ? 18.147 30.165 22.193 1.00 22.94 ? 59 ARG A CZ 1 ATOM 464 N NH1 . ARG A 1 59 ? 18.138 31.462 21.894 1.00 22.55 ? 59 ARG A NH1 1 ATOM 465 N NH2 . ARG A 1 59 ? 17.051 29.594 22.686 1.00 23.68 ? 59 ARG A NH2 1 ATOM 466 N N . THR A 1 60 ? 23.183 31.849 25.211 1.00 11.23 ? 60 THR A N 1 ATOM 467 C CA . THR A 1 60 ? 23.120 31.458 26.611 1.00 11.84 ? 60 THR A CA 1 ATOM 468 C C . THR A 1 60 ? 21.650 31.500 27.005 1.00 11.73 ? 60 THR A C 1 ATOM 469 O O . THR A 1 60 ? 20.934 32.423 26.620 1.00 13.69 ? 60 THR A O 1 ATOM 470 C CB . THR A 1 60 ? 23.916 32.451 27.519 1.00 10.13 ? 60 THR A CB 1 ATOM 471 O OG1 . THR A 1 60 ? 25.320 32.302 27.276 1.00 10.55 ? 60 THR A OG1 1 ATOM 472 C CG2 . THR A 1 60 ? 23.632 32.181 29.003 1.00 11.01 ? 60 THR A CG2 1 ATOM 473 N N . THR A 1 61 ? 21.183 30.470 27.706 1.00 11.78 ? 61 THR A N 1 ATOM 474 C CA . THR A 1 61 ? 19.797 30.413 28.175 1.00 11.54 ? 61 THR A CA 1 ATOM 475 C C . THR A 1 61 ? 19.831 30.214 29.686 1.00 10.88 ? 61 THR A C 1 ATOM 476 O O . THR A 1 61 ? 20.734 29.570 30.205 1.00 9.63 ? 61 THR A O 1 ATOM 477 C CB . THR A 1 61 ? 18.965 29.229 27.539 1.00 12.65 ? 61 THR A CB 1 ATOM 478 O OG1 . THR A 1 61 ? 19.563 27.976 27.874 1.00 14.13 ? 61 THR A OG1 1 ATOM 479 C CG2 . THR A 1 61 ? 18.889 29.336 26.012 1.00 14.15 ? 61 THR A CG2 1 ATOM 480 N N . GLU A 1 62 ? 18.878 30.828 30.382 1.00 12.14 ? 62 GLU A N 1 ATOM 481 C CA . GLU A 1 62 ? 18.749 30.698 31.833 1.00 12.88 ? 62 GLU A CA 1 ATOM 482 C C . GLU A 1 62 ? 17.283 30.444 32.100 1.00 12.21 ? 62 GLU A C 1 ATOM 483 O O . GLU A 1 62 ? 16.450 31.270 31.745 1.00 13.95 ? 62 GLU A O 1 ATOM 484 C CB . GLU A 1 62 ? 19.151 31.990 32.538 1.00 16.15 ? 62 GLU A CB 1 ATOM 485 C CG . GLU A 1 62 ? 20.585 32.344 32.326 1.00 23.65 ? 62 GLU A CG 1 ATOM 486 C CD . GLU A 1 62 ? 20.961 33.649 32.979 1.00 29.90 ? 62 GLU A CD 1 ATOM 487 O OE1 . GLU A 1 62 ? 20.969 33.703 34.229 1.00 31.84 ? 62 GLU A OE1 1 ATOM 488 O OE2 . GLU A 1 62 ? 21.258 34.616 32.236 1.00 33.89 ? 62 GLU A OE2 1 ATOM 489 N N . ILE A 1 63 ? 16.943 29.292 32.657 1.00 10.43 ? 63 ILE A N 1 ATOM 490 C CA . ILE A 1 63 ? 15.548 29.021 32.946 1.00 11.02 ? 63 ILE A CA 1 ATOM 491 C C . ILE A 1 63 ? 15.352 28.816 34.446 1.00 11.60 ? 63 ILE A C 1 ATOM 492 O O . ILE A 1 63 ? 16.286 28.434 35.144 1.00 9.20 ? 63 ILE A O 1 ATOM 493 C CB . ILE A 1 63 ? 14.976 27.816 32.125 1.00 11.28 ? 63 ILE A CB 1 ATOM 494 C CG1 . ILE A 1 63 ? 15.717 26.519 32.431 1.00 10.60 ? 63 ILE A CG1 1 ATOM 495 C CG2 . ILE A 1 63 ? 15.020 28.129 30.638 1.00 11.62 ? 63 ILE A CG2 1 ATOM 496 C CD1 . ILE A 1 63 ? 15.126 25.293 31.720 1.00 13.40 ? 63 ILE A CD1 1 ATOM 497 N N . ASN A 1 64 ? 14.184 29.219 34.933 1.00 12.13 ? 64 ASN A N 1 ATOM 498 C CA . ASN A 1 64 ? 13.824 29.083 36.343 1.00 14.79 ? 64 ASN A CA 1 ATOM 499 C C . ASN A 1 64 ? 12.451 28.441 36.375 1.00 13.29 ? 64 ASN A C 1 ATOM 500 O O . ASN A 1 64 ? 11.490 28.976 35.802 1.00 13.29 ? 64 ASN A O 1 ATOM 501 C CB . ASN A 1 64 ? 13.732 30.450 37.054 1.00 16.87 ? 64 ASN A CB 1 ATOM 502 C CG . ASN A 1 64 ? 15.079 31.089 37.279 1.00 20.91 ? 64 ASN A CG 1 ATOM 503 O OD1 . ASN A 1 64 ? 15.775 30.764 38.238 1.00 22.91 ? 64 ASN A OD1 1 ATOM 504 N ND2 . ASN A 1 64 ? 15.459 32.007 36.393 1.00 22.20 ? 64 ASN A ND2 1 ATOM 505 N N . PHE A 1 65 ? 12.347 27.301 37.044 1.00 12.90 ? 65 PHE A N 1 ATOM 506 C CA . PHE A 1 65 ? 11.058 26.641 37.132 1.00 12.63 ? 65 PHE A CA 1 ATOM 507 C C . PHE A 1 65 ? 10.858 25.841 38.410 1.00 13.07 ? 65 PHE A C 1 ATOM 508 O O . PHE A 1 65 ? 11.811 25.531 39.121 1.00 12.50 ? 65 PHE A O 1 ATOM 509 C CB . PHE A 1 65 ? 10.829 25.731 35.922 1.00 11.31 ? 65 PHE A CB 1 ATOM 510 C CG . PHE A 1 65 ? 11.794 24.586 35.825 1.00 12.32 ? 65 PHE A CG 1 ATOM 511 C CD1 . PHE A 1 65 ? 11.549 23.386 36.494 1.00 10.31 ? 65 PHE A CD1 1 ATOM 512 C CD2 . PHE A 1 65 ? 12.947 24.706 35.070 1.00 11.23 ? 65 PHE A CD2 1 ATOM 513 C CE1 . PHE A 1 65 ? 12.441 22.329 36.413 1.00 11.00 ? 65 PHE A CE1 1 ATOM 514 C CE2 . PHE A 1 65 ? 13.847 23.645 34.984 1.00 11.69 ? 65 PHE A CE2 1 ATOM 515 C CZ . PHE A 1 65 ? 13.593 22.461 35.655 1.00 12.20 ? 65 PHE A CZ 1 ATOM 516 N N . LYS A 1 66 ? 9.599 25.560 38.713 1.00 13.15 ? 66 LYS A N 1 ATOM 517 C CA . LYS A 1 66 ? 9.251 24.735 39.849 1.00 13.41 ? 66 LYS A CA 1 ATOM 518 C C . LYS A 1 66 ? 8.555 23.552 39.178 1.00 12.17 ? 66 LYS A C 1 ATOM 519 O O . LYS A 1 66 ? 7.763 23.747 38.251 1.00 12.93 ? 66 LYS A O 1 ATOM 520 C CB . LYS A 1 66 ? 8.313 25.498 40.800 1.00 16.68 ? 66 LYS A CB 1 ATOM 521 C CG . LYS A 1 66 ? 7.722 24.639 41.907 1.00 24.60 ? 66 LYS A CG 1 ATOM 522 C CD . LYS A 1 66 ? 7.391 25.453 43.165 1.00 28.53 ? 66 LYS A CD 1 ATOM 523 C CE . LYS A 1 66 ? 6.664 24.585 44.213 1.00 32.17 ? 66 LYS A CE 1 ATOM 524 N NZ . LYS A 1 66 ? 7.393 23.332 44.604 1.00 32.54 ? 66 LYS A NZ 1 ATOM 525 N N . VAL A 1 67 ? 8.918 22.329 39.562 1.00 11.82 ? 67 VAL A N 1 ATOM 526 C CA . VAL A 1 67 ? 8.295 21.141 38.975 1.00 10.93 ? 67 VAL A CA 1 ATOM 527 C C . VAL A 1 67 ? 6.783 21.174 39.226 1.00 11.97 ? 67 VAL A C 1 ATOM 528 O O . VAL A 1 67 ? 6.343 21.480 40.342 1.00 13.54 ? 67 VAL A O 1 ATOM 529 C CB . VAL A 1 67 ? 8.908 19.827 39.541 1.00 10.09 ? 67 VAL A CB 1 ATOM 530 C CG1 . VAL A 1 67 ? 8.271 18.617 38.883 1.00 10.96 ? 67 VAL A CG1 1 ATOM 531 C CG2 . VAL A 1 67 ? 10.410 19.808 39.320 1.00 10.21 ? 67 VAL A CG2 1 ATOM 532 N N . GLY A 1 68 ? 6.006 20.965 38.160 1.00 9.80 ? 68 GLY A N 1 ATOM 533 C CA . GLY A 1 68 ? 4.557 20.962 38.265 1.00 9.33 ? 68 GLY A CA 1 ATOM 534 C C . GLY A 1 68 ? 3.887 22.298 38.031 1.00 10.60 ? 68 GLY A C 1 ATOM 535 O O . GLY A 1 68 ? 2.653 22.389 38.039 1.00 11.93 ? 68 GLY A O 1 ATOM 536 N N . GLU A 1 69 ? 4.688 23.337 37.809 1.00 11.12 ? 69 GLU A N 1 ATOM 537 C CA . GLU A 1 69 ? 4.165 24.682 37.553 1.00 12.64 ? 69 GLU A CA 1 ATOM 538 C C . GLU A 1 69 ? 4.604 25.185 36.184 1.00 13.09 ? 69 GLU A C 1 ATOM 539 O O . GLU A 1 69 ? 5.774 25.107 35.820 1.00 12.17 ? 69 GLU A O 1 ATOM 540 C CB . GLU A 1 69 ? 4.578 25.642 38.668 1.00 12.20 ? 69 GLU A CB 1 ATOM 541 C CG . GLU A 1 69 ? 3.857 25.282 39.964 1.00 17.44 ? 69 GLU A CG 1 ATOM 542 C CD . GLU A 1 69 ? 4.116 26.211 41.138 1.00 21.02 ? 69 GLU A CD 1 ATOM 543 O OE1 . GLU A 1 69 ? 4.496 27.384 40.945 1.00 21.43 ? 69 GLU A OE1 1 ATOM 544 O OE2 . GLU A 1 69 ? 3.902 25.753 42.282 1.00 23.44 ? 69 GLU A OE2 1 ATOM 545 N N . GLU A 1 70 ? 3.633 25.622 35.397 1.00 14.53 ? 70 GLU A N 1 ATOM 546 C CA . GLU A 1 70 ? 3.912 26.102 34.059 1.00 15.80 ? 70 GLU A CA 1 ATOM 547 C C . GLU A 1 70 ? 4.816 27.329 34.007 1.00 13.72 ? 70 GLU A C 1 ATOM 548 O O . GLU A 1 70 ? 4.761 28.208 34.863 1.00 13.66 ? 70 GLU A O 1 ATOM 549 C CB . GLU A 1 70 ? 2.606 26.359 33.320 1.00 19.99 ? 70 GLU A CB 1 ATOM 550 C CG . GLU A 1 70 ? 2.814 26.634 31.851 1.00 28.23 ? 70 GLU A CG 1 ATOM 551 C CD . GLU A 1 70 ? 1.518 26.678 31.097 1.00 32.73 ? 70 GLU A CD 1 ATOM 552 O OE1 . GLU A 1 70 ? 0.975 25.589 30.789 1.00 35.76 ? 70 GLU A OE1 1 ATOM 553 O OE2 . GLU A 1 70 ? 1.045 27.802 30.823 1.00 35.75 ? 70 GLU A OE2 1 ATOM 554 N N . PHE A 1 71 ? 5.713 27.340 33.028 1.00 12.80 ? 71 PHE A N 1 ATOM 555 C CA . PHE A 1 71 ? 6.638 28.448 32.837 1.00 12.36 ? 71 PHE A CA 1 ATOM 556 C C . PHE A 1 71 ? 6.856 28.678 31.350 1.00 12.97 ? 71 PHE A C 1 ATOM 557 O O . PHE A 1 71 ? 6.382 27.917 30.516 1.00 12.54 ? 71 PHE A O 1 ATOM 558 C CB . PHE A 1 71 ? 7.975 28.243 33.589 1.00 10.02 ? 71 PHE A CB 1 ATOM 559 C CG . PHE A 1 71 ? 8.851 27.148 33.033 1.00 10.48 ? 71 PHE A CG 1 ATOM 560 C CD1 . PHE A 1 71 ? 8.549 25.815 33.256 1.00 9.95 ? 71 PHE A CD1 1 ATOM 561 C CD2 . PHE A 1 71 ? 10.006 27.459 32.331 1.00 9.29 ? 71 PHE A CD2 1 ATOM 562 C CE1 . PHE A 1 71 ? 9.380 24.811 32.793 1.00 9.74 ? 71 PHE A CE1 1 ATOM 563 C CE2 . PHE A 1 71 ? 10.832 26.464 31.868 1.00 9.51 ? 71 PHE A CE2 1 ATOM 564 C CZ . PHE A 1 71 ? 10.518 25.136 32.102 1.00 8.47 ? 71 PHE A CZ 1 ATOM 565 N N . GLU A 1 72 ? 7.581 29.733 31.028 1.00 15.04 ? 72 GLU A N 1 ATOM 566 C CA . GLU A 1 72 ? 7.826 30.063 29.644 1.00 17.19 ? 72 GLU A CA 1 ATOM 567 C C . GLU A 1 72 ? 9.323 30.036 29.357 1.00 15.53 ? 72 GLU A C 1 ATOM 568 O O . GLU A 1 72 ? 10.130 30.511 30.158 1.00 16.16 ? 72 GLU A O 1 ATOM 569 C CB . GLU A 1 72 ? 7.248 31.448 29.379 1.00 22.03 ? 72 GLU A CB 1 ATOM 570 C CG . GLU A 1 72 ? 6.700 31.658 28.002 1.00 30.80 ? 72 GLU A CG 1 ATOM 571 C CD . GLU A 1 72 ? 6.157 33.060 27.827 1.00 34.75 ? 72 GLU A CD 1 ATOM 572 O OE1 . GLU A 1 72 ? 5.014 33.309 28.276 1.00 35.88 ? 72 GLU A OE1 1 ATOM 573 O OE2 . GLU A 1 72 ? 6.885 33.912 27.255 1.00 38.91 ? 72 GLU A OE2 1 ATOM 574 N N . GLU A 1 73 ? 9.691 29.378 28.263 1.00 13.46 ? 73 GLU A N 1 ATOM 575 C CA . GLU A 1 73 ? 11.088 29.302 27.836 1.00 13.89 ? 73 GLU A CA 1 ATOM 576 C C . GLU A 1 73 ? 11.083 29.318 26.301 1.00 13.70 ? 73 GLU A C 1 ATOM 577 O O . GLU A 1 73 ? 10.159 29.859 25.690 1.00 13.63 ? 73 GLU A O 1 ATOM 578 C CB . GLU A 1 73 ? 11.780 28.032 28.379 1.00 12.63 ? 73 GLU A CB 1 ATOM 579 C CG . GLU A 1 73 ? 11.145 26.706 27.986 1.00 10.55 ? 73 GLU A CG 1 ATOM 580 C CD . GLU A 1 73 ? 11.997 25.499 28.366 1.00 8.94 ? 73 GLU A CD 1 ATOM 581 O OE1 . GLU A 1 73 ? 13.191 25.650 28.642 1.00 12.29 ? 73 GLU A OE1 1 ATOM 582 O OE2 . GLU A 1 73 ? 11.485 24.374 28.363 1.00 10.37 ? 73 GLU A OE2 1 ATOM 583 N N . GLN A 1 74 ? 12.115 28.751 25.685 1.00 13.09 ? 74 GLN A N 1 ATOM 584 C CA . GLN A 1 74 ? 12.187 28.691 24.239 1.00 13.16 ? 74 GLN A CA 1 ATOM 585 C C . GLN A 1 74 ? 12.618 27.315 23.806 1.00 12.86 ? 74 GLN A C 1 ATOM 586 O O . GLN A 1 74 ? 13.290 26.596 24.552 1.00 13.17 ? 74 GLN A O 1 ATOM 587 C CB . GLN A 1 74 ? 13.218 29.685 23.706 1.00 15.91 ? 74 GLN A CB 1 ATOM 588 C CG . GLN A 1 74 ? 12.803 31.133 23.779 1.00 19.68 ? 74 GLN A CG 1 ATOM 589 C CD . GLN A 1 74 ? 13.827 32.066 23.159 1.00 21.00 ? 74 GLN A CD 1 ATOM 590 O OE1 . GLN A 1 74 ? 15.010 31.730 23.024 1.00 22.37 ? 74 GLN A OE1 1 ATOM 591 N NE2 . GLN A 1 74 ? 13.373 33.247 22.774 1.00 24.07 ? 74 GLN A NE2 1 ATOM 592 N N . THR A 1 75 ? 12.229 26.935 22.600 1.00 10.98 ? 75 THR A N 1 ATOM 593 C CA . THR A 1 75 ? 12.664 25.656 22.056 1.00 11.83 ? 75 THR A CA 1 ATOM 594 C C . THR A 1 75 ? 14.162 25.828 21.729 1.00 11.24 ? 75 THR A C 1 ATOM 595 O O . THR A 1 75 ? 14.681 26.951 21.764 1.00 9.95 ? 75 THR A O 1 ATOM 596 C CB . THR A 1 75 ? 11.895 25.325 20.757 1.00 11.93 ? 75 THR A CB 1 ATOM 597 O OG1 . THR A 1 75 ? 12.123 26.366 19.795 1.00 13.31 ? 75 THR A OG1 1 ATOM 598 C CG2 . THR A 1 75 ? 10.396 25.202 21.042 1.00 13.29 ? 75 THR A CG2 1 ATOM 599 N N . VAL A 1 76 ? 14.841 24.731 21.377 1.00 13.77 ? 76 VAL A N 1 ATOM 600 C CA . VAL A 1 76 ? 16.278 24.762 21.049 1.00 14.39 ? 76 VAL A CA 1 ATOM 601 C C . VAL A 1 76 ? 16.612 25.734 19.914 1.00 12.97 ? 76 VAL A C 1 ATOM 602 O O . VAL A 1 76 ? 17.639 26.407 19.956 1.00 13.75 ? 76 VAL A O 1 ATOM 603 C CB . VAL A 1 76 ? 16.827 23.351 20.680 1.00 15.44 ? 76 VAL A CB 1 ATOM 604 C CG1 . VAL A 1 76 ? 18.332 23.314 20.844 1.00 17.74 ? 76 VAL A CG1 1 ATOM 605 C CG2 . VAL A 1 76 ? 16.218 22.293 21.548 1.00 19.99 ? 76 VAL A CG2 1 ATOM 606 N N . ASP A 1 77 ? 15.730 25.824 18.921 1.00 13.67 ? 77 ASP A N 1 ATOM 607 C CA . ASP A 1 77 ? 15.933 26.727 17.789 1.00 14.47 ? 77 ASP A CA 1 ATOM 608 C C . ASP A 1 77 ? 15.486 28.172 18.061 1.00 15.23 ? 77 ASP A C 1 ATOM 609 O O . ASP A 1 77 ? 15.461 29.002 17.153 1.00 14.90 ? 77 ASP A O 1 ATOM 610 C CB . ASP A 1 77 ? 15.301 26.158 16.503 1.00 15.63 ? 77 ASP A CB 1 ATOM 611 C CG . ASP A 1 77 ? 13.790 26.007 16.585 1.00 15.92 ? 77 ASP A CG 1 ATOM 612 O OD1 . ASP A 1 77 ? 13.260 25.470 17.586 1.00 14.64 ? 77 ASP A OD1 1 ATOM 613 O OD2 . ASP A 1 77 ? 13.123 26.409 15.613 1.00 17.79 ? 77 ASP A OD2 1 ATOM 614 N N . GLY A 1 78 ? 15.095 28.445 19.312 1.00 15.17 ? 78 GLY A N 1 ATOM 615 C CA . GLY A 1 78 ? 14.709 29.790 19.726 1.00 15.90 ? 78 GLY A CA 1 ATOM 616 C C . GLY A 1 78 ? 13.268 30.281 19.701 1.00 16.89 ? 78 GLY A C 1 ATOM 617 O O . GLY A 1 78 ? 13.038 31.489 19.790 1.00 19.37 ? 78 GLY A O 1 ATOM 618 N N . ARG A 1 79 ? 12.292 29.389 19.620 1.00 16.76 ? 79 ARG A N 1 ATOM 619 C CA . ARG A 1 79 ? 10.896 29.822 19.587 1.00 18.08 ? 79 ARG A CA 1 ATOM 620 C C . ARG A 1 79 ? 10.229 29.768 20.961 1.00 16.55 ? 79 ARG A C 1 ATOM 621 O O . ARG A 1 79 ? 10.379 28.787 21.680 1.00 16.57 ? 79 ARG A O 1 ATOM 622 C CB . ARG A 1 79 ? 10.112 28.961 18.604 1.00 20.74 ? 79 ARG A CB 1 ATOM 623 C CG . ARG A 1 79 ? 10.667 28.997 17.194 1.00 25.89 ? 79 ARG A CG 1 ATOM 624 C CD . ARG A 1 79 ? 9.986 27.976 16.310 1.00 29.77 ? 79 ARG A CD 1 ATOM 625 N NE . ARG A 1 79 ? 10.144 26.626 16.842 1.00 34.52 ? 79 ARG A NE 1 ATOM 626 C CZ . ARG A 1 79 ? 10.128 25.516 16.109 1.00 35.90 ? 79 ARG A CZ 1 ATOM 627 N NH1 . ARG A 1 79 ? 9.971 25.580 14.789 1.00 37.70 ? 79 ARG A NH1 1 ATOM 628 N NH2 . ARG A 1 79 ? 10.266 24.337 16.702 1.00 35.58 ? 79 ARG A NH2 1 ATOM 629 N N . PRO A 1 80 ? 9.501 30.830 21.352 1.00 15.98 ? 80 PRO A N 1 ATOM 630 C CA . PRO A 1 80 ? 8.819 30.867 22.651 1.00 15.47 ? 80 PRO A CA 1 ATOM 631 C C . PRO A 1 80 ? 7.825 29.725 22.833 1.00 14.23 ? 80 PRO A C 1 ATOM 632 O O . PRO A 1 80 ? 7.058 29.393 21.926 1.00 14.56 ? 80 PRO A O 1 ATOM 633 C CB . PRO A 1 80 ? 8.100 32.220 22.628 1.00 15.48 ? 80 PRO A CB 1 ATOM 634 C CG . PRO A 1 80 ? 9.010 33.057 21.846 1.00 18.18 ? 80 PRO A CG 1 ATOM 635 C CD . PRO A 1 80 ? 9.418 32.145 20.696 1.00 17.08 ? 80 PRO A CD 1 ATOM 636 N N . CYS A 1 81 ? 7.817 29.148 24.028 1.00 13.52 ? 81 CYS A N 1 ATOM 637 C CA . CYS A 1 81 ? 6.914 28.055 24.331 1.00 12.41 ? 81 CYS A CA 1 ATOM 638 C C . CYS A 1 81 ? 6.548 28.054 25.811 1.00 12.52 ? 81 CYS A C 1 ATOM 639 O O . CYS A 1 81 ? 7.202 28.718 26.624 1.00 11.74 ? 81 CYS A O 1 ATOM 640 C CB . CYS A 1 81 ? 7.563 26.705 23.950 1.00 11.59 ? 81 CYS A CB 1 ATOM 641 S SG . CYS A 1 81 ? 9.063 26.255 24.894 1.00 12.86 ? 81 CYS A SG 1 ATOM 642 N N . LYS A 1 82 ? 5.448 27.379 26.121 1.00 13.86 ? 82 LYS A N 1 ATOM 643 C CA . LYS A 1 82 ? 4.988 27.197 27.492 1.00 14.38 ? 82 LYS A CA 1 ATOM 644 C C . LYS A 1 82 ? 5.436 25.779 27.839 1.00 13.51 ? 82 LYS A C 1 ATOM 645 O O . LYS A 1 82 ? 5.227 24.842 27.063 1.00 12.69 ? 82 LYS A O 1 ATOM 646 C CB . LYS A 1 82 ? 3.473 27.299 27.589 1.00 18.36 ? 82 LYS A CB 1 ATOM 647 C CG . LYS A 1 82 ? 2.940 28.716 27.584 1.00 26.02 ? 82 LYS A CG 1 ATOM 648 C CD . LYS A 1 82 ? 3.353 29.506 28.826 1.00 31.13 ? 82 LYS A CD 1 ATOM 649 C CE . LYS A 1 82 ? 2.686 30.894 28.832 1.00 35.39 ? 82 LYS A CE 1 ATOM 650 N NZ . LYS A 1 82 ? 2.868 31.652 30.120 1.00 37.63 ? 82 LYS A NZ 1 ATOM 651 N N . SER A 1 83 ? 6.110 25.638 28.974 1.00 11.15 ? 83 SER A N 1 ATOM 652 C CA . SER A 1 83 ? 6.624 24.352 29.397 1.00 10.10 ? 83 SER A CA 1 ATOM 653 C C . SER A 1 83 ? 6.083 23.931 30.752 1.00 11.16 ? 83 SER A C 1 ATOM 654 O O . SER A 1 83 ? 5.721 24.769 31.575 1.00 10.21 ? 83 SER A O 1 ATOM 655 C CB . SER A 1 83 ? 8.149 24.418 29.446 1.00 10.30 ? 83 SER A CB 1 ATOM 656 O OG . SER A 1 83 ? 8.686 24.518 28.132 1.00 11.50 ? 83 SER A OG 1 ATOM 657 N N . LEU A 1 84 ? 6.028 22.620 30.954 1.00 11.17 ? 84 LEU A N 1 ATOM 658 C CA . LEU A 1 84 ? 5.557 22.016 32.192 1.00 11.84 ? 84 LEU A CA 1 ATOM 659 C C . LEU A 1 84 ? 6.427 20.793 32.470 1.00 10.42 ? 84 LEU A C 1 ATOM 660 O O . LEU A 1 84 ? 6.444 19.846 31.684 1.00 11.20 ? 84 LEU A O 1 ATOM 661 C CB . LEU A 1 84 ? 4.091 21.576 32.067 1.00 13.44 ? 84 LEU A CB 1 ATOM 662 C CG . LEU A 1 84 ? 3.552 20.784 33.270 1.00 15.74 ? 84 LEU A CG 1 ATOM 663 C CD1 . LEU A 1 84 ? 3.515 21.683 34.484 1.00 16.96 ? 84 LEU A CD1 1 ATOM 664 C CD2 . LEU A 1 84 ? 2.178 20.231 32.982 1.00 18.76 ? 84 LEU A CD2 1 ATOM 665 N N . VAL A 1 85 ? 7.146 20.828 33.589 1.00 9.60 ? 85 VAL A N 1 ATOM 666 C CA . VAL A 1 85 ? 8.028 19.738 34.006 1.00 9.50 ? 85 VAL A CA 1 ATOM 667 C C . VAL A 1 85 ? 7.344 18.878 35.082 1.00 9.74 ? 85 VAL A C 1 ATOM 668 O O . VAL A 1 85 ? 6.680 19.404 35.985 1.00 9.28 ? 85 VAL A O 1 ATOM 669 C CB . VAL A 1 85 ? 9.384 20.291 34.598 1.00 8.89 ? 85 VAL A CB 1 ATOM 670 C CG1 . VAL A 1 85 ? 10.327 19.140 34.970 1.00 8.20 ? 85 VAL A CG1 1 ATOM 671 C CG2 . VAL A 1 85 ? 10.062 21.227 33.612 1.00 8.48 ? 85 VAL A CG2 1 ATOM 672 N N . LYS A 1 86 ? 7.504 17.563 34.971 1.00 9.96 ? 86 LYS A N 1 ATOM 673 C CA . LYS A 1 86 ? 6.946 16.621 35.945 1.00 11.92 ? 86 LYS A CA 1 ATOM 674 C C . LYS A 1 86 ? 8.003 15.558 36.247 1.00 11.88 ? 86 LYS A C 1 ATOM 675 O O . LYS A 1 86 ? 8.917 15.340 35.453 1.00 11.00 ? 86 LYS A O 1 ATOM 676 C CB . LYS A 1 86 ? 5.700 15.911 35.385 1.00 12.40 ? 86 LYS A CB 1 ATOM 677 C CG . LYS A 1 86 ? 4.538 16.819 35.058 1.00 16.01 ? 86 LYS A CG 1 ATOM 678 C CD . LYS A 1 86 ? 3.333 16.017 34.559 1.00 21.36 ? 86 LYS A CD 1 ATOM 679 C CE . LYS A 1 86 ? 2.140 16.939 34.345 1.00 23.23 ? 86 LYS A CE 1 ATOM 680 N NZ . LYS A 1 86 ? 0.919 16.212 33.929 1.00 28.41 ? 86 LYS A NZ 1 ATOM 681 N N . TRP A 1 87 ? 7.868 14.889 37.386 1.00 10.75 ? 87 TRP A N 1 ATOM 682 C CA . TRP A 1 87 ? 8.775 13.811 37.738 1.00 9.53 ? 87 TRP A CA 1 ATOM 683 C C . TRP A 1 87 ? 8.238 12.559 37.052 1.00 9.89 ? 87 TRP A C 1 ATOM 684 O O . TRP A 1 87 ? 7.144 12.107 37.370 1.00 11.80 ? 87 TRP A O 1 ATOM 685 C CB . TRP A 1 87 ? 8.791 13.569 39.268 1.00 8.76 ? 87 TRP A CB 1 ATOM 686 C CG . TRP A 1 87 ? 9.494 14.641 40.062 1.00 8.86 ? 87 TRP A CG 1 ATOM 687 C CD1 . TRP A 1 87 ? 8.923 15.525 40.939 1.00 8.80 ? 87 TRP A CD1 1 ATOM 688 C CD2 . TRP A 1 87 ? 10.889 14.990 39.992 1.00 9.42 ? 87 TRP A CD2 1 ATOM 689 N NE1 . TRP A 1 87 ? 9.872 16.410 41.400 1.00 8.01 ? 87 TRP A NE1 1 ATOM 690 C CE2 . TRP A 1 87 ? 11.086 16.103 40.835 1.00 10.85 ? 87 TRP A CE2 1 ATOM 691 C CE3 . TRP A 1 87 ? 11.985 14.475 39.283 1.00 9.60 ? 87 TRP A CE3 1 ATOM 692 C CZ2 . TRP A 1 87 ? 12.340 16.716 40.994 1.00 11.45 ? 87 TRP A CZ2 1 ATOM 693 C CZ3 . TRP A 1 87 ? 13.230 15.084 39.438 1.00 10.72 ? 87 TRP A CZ3 1 ATOM 694 C CH2 . TRP A 1 87 ? 13.395 16.192 40.289 1.00 11.78 ? 87 TRP A CH2 1 ATOM 695 N N . GLU A 1 88 ? 8.954 12.040 36.064 1.00 9.93 ? 88 GLU A N 1 ATOM 696 C CA . GLU A 1 88 ? 8.526 10.807 35.416 1.00 11.30 ? 88 GLU A CA 1 ATOM 697 C C . GLU A 1 88 ? 8.826 9.726 36.448 1.00 11.75 ? 88 GLU A C 1 ATOM 698 O O . GLU A 1 88 ? 8.068 8.784 36.623 1.00 12.78 ? 88 GLU A O 1 ATOM 699 C CB . GLU A 1 88 ? 9.337 10.541 34.156 1.00 13.50 ? 88 GLU A CB 1 ATOM 700 C CG . GLU A 1 88 ? 8.917 9.261 33.454 1.00 18.67 ? 88 GLU A CG 1 ATOM 701 C CD . GLU A 1 88 ? 9.756 8.958 32.226 1.00 23.49 ? 88 GLU A CD 1 ATOM 702 O OE1 . GLU A 1 88 ? 9.581 9.650 31.205 1.00 26.53 ? 88 GLU A OE1 1 ATOM 703 O OE2 . GLU A 1 88 ? 10.587 8.025 32.276 1.00 26.54 ? 88 GLU A OE2 1 ATOM 704 N N . SER A 1 89 ? 9.972 9.870 37.103 1.00 11.49 ? 89 SER A N 1 ATOM 705 C CA . SER A 1 89 ? 10.402 8.954 38.158 1.00 11.10 ? 89 SER A CA 1 ATOM 706 C C . SER A 1 89 ? 11.206 9.776 39.163 1.00 11.14 ? 89 SER A C 1 ATOM 707 O O . SER A 1 89 ? 11.397 10.983 38.979 1.00 9.92 ? 89 SER A O 1 ATOM 708 C CB . SER A 1 89 ? 11.221 7.778 37.604 1.00 12.43 ? 89 SER A CB 1 ATOM 709 O OG . SER A 1 89 ? 12.396 8.215 36.947 1.00 14.39 ? 89 SER A OG 1 ATOM 710 N N . GLU A 1 90 ? 11.674 9.130 40.227 1.00 10.17 ? 90 GLU A N 1 ATOM 711 C CA . GLU A 1 90 ? 12.433 9.826 41.254 1.00 10.83 ? 90 GLU A CA 1 ATOM 712 C C . GLU A 1 90 ? 13.657 10.629 40.772 1.00 9.86 ? 90 GLU A C 1 ATOM 713 O O . GLU A 1 90 ? 13.932 11.715 41.289 1.00 10.30 ? 90 GLU A O 1 ATOM 714 C CB . GLU A 1 90 ? 12.858 8.846 42.348 1.00 11.92 ? 90 GLU A CB 1 ATOM 715 C CG . GLU A 1 90 ? 13.536 9.572 43.487 1.00 16.53 ? 90 GLU A CG 1 ATOM 716 C CD . GLU A 1 90 ? 13.912 8.671 44.644 1.00 19.80 ? 90 GLU A CD 1 ATOM 717 O OE1 . GLU A 1 90 ? 14.122 7.464 44.426 1.00 21.18 ? 90 GLU A OE1 1 ATOM 718 O OE2 . GLU A 1 90 ? 14.012 9.187 45.774 1.00 22.91 ? 90 GLU A OE2 1 ATOM 719 N N . ASN A 1 91 ? 14.376 10.102 39.783 1.00 8.79 ? 91 ASN A N 1 ATOM 720 C CA . ASN A 1 91 ? 15.578 10.767 39.274 1.00 10.50 ? 91 ASN A CA 1 ATOM 721 C C . ASN A 1 91 ? 15.455 11.289 37.855 1.00 9.69 ? 91 ASN A C 1 ATOM 722 O O . ASN A 1 91 ? 16.467 11.627 37.246 1.00 7.10 ? 91 ASN A O 1 ATOM 723 C CB . ASN A 1 91 ? 16.760 9.798 39.305 1.00 14.33 ? 91 ASN A CB 1 ATOM 724 C CG . ASN A 1 91 ? 17.064 9.307 40.693 1.00 17.71 ? 91 ASN A CG 1 ATOM 725 O OD1 . ASN A 1 91 ? 17.445 10.087 41.560 1.00 20.87 ? 91 ASN A OD1 1 ATOM 726 N ND2 . ASN A 1 91 ? 16.855 8.016 40.928 1.00 19.39 ? 91 ASN A ND2 1 ATOM 727 N N . LYS A 1 92 ? 14.230 11.387 37.352 1.00 8.60 ? 92 LYS A N 1 ATOM 728 C CA . LYS A 1 92 ? 14.016 11.835 35.981 1.00 8.88 ? 92 LYS A CA 1 ATOM 729 C C . LYS A 1 92 ? 12.861 12.812 35.807 1.00 8.61 ? 92 LYS A C 1 ATOM 730 O O . LYS A 1 92 ? 11.721 12.511 36.168 1.00 8.95 ? 92 LYS A O 1 ATOM 731 C CB . LYS A 1 92 ? 13.781 10.626 35.078 1.00 9.10 ? 92 LYS A CB 1 ATOM 732 C CG . LYS A 1 92 ? 13.566 10.996 33.618 1.00 11.95 ? 92 LYS A CG 1 ATOM 733 C CD . LYS A 1 92 ? 13.467 9.762 32.759 1.00 14.04 ? 92 LYS A CD 1 ATOM 734 C CE . LYS A 1 92 ? 13.333 10.124 31.299 1.00 16.33 ? 92 LYS A CE 1 ATOM 735 N NZ . LYS A 1 92 ? 13.129 8.884 30.506 1.00 17.37 ? 92 LYS A NZ 1 ATOM 736 N N . MET A 1 93 ? 13.172 13.988 35.268 1.00 7.58 ? 93 MET A N 1 ATOM 737 C CA . MET A 1 93 ? 12.159 14.985 34.995 1.00 8.21 ? 93 MET A CA 1 ATOM 738 C C . MET A 1 93 ? 11.915 15.038 33.496 1.00 9.18 ? 93 MET A C 1 ATOM 739 O O . MET A 1 93 ? 12.833 14.838 32.690 1.00 7.74 ? 93 MET A O 1 ATOM 740 C CB . MET A 1 93 ? 12.565 16.359 35.523 1.00 9.68 ? 93 MET A CB 1 ATOM 741 C CG . MET A 1 93 ? 13.826 16.925 34.937 1.00 13.16 ? 93 MET A CG 1 ATOM 742 S SD . MET A 1 93 ? 14.238 18.543 35.628 1.00 17.49 ? 93 MET A SD 1 ATOM 743 C CE . MET A 1 93 ? 15.009 18.106 37.076 1.00 18.53 ? 93 MET A CE 1 ATOM 744 N N . VAL A 1 94 ? 10.658 15.239 33.128 1.00 9.48 ? 94 VAL A N 1 ATOM 745 C CA . VAL A 1 94 ? 10.266 15.334 31.726 1.00 9.55 ? 94 VAL A CA 1 ATOM 746 C C . VAL A 1 94 ? 9.516 16.639 31.528 1.00 10.10 ? 94 VAL A C 1 ATOM 747 O O . VAL A 1 94 ? 8.683 17.024 32.364 1.00 9.47 ? 94 VAL A O 1 ATOM 748 C CB . VAL A 1 94 ? 9.371 14.164 31.315 1.00 11.05 ? 94 VAL A CB 1 ATOM 749 C CG1 . VAL A 1 94 ? 8.878 14.354 29.878 1.00 12.88 ? 94 VAL A CG1 1 ATOM 750 C CG2 . VAL A 1 94 ? 10.147 12.866 31.420 1.00 14.00 ? 94 VAL A CG2 1 ATOM 751 N N . CYS A 1 95 ? 9.802 17.312 30.413 1.00 9.49 ? 95 CYS A N 1 ATOM 752 C CA . CYS A 1 95 ? 9.169 18.582 30.094 1.00 8.82 ? 95 CYS A CA 1 ATOM 753 C C . CYS A 1 95 ? 8.431 18.559 28.758 1.00 11.70 ? 95 CYS A C 1 ATOM 754 O O . CYS A 1 95 ? 9.014 18.215 27.723 1.00 12.29 ? 95 CYS A O 1 ATOM 755 C CB . CYS A 1 95 ? 10.229 19.679 30.059 1.00 8.79 ? 95 CYS A CB 1 ATOM 756 S SG . CYS A 1 95 ? 9.620 21.322 29.690 1.00 10.97 ? 95 CYS A SG 1 ATOM 757 N N . GLU A 1 96 ? 7.149 18.902 28.791 1.00 10.87 ? 96 GLU A N 1 ATOM 758 C CA . GLU A 1 96 ? 6.342 18.962 27.587 1.00 14.78 ? 96 GLU A CA 1 ATOM 759 C C . GLU A 1 96 ? 6.267 20.439 27.182 1.00 13.83 ? 96 GLU A C 1 ATOM 760 O O . GLU A 1 96 ? 6.044 21.311 28.030 1.00 12.79 ? 96 GLU A O 1 ATOM 761 C CB . GLU A 1 96 ? 4.957 18.397 27.885 1.00 20.21 ? 96 GLU A CB 1 ATOM 762 C CG . GLU A 1 96 ? 3.981 18.432 26.726 1.00 32.46 ? 96 GLU A CG 1 ATOM 763 C CD . GLU A 1 96 ? 2.646 17.765 27.065 1.00 38.97 ? 96 GLU A CD 1 ATOM 764 O OE1 . GLU A 1 96 ? 2.053 18.108 28.128 1.00 42.61 ? 96 GLU A OE1 1 ATOM 765 O OE2 . GLU A 1 96 ? 2.201 16.892 26.271 1.00 42.17 ? 96 GLU A OE2 1 ATOM 766 N N . GLN A 1 97 ? 6.513 20.725 25.903 1.00 13.39 ? 97 GLN A N 1 ATOM 767 C CA . GLN A 1 97 ? 6.489 22.100 25.402 1.00 13.55 ? 97 GLN A CA 1 ATOM 768 C C . GLN A 1 97 ? 5.357 22.334 24.400 1.00 15.88 ? 97 GLN A C 1 ATOM 769 O O . GLN A 1 97 ? 5.013 21.455 23.591 1.00 16.25 ? 97 GLN A O 1 ATOM 770 C CB . GLN A 1 97 ? 7.823 22.465 24.747 1.00 12.20 ? 97 GLN A CB 1 ATOM 771 C CG . GLN A 1 97 ? 9.033 22.324 25.650 1.00 12.55 ? 97 GLN A CG 1 ATOM 772 C CD . GLN A 1 97 ? 10.321 22.613 24.927 1.00 14.20 ? 97 GLN A CD 1 ATOM 773 O OE1 . GLN A 1 97 ? 10.478 22.288 23.749 1.00 12.94 ? 97 GLN A OE1 1 ATOM 774 N NE2 . GLN A 1 97 ? 11.260 23.235 25.627 1.00 14.75 ? 97 GLN A NE2 1 ATOM 775 N N . LYS A 1 98 ? 4.801 23.541 24.450 1.00 17.30 ? 98 LYS A N 1 ATOM 776 C CA . LYS A 1 98 ? 3.696 23.952 23.582 1.00 19.78 ? 98 LYS A CA 1 ATOM 777 C C . LYS A 1 98 ? 3.990 25.340 23.019 1.00 18.56 ? 98 LYS A C 1 ATOM 778 O O . LYS A 1 98 ? 4.162 26.293 23.771 1.00 17.70 ? 98 LYS A O 1 ATOM 779 C CB . LYS A 1 98 ? 2.389 23.953 24.389 1.00 23.30 ? 98 LYS A CB 1 ATOM 780 C CG . LYS A 1 98 ? 1.294 24.857 23.867 1.00 30.94 ? 98 LYS A CG 1 ATOM 781 C CD . LYS A 1 98 ? 0.210 25.047 24.934 1.00 37.10 ? 98 LYS A CD 1 ATOM 782 C CE . LYS A 1 98 ? -0.849 26.072 24.520 1.00 39.73 ? 98 LYS A CE 1 ATOM 783 N NZ . LYS A 1 98 ? -0.326 27.476 24.541 1.00 42.46 ? 98 LYS A NZ 1 ATOM 784 N N . LEU A 1 99 ? 4.073 25.445 21.696 1.00 19.35 ? 99 LEU A N 1 ATOM 785 C CA . LEU A 1 99 ? 4.357 26.721 21.041 1.00 21.32 ? 99 LEU A CA 1 ATOM 786 C C . LEU A 1 99 ? 3.307 27.770 21.351 1.00 22.86 ? 99 LEU A C 1 ATOM 787 O O . LEU A 1 99 ? 2.108 27.496 21.261 1.00 23.41 ? 99 LEU A O 1 ATOM 788 C CB . LEU A 1 99 ? 4.466 26.542 19.526 1.00 22.09 ? 99 LEU A CB 1 ATOM 789 C CG . LEU A 1 99 ? 5.692 25.792 18.997 1.00 22.72 ? 99 LEU A CG 1 ATOM 790 C CD1 . LEU A 1 99 ? 5.585 25.639 17.490 1.00 23.04 ? 99 LEU A CD1 1 ATOM 791 C CD2 . LEU A 1 99 ? 6.951 26.548 19.372 1.00 23.61 ? 99 LEU A CD2 1 ATOM 792 N N . LEU A 1 100 ? 3.767 28.962 21.722 1.00 24.11 ? 100 LEU A N 1 ATOM 793 C CA . LEU A 1 100 ? 2.879 30.070 22.051 1.00 27.59 ? 100 LEU A CA 1 ATOM 794 C C . LEU A 1 100 ? 2.130 30.545 20.815 1.00 30.94 ? 100 LEU A C 1 ATOM 795 O O . LEU A 1 100 ? 0.951 30.908 20.877 1.00 31.34 ? 100 LEU A O 1 ATOM 796 C CB . LEU A 1 100 ? 3.680 31.227 22.640 1.00 25.50 ? 100 LEU A CB 1 ATOM 797 C CG . LEU A 1 100 ? 4.254 30.947 24.020 1.00 24.80 ? 100 LEU A CG 1 ATOM 798 C CD1 . LEU A 1 100 ? 4.960 32.171 24.542 1.00 26.59 ? 100 LEU A CD1 1 ATOM 799 C CD2 . LEU A 1 100 ? 3.141 30.554 24.935 1.00 24.80 ? 100 LEU A CD2 1 ATOM 800 N N . LYS A 1 101 ? 2.835 30.531 19.689 1.00 34.60 ? 101 LYS A N 1 ATOM 801 C CA . LYS A 1 101 ? 2.282 30.961 18.413 1.00 37.81 ? 101 LYS A CA 1 ATOM 802 C C . LYS A 1 101 ? 2.847 30.088 17.292 1.00 37.39 ? 101 LYS A C 1 ATOM 803 O O . LYS A 1 101 ? 4.019 29.687 17.319 1.00 37.22 ? 101 LYS A O 1 ATOM 804 C CB . LYS A 1 101 ? 2.653 32.429 18.147 1.00 40.57 ? 101 LYS A CB 1 ATOM 805 C CG . LYS A 1 101 ? 2.182 33.426 19.212 1.00 45.13 ? 101 LYS A CG 1 ATOM 806 C CD . LYS A 1 101 ? 2.955 34.741 19.125 1.00 48.57 ? 101 LYS A CD 1 ATOM 807 C CE . LYS A 1 101 ? 4.479 34.527 19.248 1.00 51.31 ? 101 LYS A CE 1 ATOM 808 N NZ . LYS A 1 101 ? 4.917 33.952 20.559 1.00 51.14 ? 101 LYS A NZ 1 ATOM 809 N N . GLY A 1 102 ? 1.997 29.786 16.318 1.00 37.21 ? 102 GLY A N 1 ATOM 810 C CA . GLY A 1 102 ? 2.423 28.993 15.184 1.00 36.82 ? 102 GLY A CA 1 ATOM 811 C C . GLY A 1 102 ? 2.333 27.494 15.344 1.00 36.36 ? 102 GLY A C 1 ATOM 812 O O . GLY A 1 102 ? 1.690 26.977 16.265 1.00 35.74 ? 102 GLY A O 1 ATOM 813 N N . GLU A 1 103 ? 2.954 26.803 14.395 1.00 35.74 ? 103 GLU A N 1 ATOM 814 C CA . GLU A 1 103 ? 2.988 25.348 14.377 1.00 35.50 ? 103 GLU A CA 1 ATOM 815 C C . GLU A 1 103 ? 4.418 24.880 14.140 1.00 31.92 ? 103 GLU A C 1 ATOM 816 O O . GLU A 1 103 ? 5.281 25.654 13.723 1.00 31.61 ? 103 GLU A O 1 ATOM 817 C CB . GLU A 1 103 ? 2.077 24.784 13.274 1.00 39.37 ? 103 GLU A CB 1 ATOM 818 C CG . GLU A 1 103 ? 0.652 24.422 13.712 1.00 45.52 ? 103 GLU A CG 1 ATOM 819 C CD . GLU A 1 103 ? -0.383 25.503 13.395 1.00 50.23 ? 103 GLU A CD 1 ATOM 820 O OE1 . GLU A 1 103 ? -0.130 26.346 12.499 1.00 53.12 ? 103 GLU A OE1 1 ATOM 821 O OE2 . GLU A 1 103 ? -1.464 25.500 14.036 1.00 52.16 ? 103 GLU A OE2 1 ATOM 822 N N . GLY A 1 104 ? 4.653 23.604 14.414 1.00 28.97 ? 104 GLY A N 1 ATOM 823 C CA . GLY A 1 104 ? 5.967 23.024 14.231 1.00 25.41 ? 104 GLY A CA 1 ATOM 824 C C . GLY A 1 104 ? 6.012 21.648 14.863 1.00 22.09 ? 104 GLY A C 1 ATOM 825 O O . GLY A 1 104 ? 4.987 21.160 15.347 1.00 21.89 ? 104 GLY A O 1 ATOM 826 N N . PRO A 1 105 ? 7.176 20.976 14.832 1.00 19.50 ? 105 PRO A N 1 ATOM 827 C CA . PRO A 1 105 ? 7.338 19.640 15.418 1.00 17.92 ? 105 PRO A CA 1 ATOM 828 C C . PRO A 1 105 ? 7.020 19.664 16.914 1.00 15.61 ? 105 PRO A C 1 ATOM 829 O O . PRO A 1 105 ? 7.170 20.696 17.567 1.00 14.42 ? 105 PRO A O 1 ATOM 830 C CB . PRO A 1 105 ? 8.828 19.348 15.202 1.00 18.86 ? 105 PRO A CB 1 ATOM 831 C CG . PRO A 1 105 ? 9.188 20.164 14.005 1.00 18.76 ? 105 PRO A CG 1 ATOM 832 C CD . PRO A 1 105 ? 8.423 21.440 14.199 1.00 18.40 ? 105 PRO A CD 1 ATOM 833 N N . LYS A 1 106 ? 6.552 18.541 17.444 1.00 16.02 ? 106 LYS A N 1 ATOM 834 C CA . LYS A 1 106 ? 6.255 18.453 18.868 1.00 16.93 ? 106 LYS A CA 1 ATOM 835 C C . LYS A 1 106 ? 7.609 18.305 19.554 1.00 15.49 ? 106 LYS A C 1 ATOM 836 O O . LYS A 1 106 ? 8.397 17.437 19.183 1.00 14.76 ? 106 LYS A O 1 ATOM 837 C CB . LYS A 1 106 ? 5.387 17.229 19.174 1.00 20.98 ? 106 LYS A CB 1 ATOM 838 C CG . LYS A 1 106 ? 5.015 17.097 20.662 1.00 27.98 ? 106 LYS A CG 1 ATOM 839 C CD . LYS A 1 106 ? 4.463 18.433 21.229 1.00 33.23 ? 106 LYS A CD 1 ATOM 840 C CE . LYS A 1 106 ? 4.250 18.417 22.764 1.00 35.21 ? 106 LYS A CE 1 ATOM 841 N NZ . LYS A 1 106 ? 5.519 18.251 23.566 1.00 33.75 ? 106 LYS A NZ 1 ATOM 842 N N . THR A 1 107 ? 7.907 19.167 20.515 1.00 13.91 ? 107 THR A N 1 ATOM 843 C CA . THR A 1 107 ? 9.203 19.086 21.190 1.00 12.14 ? 107 THR A CA 1 ATOM 844 C C . THR A 1 107 ? 9.083 18.819 22.681 1.00 11.66 ? 107 THR A C 1 ATOM 845 O O . THR A 1 107 ? 8.061 19.120 23.295 1.00 10.59 ? 107 THR A O 1 ATOM 846 C CB . THR A 1 107 ? 10.012 20.382 21.016 1.00 12.37 ? 107 THR A CB 1 ATOM 847 O OG1 . THR A 1 107 ? 9.263 21.480 21.547 1.00 12.36 ? 107 THR A OG1 1 ATOM 848 C CG2 . THR A 1 107 ? 10.327 20.643 19.544 1.00 12.62 ? 107 THR A CG2 1 ATOM 849 N N . SER A 1 108 ? 10.140 18.249 23.250 1.00 10.16 ? 108 SER A N 1 ATOM 850 C CA . SER A 1 108 ? 10.192 17.975 24.681 1.00 9.98 ? 108 SER A CA 1 ATOM 851 C C . SER A 1 108 ? 11.649 17.774 25.081 1.00 9.90 ? 108 SER A C 1 ATOM 852 O O . SER A 1 108 ? 12.549 17.774 24.227 1.00 8.48 ? 108 SER A O 1 ATOM 853 C CB . SER A 1 108 ? 9.370 16.729 25.024 1.00 9.84 ? 108 SER A CB 1 ATOM 854 O OG . SER A 1 108 ? 9.844 15.601 24.313 1.00 13.87 ? 108 SER A OG 1 ATOM 855 N N . TRP A 1 109 ? 11.890 17.708 26.386 1.00 7.96 ? 109 TRP A N 1 ATOM 856 C CA . TRP A 1 109 ? 13.233 17.446 26.894 1.00 7.85 ? 109 TRP A CA 1 ATOM 857 C C . TRP A 1 109 ? 13.109 16.693 28.209 1.00 7.56 ? 109 TRP A C 1 ATOM 858 O O . TRP A 1 109 ? 12.053 16.728 28.837 1.00 8.14 ? 109 TRP A O 1 ATOM 859 C CB . TRP A 1 109 ? 14.094 18.722 27.051 1.00 8.25 ? 109 TRP A CB 1 ATOM 860 C CG . TRP A 1 109 ? 13.627 19.829 28.007 1.00 8.07 ? 109 TRP A CG 1 ATOM 861 C CD1 . TRP A 1 109 ? 13.120 21.046 27.648 1.00 9.28 ? 109 TRP A CD1 1 ATOM 862 C CD2 . TRP A 1 109 ? 13.745 19.865 29.450 1.00 9.31 ? 109 TRP A CD2 1 ATOM 863 N NE1 . TRP A 1 109 ? 12.929 21.836 28.760 1.00 9.69 ? 109 TRP A NE1 1 ATOM 864 C CE2 . TRP A 1 109 ? 13.306 21.136 29.878 1.00 9.04 ? 109 TRP A CE2 1 ATOM 865 C CE3 . TRP A 1 109 ? 14.186 18.939 30.416 1.00 9.92 ? 109 TRP A CE3 1 ATOM 866 C CZ2 . TRP A 1 109 ? 13.286 21.515 31.228 1.00 9.72 ? 109 TRP A CZ2 1 ATOM 867 C CZ3 . TRP A 1 109 ? 14.163 19.316 31.758 1.00 10.25 ? 109 TRP A CZ3 1 ATOM 868 C CH2 . TRP A 1 109 ? 13.717 20.593 32.149 1.00 10.11 ? 109 TRP A CH2 1 ATOM 869 N N . THR A 1 110 ? 14.136 15.924 28.549 1.00 7.39 ? 110 THR A N 1 ATOM 870 C CA . THR A 1 110 ? 14.168 15.176 29.808 1.00 6.23 ? 110 THR A CA 1 ATOM 871 C C . THR A 1 110 ? 15.577 15.334 30.395 1.00 7.40 ? 110 THR A C 1 ATOM 872 O O . THR A 1 110 ? 16.558 15.563 29.652 1.00 6.43 ? 110 THR A O 1 ATOM 873 C CB . THR A 1 110 ? 13.887 13.633 29.626 1.00 7.17 ? 110 THR A CB 1 ATOM 874 O OG1 . THR A 1 110 ? 15.000 13.002 28.973 1.00 7.49 ? 110 THR A OG1 1 ATOM 875 C CG2 . THR A 1 110 ? 12.616 13.377 28.803 1.00 6.64 ? 110 THR A CG2 1 ATOM 876 N N . ARG A 1 111 ? 15.669 15.293 31.727 1.00 6.72 ? 111 ARG A N 1 ATOM 877 C CA . ARG A 1 111 ? 16.966 15.356 32.425 1.00 6.27 ? 111 ARG A CA 1 ATOM 878 C C . ARG A 1 111 ? 16.924 14.287 33.483 1.00 7.89 ? 111 ARG A C 1 ATOM 879 O O . ARG A 1 111 ? 15.928 14.156 34.193 1.00 8.35 ? 111 ARG A O 1 ATOM 880 C CB . ARG A 1 111 ? 17.240 16.722 33.068 1.00 6.20 ? 111 ARG A CB 1 ATOM 881 C CG . ARG A 1 111 ? 17.703 17.765 32.060 1.00 7.38 ? 111 ARG A CG 1 ATOM 882 C CD . ARG A 1 111 ? 18.100 19.072 32.727 1.00 8.70 ? 111 ARG A CD 1 ATOM 883 N NE . ARG A 1 111 ? 18.783 19.965 31.784 1.00 9.83 ? 111 ARG A NE 1 ATOM 884 C CZ . ARG A 1 111 ? 18.158 20.804 30.963 1.00 10.23 ? 111 ARG A CZ 1 ATOM 885 N NH1 . ARG A 1 111 ? 16.840 20.869 30.966 1.00 10.89 ? 111 ARG A NH1 1 ATOM 886 N NH2 . ARG A 1 111 ? 18.847 21.590 30.144 1.00 11.56 ? 111 ARG A NH2 1 ATOM 887 N N . GLU A 1 112 ? 17.957 13.464 33.534 1.00 7.64 ? 112 GLU A N 1 ATOM 888 C CA . GLU A 1 112 ? 17.977 12.402 34.527 1.00 10.31 ? 112 GLU A CA 1 ATOM 889 C C . GLU A 1 112 ? 19.356 12.142 35.113 1.00 9.93 ? 112 GLU A C 1 ATOM 890 O O . GLU A 1 112 ? 20.367 12.273 34.425 1.00 7.92 ? 112 GLU A O 1 ATOM 891 C CB . GLU A 1 112 ? 17.401 11.118 33.940 1.00 14.05 ? 112 GLU A CB 1 ATOM 892 C CG . GLU A 1 112 ? 18.213 10.489 32.836 1.00 20.37 ? 112 GLU A CG 1 ATOM 893 C CD . GLU A 1 112 ? 17.484 9.325 32.177 1.00 25.09 ? 112 GLU A CD 1 ATOM 894 O OE1 . GLU A 1 112 ? 17.223 8.308 32.883 1.00 22.36 ? 112 GLU A OE1 1 ATOM 895 O OE2 . GLU A 1 112 ? 17.175 9.443 30.955 1.00 25.10 ? 112 GLU A OE2 1 ATOM 896 N N . LEU A 1 113 ? 19.387 11.816 36.401 1.00 8.96 ? 113 LEU A N 1 ATOM 897 C CA . LEU A 1 113 ? 20.634 11.503 37.091 1.00 12.04 ? 113 LEU A CA 1 ATOM 898 C C . LEU A 1 113 ? 20.789 9.991 37.081 1.00 12.06 ? 113 LEU A C 1 ATOM 899 O O . LEU A 1 113 ? 19.906 9.270 37.559 1.00 12.08 ? 113 LEU A O 1 ATOM 900 C CB . LEU A 1 113 ? 20.575 11.983 38.532 1.00 14.38 ? 113 LEU A CB 1 ATOM 901 C CG . LEU A 1 113 ? 20.768 13.465 38.799 1.00 17.46 ? 113 LEU A CG 1 ATOM 902 C CD1 . LEU A 1 113 ? 20.709 13.656 40.298 1.00 19.61 ? 113 LEU A CD1 1 ATOM 903 C CD2 . LEU A 1 113 ? 22.128 13.945 38.266 1.00 18.46 ? 113 LEU A CD2 1 ATOM 904 N N . THR A 1 114 ? 21.895 9.502 36.535 1.00 11.06 ? 114 THR A N 1 ATOM 905 C CA . THR A 1 114 ? 22.110 8.062 36.452 1.00 11.74 ? 114 THR A CA 1 ATOM 906 C C . THR A 1 114 ? 22.816 7.522 37.686 1.00 11.41 ? 114 THR A C 1 ATOM 907 O O . THR A 1 114 ? 23.327 8.282 38.501 1.00 11.47 ? 114 THR A O 1 ATOM 908 C CB . THR A 1 114 ? 22.894 7.700 35.188 1.00 12.89 ? 114 THR A CB 1 ATOM 909 O OG1 . THR A 1 114 ? 24.109 8.451 35.164 1.00 15.50 ? 114 THR A OG1 1 ATOM 910 C CG2 . THR A 1 114 ? 22.075 8.037 33.951 1.00 14.75 ? 114 THR A CG2 1 ATOM 911 N N . ASN A 1 115 ? 22.834 6.202 37.808 1.00 13.23 ? 115 ASN A N 1 ATOM 912 C CA . ASN A 1 115 ? 23.441 5.538 38.951 1.00 16.19 ? 115 ASN A CA 1 ATOM 913 C C . ASN A 1 115 ? 24.930 5.761 39.139 1.00 14.24 ? 115 ASN A C 1 ATOM 914 O O . ASN A 1 115 ? 25.432 5.626 40.256 1.00 14.74 ? 115 ASN A O 1 ATOM 915 C CB . ASN A 1 115 ? 23.123 4.047 38.918 1.00 21.89 ? 115 ASN A CB 1 ATOM 916 C CG . ASN A 1 115 ? 21.703 3.754 39.357 1.00 29.77 ? 115 ASN A CG 1 ATOM 917 O OD1 . ASN A 1 115 ? 20.955 3.046 38.669 1.00 34.83 ? 115 ASN A OD1 1 ATOM 918 N ND2 . ASN A 1 115 ? 21.313 4.310 40.516 1.00 32.90 ? 115 ASN A ND2 1 ATOM 919 N N . ASP A 1 116 ? 25.626 6.095 38.055 1.00 12.05 ? 116 ASP A N 1 ATOM 920 C CA . ASP A 1 116 ? 27.061 6.364 38.094 1.00 11.99 ? 116 ASP A CA 1 ATOM 921 C C . ASP A 1 116 ? 27.424 7.821 38.397 1.00 11.45 ? 116 ASP A C 1 ATOM 922 O O . ASP A 1 116 ? 28.592 8.184 38.393 1.00 12.23 ? 116 ASP A O 1 ATOM 923 C CB . ASP A 1 116 ? 27.764 5.875 36.806 1.00 13.89 ? 116 ASP A CB 1 ATOM 924 C CG . ASP A 1 116 ? 27.177 6.474 35.512 1.00 16.58 ? 116 ASP A CG 1 ATOM 925 O OD1 . ASP A 1 116 ? 26.263 7.303 35.569 1.00 19.66 ? 116 ASP A OD1 1 ATOM 926 O OD2 . ASP A 1 116 ? 27.651 6.113 34.422 1.00 20.14 ? 116 ASP A OD2 1 ATOM 927 N N . GLY A 1 117 ? 26.420 8.647 38.675 1.00 10.58 ? 117 GLY A N 1 ATOM 928 C CA . GLY A 1 117 ? 26.669 10.042 38.997 1.00 9.83 ? 117 GLY A CA 1 ATOM 929 C C . GLY A 1 117 ? 26.652 11.019 37.831 1.00 9.97 ? 117 GLY A C 1 ATOM 930 O O . GLY A 1 117 ? 26.945 12.192 38.019 1.00 10.45 ? 117 GLY A O 1 ATOM 931 N N . GLU A 1 118 ? 26.289 10.550 36.638 1.00 9.43 ? 118 GLU A N 1 ATOM 932 C CA . GLU A 1 118 ? 26.242 11.413 35.458 1.00 7.79 ? 118 GLU A CA 1 ATOM 933 C C . GLU A 1 118 ? 24.834 11.955 35.213 1.00 7.60 ? 118 GLU A C 1 ATOM 934 O O . GLU A 1 118 ? 23.872 11.565 35.885 1.00 8.05 ? 118 GLU A O 1 ATOM 935 C CB . GLU A 1 118 ? 26.776 10.653 34.241 1.00 8.86 ? 118 GLU A CB 1 ATOM 936 C CG . GLU A 1 118 ? 28.227 10.234 34.427 1.00 9.64 ? 118 GLU A CG 1 ATOM 937 C CD . GLU A 1 118 ? 28.770 9.370 33.310 1.00 13.39 ? 118 GLU A CD 1 ATOM 938 O OE1 . GLU A 1 118 ? 28.036 9.043 32.355 1.00 11.90 ? 118 GLU A OE1 1 ATOM 939 O OE2 . GLU A 1 118 ? 29.956 8.998 33.405 1.00 16.59 ? 118 GLU A OE2 1 ATOM 940 N N . LEU A 1 119 ? 24.732 12.884 34.269 1.00 7.57 ? 119 LEU A N 1 ATOM 941 C CA . LEU A 1 119 ? 23.467 13.513 33.917 1.00 6.94 ? 119 LEU A CA 1 ATOM 942 C C . LEU A 1 119 ? 23.189 13.277 32.431 1.00 8.29 ? 119 LEU A C 1 ATOM 943 O O . LEU A 1 119 ? 24.070 13.506 31.593 1.00 8.23 ? 119 LEU A O 1 ATOM 944 C CB . LEU A 1 119 ? 23.556 15.023 34.184 1.00 7.83 ? 119 LEU A CB 1 ATOM 945 C CG . LEU A 1 119 ? 22.417 15.972 33.810 1.00 9.54 ? 119 LEU A CG 1 ATOM 946 C CD1 . LEU A 1 119 ? 21.213 15.661 34.618 1.00 11.05 ? 119 LEU A CD1 1 ATOM 947 C CD2 . LEU A 1 119 ? 22.822 17.421 34.066 1.00 12.54 ? 119 LEU A CD2 1 ATOM 948 N N . ILE A 1 120 ? 22.010 12.743 32.119 1.00 6.17 ? 120 ILE A N 1 ATOM 949 C CA . ILE A 1 120 ? 21.638 12.529 30.730 1.00 6.22 ? 120 ILE A CA 1 ATOM 950 C C . ILE A 1 120 ? 20.527 13.511 30.354 1.00 7.47 ? 120 ILE A C 1 ATOM 951 O O . ILE A 1 120 ? 19.493 13.580 31.036 1.00 6.54 ? 120 ILE A O 1 ATOM 952 C CB . ILE A 1 120 ? 21.103 11.118 30.485 1.00 7.19 ? 120 ILE A CB 1 ATOM 953 C CG1 . ILE A 1 120 ? 22.171 10.070 30.801 1.00 8.26 ? 120 ILE A CG1 1 ATOM 954 C CG2 . ILE A 1 120 ? 20.556 11.003 29.047 1.00 6.54 ? 120 ILE A CG2 1 ATOM 955 C CD1 . ILE A 1 120 ? 21.668 8.658 30.600 1.00 9.35 ? 120 ILE A CD1 1 ATOM 956 N N . LEU A 1 121 ? 20.771 14.301 29.306 1.00 6.41 ? 121 LEU A N 1 ATOM 957 C CA . LEU A 1 121 ? 19.783 15.236 28.779 1.00 6.25 ? 121 LEU A CA 1 ATOM 958 C C . LEU A 1 121 ? 19.299 14.693 27.426 1.00 7.41 ? 121 LEU A C 1 ATOM 959 O O . LEU A 1 121 ? 20.115 14.242 26.619 1.00 6.01 ? 121 LEU A O 1 ATOM 960 C CB . LEU A 1 121 ? 20.400 16.624 28.526 1.00 7.37 ? 121 LEU A CB 1 ATOM 961 C CG . LEU A 1 121 ? 19.607 17.580 27.597 1.00 7.96 ? 121 LEU A CG 1 ATOM 962 C CD1 . LEU A 1 121 ? 18.340 18.117 28.290 1.00 7.91 ? 121 LEU A CD1 1 ATOM 963 C CD2 . LEU A 1 121 ? 20.501 18.739 27.151 1.00 7.96 ? 121 LEU A CD2 1 ATOM 964 N N . THR A 1 122 ? 17.988 14.607 27.222 1.00 6.71 ? 122 THR A N 1 ATOM 965 C CA . THR A 1 122 ? 17.514 14.205 25.898 1.00 7.80 ? 122 THR A CA 1 ATOM 966 C C . THR A 1 122 ? 16.633 15.334 25.402 1.00 8.58 ? 122 THR A C 1 ATOM 967 O O . THR A 1 122 ? 15.988 16.034 26.194 1.00 7.21 ? 122 THR A O 1 ATOM 968 C CB . THR A 1 122 ? 16.754 12.843 25.832 1.00 7.51 ? 122 THR A CB 1 ATOM 969 O OG1 . THR A 1 122 ? 15.422 12.992 26.313 1.00 9.27 ? 122 THR A OG1 1 ATOM 970 C CG2 . THR A 1 122 ? 17.484 11.759 26.622 1.00 7.86 ? 122 THR A CG2 1 ATOM 971 N N . MET A 1 123 ? 16.732 15.613 24.110 1.00 7.87 ? 123 MET A N 1 ATOM 972 C CA . MET A 1 123 ? 15.904 16.643 23.494 1.00 9.22 ? 123 MET A CA 1 ATOM 973 C C . MET A 1 123 ? 15.194 15.950 22.337 1.00 8.66 ? 123 MET A C 1 ATOM 974 O O . MET A 1 123 ? 15.828 15.189 21.601 1.00 8.09 ? 123 MET A O 1 ATOM 975 C CB . MET A 1 123 ? 16.760 17.818 23.019 1.00 9.37 ? 123 MET A CB 1 ATOM 976 C CG . MET A 1 123 ? 17.359 18.612 24.171 1.00 11.81 ? 123 MET A CG 1 ATOM 977 S SD . MET A 1 123 ? 18.325 20.048 23.658 1.00 16.59 ? 123 MET A SD 1 ATOM 978 C CE . MET A 1 123 ? 19.871 19.278 23.173 1.00 14.10 ? 123 MET A CE 1 ATOM 979 N N . THR A 1 124 ? 13.895 16.195 22.186 1.00 7.20 ? 124 THR A N 1 ATOM 980 C CA . THR A 1 124 ? 13.133 15.534 21.134 1.00 9.54 ? 124 THR A CA 1 ATOM 981 C C . THR A 1 124 ? 12.407 16.513 20.222 1.00 10.12 ? 124 THR A C 1 ATOM 982 O O . THR A 1 124 ? 11.941 17.563 20.665 1.00 9.54 ? 124 THR A O 1 ATOM 983 C CB . THR A 1 124 ? 12.073 14.552 21.756 1.00 10.74 ? 124 THR A CB 1 ATOM 984 O OG1 . THR A 1 124 ? 12.740 13.544 22.535 1.00 11.99 ? 124 THR A OG1 1 ATOM 985 C CG2 . THR A 1 124 ? 11.247 13.865 20.679 1.00 11.66 ? 124 THR A CG2 1 ATOM 986 N N . ALA A 1 125 ? 12.346 16.167 18.935 1.00 11.06 ? 125 ALA A N 1 ATOM 987 C CA . ALA A 1 125 ? 11.634 16.962 17.923 1.00 11.63 ? 125 ALA A CA 1 ATOM 988 C C . ALA A 1 125 ? 10.981 15.878 17.078 1.00 13.46 ? 125 ALA A C 1 ATOM 989 O O . ALA A 1 125 ? 11.669 15.144 16.352 1.00 13.11 ? 125 ALA A O 1 ATOM 990 C CB . ALA A 1 125 ? 12.603 17.786 17.091 1.00 13.16 ? 125 ALA A CB 1 ATOM 991 N N . ASP A 1 126 ? 9.664 15.754 17.216 1.00 14.63 ? 126 ASP A N 1 ATOM 992 C CA . ASP A 1 126 ? 8.901 14.721 16.536 1.00 17.86 ? 126 ASP A CA 1 ATOM 993 C C . ASP A 1 126 ? 9.512 13.364 16.905 1.00 18.66 ? 126 ASP A C 1 ATOM 994 O O . ASP A 1 126 ? 9.519 13.006 18.080 1.00 19.38 ? 126 ASP A O 1 ATOM 995 C CB . ASP A 1 126 ? 8.835 14.982 15.023 1.00 18.40 ? 126 ASP A CB 1 ATOM 996 C CG . ASP A 1 126 ? 7.786 16.032 14.660 1.00 22.34 ? 126 ASP A CG 1 ATOM 997 O OD1 . ASP A 1 126 ? 6.800 16.198 15.422 1.00 23.23 ? 126 ASP A OD1 1 ATOM 998 O OD2 . ASP A 1 126 ? 7.940 16.702 13.621 1.00 24.32 ? 126 ASP A OD2 1 ATOM 999 N N . ASP A 1 127 ? 10.064 12.629 15.945 1.00 20.19 ? 127 ASP A N 1 ATOM 1000 C CA . ASP A 1 127 ? 10.656 11.333 16.271 1.00 21.56 ? 127 ASP A CA 1 ATOM 1001 C C . ASP A 1 127 ? 12.175 11.279 16.416 1.00 18.85 ? 127 ASP A C 1 ATOM 1002 O O . ASP A 1 127 ? 12.732 10.219 16.657 1.00 20.67 ? 127 ASP A O 1 ATOM 1003 C CB . ASP A 1 127 ? 10.178 10.263 15.303 1.00 26.47 ? 127 ASP A CB 1 ATOM 1004 C CG . ASP A 1 127 ? 9.043 9.450 15.880 1.00 33.21 ? 127 ASP A CG 1 ATOM 1005 O OD1 . ASP A 1 127 ? 7.892 9.959 15.934 1.00 36.08 ? 127 ASP A OD1 1 ATOM 1006 O OD2 . ASP A 1 127 ? 9.318 8.308 16.318 1.00 38.35 ? 127 ASP A OD2 1 ATOM 1007 N N . VAL A 1 128 ? 12.836 12.418 16.281 1.00 15.22 ? 128 VAL A N 1 ATOM 1008 C CA . VAL A 1 128 ? 14.286 12.486 16.407 1.00 12.83 ? 128 VAL A CA 1 ATOM 1009 C C . VAL A 1 128 ? 14.681 12.843 17.835 1.00 11.58 ? 128 VAL A C 1 ATOM 1010 O O . VAL A 1 128 ? 14.176 13.811 18.408 1.00 9.74 ? 128 VAL A O 1 ATOM 1011 C CB . VAL A 1 128 ? 14.864 13.503 15.423 1.00 12.79 ? 128 VAL A CB 1 ATOM 1012 C CG1 . VAL A 1 128 ? 16.338 13.757 15.706 1.00 12.93 ? 128 VAL A CG1 1 ATOM 1013 C CG2 . VAL A 1 128 ? 14.677 12.968 14.005 1.00 14.30 ? 128 VAL A CG2 1 ATOM 1014 N N . VAL A 1 129 ? 15.586 12.051 18.397 1.00 9.29 ? 129 VAL A N 1 ATOM 1015 C CA . VAL A 1 129 ? 16.054 12.257 19.761 1.00 7.95 ? 129 VAL A CA 1 ATOM 1016 C C . VAL A 1 129 ? 17.558 12.546 19.842 1.00 7.49 ? 129 VAL A C 1 ATOM 1017 O O . VAL A 1 129 ? 18.374 11.816 19.276 1.00 8.73 ? 129 VAL A O 1 ATOM 1018 C CB . VAL A 1 129 ? 15.764 11.007 20.617 1.00 9.43 ? 129 VAL A CB 1 ATOM 1019 C CG1 . VAL A 1 129 ? 16.153 11.253 22.076 1.00 9.09 ? 129 VAL A CG1 1 ATOM 1020 C CG2 . VAL A 1 129 ? 14.293 10.610 20.495 1.00 9.45 ? 129 VAL A CG2 1 ATOM 1021 N N . CYS A 1 130 ? 17.912 13.630 20.534 1.00 7.54 ? 130 CYS A N 1 ATOM 1022 C CA . CYS A 1 130 ? 19.305 14.010 20.756 1.00 6.47 ? 130 CYS A CA 1 ATOM 1023 C C . CYS A 1 130 ? 19.670 13.627 22.200 1.00 6.61 ? 130 CYS A C 1 ATOM 1024 O O . CYS A 1 130 ? 18.955 13.992 23.135 1.00 7.53 ? 130 CYS A O 1 ATOM 1025 C CB . CYS A 1 130 ? 19.485 15.517 20.544 1.00 6.05 ? 130 CYS A CB 1 ATOM 1026 S SG . CYS A 1 130 ? 21.063 16.183 21.077 1.00 8.82 ? 130 CYS A SG 1 ATOM 1027 N N . THR A 1 131 ? 20.786 12.925 22.372 1.00 6.58 ? 131 THR A N 1 ATOM 1028 C CA . THR A 1 131 ? 21.241 12.462 23.693 1.00 5.93 ? 131 THR A CA 1 ATOM 1029 C C . THR A 1 131 ? 22.569 13.102 24.054 1.00 6.18 ? 131 THR A C 1 ATOM 1030 O O . THR A 1 131 ? 23.528 13.003 23.294 1.00 5.77 ? 131 THR A O 1 ATOM 1031 C CB . THR A 1 131 ? 21.419 10.914 23.699 1.00 6.63 ? 131 THR A CB 1 ATOM 1032 O OG1 . THR A 1 131 ? 20.199 10.299 23.289 1.00 7.60 ? 131 THR A OG1 1 ATOM 1033 C CG2 . THR A 1 131 ? 21.763 10.399 25.091 1.00 7.76 ? 131 THR A CG2 1 ATOM 1034 N N . ARG A 1 132 ? 22.624 13.780 25.202 1.00 6.29 ? 132 ARG A N 1 ATOM 1035 C CA . ARG A 1 132 ? 23.853 14.429 25.660 1.00 7.67 ? 132 ARG A CA 1 ATOM 1036 C C . ARG A 1 132 ? 24.108 13.960 27.093 1.00 7.19 ? 132 ARG A C 1 ATOM 1037 O O . ARG A 1 132 ? 23.184 13.895 27.902 1.00 8.65 ? 132 ARG A O 1 ATOM 1038 C CB . ARG A 1 132 ? 23.719 15.957 25.621 1.00 9.67 ? 132 ARG A CB 1 ATOM 1039 C CG . ARG A 1 132 ? 22.945 16.470 24.429 1.00 15.02 ? 132 ARG A CG 1 ATOM 1040 C CD . ARG A 1 132 ? 23.781 17.260 23.476 1.00 16.80 ? 132 ARG A CD 1 ATOM 1041 N NE . ARG A 1 132 ? 24.140 18.580 23.984 1.00 12.48 ? 132 ARG A NE 1 ATOM 1042 C CZ . ARG A 1 132 ? 25.030 19.377 23.395 1.00 12.93 ? 132 ARG A CZ 1 ATOM 1043 N NH1 . ARG A 1 132 ? 25.641 19.005 22.279 1.00 13.84 ? 132 ARG A NH1 1 ATOM 1044 N NH2 . ARG A 1 132 ? 25.398 20.506 23.973 1.00 11.57 ? 132 ARG A NH2 1 ATOM 1045 N N . VAL A 1 133 ? 25.359 13.633 27.397 1.00 5.99 ? 133 VAL A N 1 ATOM 1046 C CA . VAL A 1 133 ? 25.739 13.124 28.719 1.00 5.92 ? 133 VAL A CA 1 ATOM 1047 C C . VAL A 1 133 ? 26.773 14.055 29.345 1.00 5.85 ? 133 VAL A C 1 ATOM 1048 O O . VAL A 1 133 ? 27.713 14.492 28.681 1.00 5.50 ? 133 VAL A O 1 ATOM 1049 C CB . VAL A 1 133 ? 26.333 11.698 28.608 1.00 6.37 ? 133 VAL A CB 1 ATOM 1050 C CG1 . VAL A 1 133 ? 26.609 11.120 29.988 1.00 7.95 ? 133 VAL A CG1 1 ATOM 1051 C CG2 . VAL A 1 133 ? 25.385 10.782 27.832 1.00 6.46 ? 133 VAL A CG2 1 ATOM 1052 N N . TYR A 1 134 ? 26.619 14.337 30.635 1.00 5.35 ? 134 TYR A N 1 ATOM 1053 C CA . TYR A 1 134 ? 27.538 15.228 31.322 1.00 4.57 ? 134 TYR A CA 1 ATOM 1054 C C . TYR A 1 134 ? 28.014 14.611 32.617 1.00 5.30 ? 134 TYR A C 1 ATOM 1055 O O . TYR A 1 134 ? 27.371 13.712 33.165 1.00 3.92 ? 134 TYR A O 1 ATOM 1056 C CB . TYR A 1 134 ? 26.846 16.550 31.686 1.00 6.84 ? 134 TYR A CB 1 ATOM 1057 C CG . TYR A 1 134 ? 26.118 17.251 30.574 1.00 8.89 ? 134 TYR A CG 1 ATOM 1058 C CD1 . TYR A 1 134 ? 24.901 16.762 30.122 1.00 10.29 ? 134 TYR A CD1 1 ATOM 1059 C CD2 . TYR A 1 134 ? 26.628 18.406 29.992 1.00 10.49 ? 134 TYR A CD2 1 ATOM 1060 C CE1 . TYR A 1 134 ? 24.212 17.386 29.133 1.00 13.03 ? 134 TYR A CE1 1 ATOM 1061 C CE2 . TYR A 1 134 ? 25.930 19.051 28.982 1.00 12.15 ? 134 TYR A CE2 1 ATOM 1062 C CZ . TYR A 1 134 ? 24.723 18.517 28.567 1.00 12.80 ? 134 TYR A CZ 1 ATOM 1063 O OH . TYR A 1 134 ? 23.991 19.082 27.567 1.00 18.07 ? 134 TYR A OH 1 ATOM 1064 N N . VAL A 1 135 ? 29.113 15.158 33.119 1.00 6.63 ? 135 VAL A N 1 ATOM 1065 C CA . VAL A 1 135 ? 29.697 14.762 34.394 1.00 8.42 ? 135 VAL A CA 1 ATOM 1066 C C . VAL A 1 135 ? 30.100 16.086 35.064 1.00 9.05 ? 135 VAL A C 1 ATOM 1067 O O . VAL A 1 135 ? 30.340 17.086 34.385 1.00 9.02 ? 135 VAL A O 1 ATOM 1068 C CB . VAL A 1 135 ? 30.925 13.815 34.204 1.00 8.05 ? 135 VAL A CB 1 ATOM 1069 C CG1 . VAL A 1 135 ? 32.109 14.556 33.596 1.00 9.27 ? 135 VAL A CG1 1 ATOM 1070 C CG2 . VAL A 1 135 ? 31.304 13.151 35.533 1.00 10.37 ? 135 VAL A CG2 1 ATOM 1071 N N . ARG A 1 136 ? 30.117 16.133 36.390 1.00 9.57 ? 136 ARG A N 1 ATOM 1072 C CA . ARG A 1 136 ? 30.498 17.375 37.040 1.00 10.86 ? 136 ARG A CA 1 ATOM 1073 C C . ARG A 1 136 ? 31.964 17.676 36.776 1.00 11.68 ? 136 ARG A C 1 ATOM 1074 O O . ARG A 1 136 ? 32.782 16.765 36.686 1.00 11.35 ? 136 ARG A O 1 ATOM 1075 C CB . ARG A 1 136 ? 30.221 17.319 38.536 1.00 11.99 ? 136 ARG A CB 1 ATOM 1076 C CG . ARG A 1 136 ? 28.746 17.454 38.885 1.00 13.89 ? 136 ARG A CG 1 ATOM 1077 C CD . ARG A 1 136 ? 28.576 17.533 40.382 1.00 15.85 ? 136 ARG A CD 1 ATOM 1078 N NE . ARG A 1 136 ? 27.185 17.407 40.754 1.00 17.08 ? 136 ARG A NE 1 ATOM 1079 C CZ . ARG A 1 136 ? 26.561 16.245 40.926 1.00 21.69 ? 136 ARG A CZ 1 ATOM 1080 N NH1 . ARG A 1 136 ? 27.217 15.102 40.754 1.00 23.26 ? 136 ARG A NH1 1 ATOM 1081 N NH2 . ARG A 1 136 ? 25.278 16.227 41.283 1.00 22.60 ? 136 ARG A NH2 1 ATOM 1082 N N . GLU A 1 137 ? 32.282 18.963 36.663 1.00 15.12 ? 137 GLU A N 1 ATOM 1083 C CA . GLU A 1 137 ? 33.641 19.430 36.400 1.00 18.00 ? 137 GLU A CA 1 ATOM 1084 C C . GLU A 1 137 ? 34.615 19.038 37.493 1.00 18.96 ? 137 GLU A C 1 ATOM 1085 O O . GLU A 1 137 ? 34.221 19.175 38.659 1.00 17.37 ? 137 GLU A O 1 ATOM 1086 C CB . GLU A 1 137 ? 33.661 20.943 36.293 1.00 19.89 ? 137 GLU A CB 1 ATOM 1087 C CG . GLU A 1 137 ? 33.092 21.492 35.035 1.00 28.03 ? 137 GLU A CG 1 ATOM 1088 C CD . GLU A 1 137 ? 33.469 22.953 34.865 1.00 33.22 ? 137 GLU A CD 1 ATOM 1089 O OE1 . GLU A 1 137 ? 34.630 23.217 34.473 1.00 37.31 ? 137 GLU A OE1 1 ATOM 1090 O OE2 . GLU A 1 137 ? 32.636 23.836 35.164 1.00 36.38 ? 137 GLU A OE2 1 ATOM 1091 O OXT . GLU A 1 137 ? 35.776 18.680 37.173 1.00 22.23 ? 137 GLU A OXT 1 HETATM 1092 C C1 . REA B 2 . ? 21.972 29.831 16.739 1.00 15.25 ? 200 REA A C1 1 HETATM 1093 C C2 . REA B 2 . ? 20.921 30.524 15.841 1.00 15.61 ? 200 REA A C2 1 HETATM 1094 C C3 . REA B 2 . ? 20.245 29.635 14.848 1.00 16.19 ? 200 REA A C3 1 HETATM 1095 C C4 . REA B 2 . ? 19.555 28.479 15.488 1.00 14.59 ? 200 REA A C4 1 HETATM 1096 C C5 . REA B 2 . ? 20.389 27.812 16.587 1.00 14.10 ? 200 REA A C5 1 HETATM 1097 C C6 . REA B 2 . ? 21.425 28.446 17.218 1.00 14.42 ? 200 REA A C6 1 HETATM 1098 C C7 . REA B 2 . ? 22.242 27.851 18.297 1.00 13.89 ? 200 REA A C7 1 HETATM 1099 C C8 . REA B 2 . ? 21.868 26.977 19.240 1.00 11.86 ? 200 REA A C8 1 HETATM 1100 C C9 . REA B 2 . ? 22.705 26.434 20.286 1.00 10.87 ? 200 REA A C9 1 HETATM 1101 C C10 . REA B 2 . ? 22.159 25.536 21.131 1.00 9.19 ? 200 REA A C10 1 HETATM 1102 C C11 . REA B 2 . ? 22.875 24.924 22.234 1.00 10.35 ? 200 REA A C11 1 HETATM 1103 C C12 . REA B 2 . ? 22.237 24.026 22.990 1.00 10.53 ? 200 REA A C12 1 HETATM 1104 C C13 . REA B 2 . ? 22.856 23.377 24.125 1.00 10.91 ? 200 REA A C13 1 HETATM 1105 C C14 . REA B 2 . ? 22.135 22.473 24.834 1.00 11.88 ? 200 REA A C14 1 HETATM 1106 C C15 . REA B 2 . ? 22.563 21.710 26.016 1.00 14.86 ? 200 REA A C15 1 HETATM 1107 C C16 . REA B 2 . ? 22.238 30.737 17.948 1.00 15.47 ? 200 REA A C16 1 HETATM 1108 C C17 . REA B 2 . ? 23.292 29.620 15.948 1.00 13.42 ? 200 REA A C17 1 HETATM 1109 C C18 . REA B 2 . ? 19.791 26.449 16.947 1.00 12.61 ? 200 REA A C18 1 HETATM 1110 C C19 . REA B 2 . ? 24.181 26.841 20.385 1.00 10.08 ? 200 REA A C19 1 HETATM 1111 C C20 . REA B 2 . ? 24.303 23.747 24.489 1.00 10.10 ? 200 REA A C20 1 HETATM 1112 O O1 . REA B 2 . ? 23.640 21.075 25.978 1.00 13.29 ? 200 REA A O1 1 HETATM 1113 O O2 . REA B 2 . ? 21.840 21.712 27.037 1.00 10.99 ? 200 REA A O2 1 HETATM 1114 O O . HOH C 3 . ? 21.817 19.604 31.169 1.00 17.43 ? 300 HOH A O 1 HETATM 1115 O O . HOH C 3 . ? 7.617 26.892 37.107 1.00 12.66 ? 301 HOH A O 1 HETATM 1116 O O . HOH C 3 . ? 22.885 27.835 25.056 1.00 18.86 ? 302 HOH A O 1 HETATM 1117 O O . HOH C 3 . ? 30.685 27.402 22.818 1.00 14.12 ? 303 HOH A O 1 HETATM 1118 O O . HOH C 3 . ? 29.930 20.839 40.398 1.00 16.48 ? 304 HOH A O 1 HETATM 1119 O O . HOH C 3 . ? 31.492 21.096 28.452 1.00 16.65 ? 305 HOH A O 1 HETATM 1120 O O . HOH C 3 . ? 19.459 26.601 30.320 1.00 9.81 ? 306 HOH A O 1 HETATM 1121 O O . HOH C 3 . ? 19.116 26.759 22.930 1.00 22.33 ? 307 HOH A O 1 HETATM 1122 O O . HOH C 3 . ? 16.356 22.299 28.453 1.00 35.46 ? 308 HOH A O 1 HETATM 1123 O O . HOH C 3 . ? 21.823 21.939 29.734 1.00 13.95 ? 309 HOH A O 1 HETATM 1124 O O . HOH C 3 . ? 13.206 22.267 22.102 1.00 20.07 ? 310 HOH A O 1 HETATM 1125 O O . HOH C 3 . ? 30.300 22.803 12.740 1.00 24.70 ? 311 HOH A O 1 HETATM 1126 O O . HOH C 3 . ? 7.344 23.059 35.600 1.00 8.82 ? 312 HOH A O 1 HETATM 1127 O O . HOH C 3 . ? 6.876 22.668 20.375 1.00 29.74 ? 313 HOH A O 1 HETATM 1128 O O . HOH C 3 . ? 17.917 24.800 29.159 1.00 23.69 ? 314 HOH A O 1 HETATM 1129 O O . HOH C 3 . ? 37.101 16.714 38.714 1.00 19.84 ? 315 HOH A O 1 HETATM 1130 O O . HOH C 3 . ? 28.721 7.425 30.043 1.00 14.94 ? 316 HOH A O 1 HETATM 1131 O O . HOH C 3 . ? 13.212 14.450 25.193 1.00 18.03 ? 317 HOH A O 1 HETATM 1132 O O . HOH C 3 . ? 6.094 9.777 39.151 1.00 13.98 ? 318 HOH A O 1 HETATM 1133 O O . HOH C 3 . ? 19.296 10.379 13.144 1.00 27.20 ? 319 HOH A O 1 HETATM 1134 O O . HOH C 3 . ? 25.337 10.931 16.577 1.00 18.41 ? 320 HOH A O 1 HETATM 1135 O O . HOH C 3 . ? 25.244 34.269 18.193 1.00 9.65 ? 321 HOH A O 1 HETATM 1136 O O . HOH C 3 . ? 23.567 10.727 14.429 1.00 11.13 ? 322 HOH A O 1 HETATM 1137 O O . HOH C 3 . ? 17.151 12.178 30.238 1.00 11.53 ? 323 HOH A O 1 HETATM 1138 O O . HOH C 3 . ? 27.768 11.967 42.077 1.00 23.33 ? 324 HOH A O 1 HETATM 1139 O O . HOH C 3 . ? 30.270 12.554 21.386 1.00 25.05 ? 325 HOH A O 1 HETATM 1140 O O . HOH C 3 . ? 25.662 15.488 18.515 1.00 10.80 ? 326 HOH A O 1 HETATM 1141 O O . HOH C 3 . ? 4.514 21.426 18.685 1.00 45.94 ? 327 HOH A O 1 HETATM 1142 O O . HOH C 3 . ? 8.081 23.201 17.690 1.00 30.16 ? 328 HOH A O 1 HETATM 1143 O O . HOH C 3 . ? 13.242 29.389 14.924 1.00 39.93 ? 329 HOH A O 1 HETATM 1144 O O . HOH C 3 . ? 10.514 18.772 10.176 1.00 33.65 ? 330 HOH A O 1 HETATM 1145 O O . HOH C 3 . ? 10.555 13.666 26.313 1.00 32.55 ? 331 HOH A O 1 HETATM 1146 O O . HOH C 3 . ? 5.189 16.418 31.375 1.00 35.78 ? 332 HOH A O 1 HETATM 1147 O O . HOH C 3 . ? 0.738 25.633 36.349 1.00 29.00 ? 333 HOH A O 1 HETATM 1148 O O . HOH C 3 . ? 2.976 28.966 37.321 1.00 40.14 ? 334 HOH A O 1 HETATM 1149 O O . HOH C 3 . ? 6.424 28.750 38.849 1.00 32.17 ? 335 HOH A O 1 HETATM 1150 O O . HOH C 3 . ? 12.503 30.488 31.704 1.00 41.11 ? 336 HOH A O 1 HETATM 1151 O O . HOH C 3 . ? 14.979 30.157 27.559 1.00 23.78 ? 337 HOH A O 1 HETATM 1152 O O . HOH C 3 . ? 17.312 32.981 28.812 1.00 20.84 ? 338 HOH A O 1 HETATM 1153 O O . HOH C 3 . ? 29.473 25.946 34.693 1.00 29.05 ? 339 HOH A O 1 HETATM 1154 O O . HOH C 3 . ? 30.328 23.817 33.494 1.00 24.17 ? 340 HOH A O 1 HETATM 1155 O O . HOH C 3 . ? 31.158 28.144 26.433 1.00 42.66 ? 341 HOH A O 1 HETATM 1156 O O . HOH C 3 . ? 30.276 28.397 16.400 1.00 21.90 ? 342 HOH A O 1 HETATM 1157 O O . HOH C 3 . ? 19.533 23.600 26.857 1.00 21.12 ? 343 HOH A O 1 HETATM 1158 O O . HOH C 3 . ? 17.892 24.675 24.549 1.00 48.11 ? 344 HOH A O 1 HETATM 1159 O O . HOH C 3 . ? 14.211 24.152 25.435 1.00 21.09 ? 345 HOH A O 1 HETATM 1160 O O . HOH C 3 . ? 15.223 27.626 27.056 1.00 27.16 ? 346 HOH A O 1 HETATM 1161 O O . HOH C 3 . ? 3.502 22.911 43.083 1.00 30.15 ? 347 HOH A O 1 HETATM 1162 O O . HOH C 3 . ? 20.610 7.668 40.212 1.00 49.06 ? 348 HOH A O 1 HETATM 1163 O O . HOH C 3 . ? 24.813 2.899 36.403 1.00 48.98 ? 349 HOH A O 1 HETATM 1164 O O . HOH C 3 . ? 29.900 5.163 26.918 1.00 23.60 ? 350 HOH A O 1 HETATM 1165 O O . HOH C 3 . ? 14.333 5.466 42.757 1.00 22.90 ? 351 HOH A O 1 HETATM 1166 O O . HOH C 3 . ? 8.914 5.771 35.515 1.00 35.92 ? 352 HOH A O 1 HETATM 1167 O O . HOH C 3 . ? 14.519 28.906 40.193 1.00 28.73 ? 353 HOH A O 1 HETATM 1168 O O . HOH C 3 . ? 17.573 20.203 47.080 1.00 37.63 ? 354 HOH A O 1 HETATM 1169 O O . HOH C 3 . ? 13.324 32.251 34.152 1.00 47.79 ? 355 HOH A O 1 HETATM 1170 O O . HOH C 3 . ? 12.491 24.840 7.594 1.00 39.45 ? 356 HOH A O 1 HETATM 1171 O O . HOH C 3 . ? 25.066 15.777 15.214 1.00 27.39 ? 357 HOH A O 1 HETATM 1172 O O . HOH C 3 . ? 27.138 17.638 17.834 1.00 45.12 ? 358 HOH A O 1 HETATM 1173 O O . HOH C 3 . ? 27.611 19.792 19.503 1.00 24.45 ? 359 HOH A O 1 HETATM 1174 O O . HOH C 3 . ? 11.358 8.880 19.119 1.00 24.31 ? 360 HOH A O 1 HETATM 1175 O O . HOH C 3 . ? 16.252 27.169 24.557 1.00 25.40 ? 361 HOH A O 1 HETATM 1176 O O . HOH C 3 . ? 22.049 27.870 4.565 1.00 25.37 ? 362 HOH A O 1 HETATM 1177 O O . HOH C 3 . ? 11.533 6.689 34.501 1.00 29.92 ? 363 HOH A O 1 HETATM 1178 O O . HOH C 3 . ? 13.269 4.551 36.338 1.00 45.75 ? 364 HOH A O 1 HETATM 1179 O O . HOH C 3 . ? 23.149 9.493 41.173 1.00 30.10 ? 365 HOH A O 1 HETATM 1180 O O . HOH C 3 . ? 21.090 12.171 43.973 1.00 27.97 ? 366 HOH A O 1 HETATM 1181 O O . HOH C 3 . ? 11.884 13.399 42.560 1.00 23.28 ? 367 HOH A O 1 HETATM 1182 O O . HOH C 3 . ? 29.542 17.520 20.025 1.00 38.32 ? 368 HOH A O 1 HETATM 1183 O O . HOH C 3 . ? 31.058 17.427 22.538 1.00 37.85 ? 369 HOH A O 1 HETATM 1184 O O . HOH C 3 . ? 31.928 9.444 23.294 1.00 46.07 ? 370 HOH A O 1 HETATM 1185 O O . HOH C 3 . ? 25.699 10.933 9.557 1.00 44.12 ? 371 HOH A O 1 HETATM 1186 O O . HOH C 3 . ? 26.533 13.428 16.334 1.00 45.21 ? 372 HOH A O 1 HETATM 1187 O O . HOH C 3 . ? 27.078 16.850 13.245 1.00 39.52 ? 373 HOH A O 1 HETATM 1188 O O . HOH C 3 . ? 20.596 32.070 6.807 1.00 36.38 ? 374 HOH A O 1 HETATM 1189 O O . HOH C 3 . ? 17.126 28.421 9.515 1.00 23.81 ? 375 HOH A O 1 HETATM 1190 O O . HOH C 3 . ? 16.626 32.383 11.231 1.00 20.11 ? 376 HOH A O 1 HETATM 1191 O O . HOH C 3 . ? 6.046 30.510 19.639 1.00 29.02 ? 377 HOH A O 1 HETATM 1192 O O . HOH C 3 . ? 9.543 16.072 11.145 1.00 50.91 ? 378 HOH A O 1 HETATM 1193 O O . HOH C 3 . ? 8.174 14.289 20.240 1.00 54.21 ? 379 HOH A O 1 HETATM 1194 O O . HOH C 3 . ? 11.561 10.834 22.873 1.00 43.23 ? 380 HOH A O 1 HETATM 1195 O O . HOH C 3 . ? 5.486 15.385 24.922 1.00 50.19 ? 381 HOH A O 1 HETATM 1196 O O . HOH C 3 . ? 6.038 21.424 43.276 1.00 46.64 ? 382 HOH A O 1 HETATM 1197 O O . HOH C 3 . ? 34.144 19.165 27.284 1.00 41.41 ? 383 HOH A O 1 HETATM 1198 O O . HOH C 3 . ? 16.916 27.142 42.621 1.00 29.32 ? 384 HOH A O 1 HETATM 1199 O O . HOH C 3 . ? 25.509 24.918 41.520 1.00 32.12 ? 385 HOH A O 1 HETATM 1200 O O . HOH C 3 . ? 31.446 7.504 31.389 1.00 28.93 ? 386 HOH A O 1 HETATM 1201 O O . HOH C 3 . ? 18.212 20.893 5.892 1.00 29.90 ? 387 HOH A O 1 HETATM 1202 O O . HOH C 3 . ? 15.148 27.608 7.685 1.00 30.91 ? 388 HOH A O 1 HETATM 1203 O O . HOH C 3 . ? 2.656 23.148 20.117 1.00 35.98 ? 389 HOH A O 1 HETATM 1204 O O . HOH C 3 . ? 3.100 22.690 28.640 1.00 31.31 ? 390 HOH A O 1 HETATM 1205 O O . HOH C 3 . ? 13.699 19.720 21.819 1.00 26.56 ? 391 HOH A O 1 HETATM 1206 O O . HOH C 3 . ? 26.833 28.283 32.272 1.00 31.48 ? 392 HOH A O 1 HETATM 1207 O O . HOH C 3 . ? 20.458 26.214 25.811 1.00 24.39 ? 393 HOH A O 1 HETATM 1208 O O . HOH C 3 . ? 32.304 27.731 18.152 1.00 41.66 ? 394 HOH A O 1 HETATM 1209 O O . HOH C 3 . ? 24.283 13.868 42.687 1.00 35.59 ? 395 HOH A O 1 HETATM 1210 O O . HOH C 3 . ? 11.833 12.657 45.160 1.00 38.30 ? 396 HOH A O 1 HETATM 1211 O O . HOH C 3 . ? 1.988 27.992 43.589 1.00 33.97 ? 397 HOH A O 1 HETATM 1212 O O . HOH C 3 . ? 32.913 22.982 40.176 1.00 39.26 ? 398 HOH A O 1 HETATM 1213 O O . HOH C 3 . ? 32.435 20.043 40.169 1.00 33.87 ? 399 HOH A O 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 73 ? ? -144.94 -154.28 2 1 ASP A 126 ? ? 55.69 -115.96 # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 10 GLU A 13 ? GLU A 13 . ? 3_655 ? 2 AC1 10 ALA A 32 ? ALA A 32 . ? 1_555 ? 3 AC1 10 THR A 54 ? THR A 54 . ? 1_555 ? 4 AC1 10 VAL A 58 ? VAL A 58 . ? 1_555 ? 5 AC1 10 VAL A 76 ? VAL A 76 . ? 1_555 ? 6 AC1 10 LEU A 121 ? LEU A 121 . ? 1_555 ? 7 AC1 10 ARG A 132 ? ARG A 132 . ? 1_555 ? 8 AC1 10 TYR A 134 ? TYR A 134 . ? 1_555 ? 9 AC1 10 HOH C . ? HOH A 309 . ? 1_555 ? 10 AC1 10 HOH C . ? HOH A 343 . ? 1_555 ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 REA 1 200 200 REA REA A . C 3 HOH 1 300 300 HOH HOH A . C 3 HOH 2 301 301 HOH HOH A . C 3 HOH 3 302 302 HOH HOH A . C 3 HOH 4 303 303 HOH HOH A . C 3 HOH 5 304 304 HOH HOH A . C 3 HOH 6 305 305 HOH HOH A . C 3 HOH 7 306 306 HOH HOH A . C 3 HOH 8 307 307 HOH HOH A . C 3 HOH 9 308 308 HOH HOH A . C 3 HOH 10 309 309 HOH HOH A . C 3 HOH 11 310 310 HOH HOH A . C 3 HOH 12 311 311 HOH HOH A . C 3 HOH 13 312 312 HOH HOH A . C 3 HOH 14 313 313 HOH HOH A . C 3 HOH 15 314 314 HOH HOH A . C 3 HOH 16 315 315 HOH HOH A . C 3 HOH 17 316 316 HOH HOH A . C 3 HOH 18 317 317 HOH HOH A . C 3 HOH 19 318 318 HOH HOH A . C 3 HOH 20 319 319 HOH HOH A . C 3 HOH 21 320 320 HOH HOH A . C 3 HOH 22 321 321 HOH HOH A . C 3 HOH 23 322 322 HOH HOH A . C 3 HOH 24 323 323 HOH HOH A . C 3 HOH 25 324 324 HOH HOH A . C 3 HOH 26 325 325 HOH HOH A . C 3 HOH 27 326 326 HOH HOH A . C 3 HOH 28 327 327 HOH HOH A . C 3 HOH 29 328 328 HOH HOH A . C 3 HOH 30 329 329 HOH HOH A . C 3 HOH 31 330 330 HOH HOH A . C 3 HOH 32 331 331 HOH HOH A . C 3 HOH 33 332 332 HOH HOH A . C 3 HOH 34 333 333 HOH HOH A . C 3 HOH 35 334 334 HOH HOH A . C 3 HOH 36 335 335 HOH HOH A . C 3 HOH 37 336 336 HOH HOH A . C 3 HOH 38 337 337 HOH HOH A . C 3 HOH 39 338 338 HOH HOH A . C 3 HOH 40 339 339 HOH HOH A . C 3 HOH 41 340 340 HOH HOH A . C 3 HOH 42 341 341 HOH HOH A . C 3 HOH 43 342 342 HOH HOH A . C 3 HOH 44 343 343 HOH HOH A . C 3 HOH 45 344 344 HOH HOH A . C 3 HOH 46 345 345 HOH HOH A . C 3 HOH 47 346 346 HOH HOH A . C 3 HOH 48 347 347 HOH HOH A . C 3 HOH 49 348 348 HOH HOH A . C 3 HOH 50 349 349 HOH HOH A . C 3 HOH 51 350 350 HOH HOH A . C 3 HOH 52 351 351 HOH HOH A . C 3 HOH 53 352 352 HOH HOH A . C 3 HOH 54 353 353 HOH HOH A . C 3 HOH 55 354 354 HOH HOH A . C 3 HOH 56 355 355 HOH HOH A . C 3 HOH 57 356 356 HOH HOH A . C 3 HOH 58 357 357 HOH HOH A . C 3 HOH 59 358 358 HOH HOH A . C 3 HOH 60 359 359 HOH HOH A . C 3 HOH 61 360 360 HOH HOH A . C 3 HOH 62 361 361 HOH HOH A . C 3 HOH 63 362 362 HOH HOH A . C 3 HOH 64 363 363 HOH HOH A . C 3 HOH 65 364 364 HOH HOH A . C 3 HOH 66 365 365 HOH HOH A . C 3 HOH 67 366 366 HOH HOH A . C 3 HOH 68 367 367 HOH HOH A . C 3 HOH 69 368 368 HOH HOH A . C 3 HOH 70 369 369 HOH HOH A . C 3 HOH 71 370 370 HOH HOH A . C 3 HOH 72 371 371 HOH HOH A . C 3 HOH 73 372 372 HOH HOH A . C 3 HOH 74 373 373 HOH HOH A . C 3 HOH 75 374 374 HOH HOH A . C 3 HOH 76 375 375 HOH HOH A . C 3 HOH 77 376 376 HOH HOH A . C 3 HOH 78 377 377 HOH HOH A . C 3 HOH 79 378 378 HOH HOH A . C 3 HOH 80 379 379 HOH HOH A . C 3 HOH 81 380 380 HOH HOH A . C 3 HOH 82 381 381 HOH HOH A . C 3 HOH 83 382 382 HOH HOH A . C 3 HOH 84 383 383 HOH HOH A . C 3 HOH 85 384 384 HOH HOH A . C 3 HOH 86 385 385 HOH HOH A . C 3 HOH 87 386 386 HOH HOH A . C 3 HOH 88 387 387 HOH HOH A . C 3 HOH 89 388 388 HOH HOH A . C 3 HOH 90 389 389 HOH HOH A . C 3 HOH 91 390 390 HOH HOH A . C 3 HOH 92 391 391 HOH HOH A . C 3 HOH 93 392 392 HOH HOH A . C 3 HOH 94 393 393 HOH HOH A . C 3 HOH 95 394 394 HOH HOH A . C 3 HOH 96 395 395 HOH HOH A . C 3 HOH 97 396 396 HOH HOH A . C 3 HOH 98 397 397 HOH HOH A . C 3 HOH 99 398 398 HOH HOH A . C 3 HOH 100 399 399 HOH HOH A . # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'RETINOIC ACID' REA 3 water HOH # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1CBS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 137 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P29373 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 137 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 137 # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A A GLY A 5 ? GLU A 13 ? GLY A 5 GLU A 13 A B ALA A 40 ? GLU A 46 ? ALA A 40 GLU A 46 A C THR A 49 ? SER A 55 ? THR A 49 SER A 55 A D THR A 60 ? LYS A 66 ? THR A 60 LYS A 66 A E PHE A 71 ? GLN A 74 ? PHE A 71 GLN A 74 A F PRO A 80 ? SER A 89 ? PRO A 80 SER A 89 A G LYS A 92 ? LEU A 99 ? LYS A 92 LEU A 99 A H THR A 107 ? LEU A 113 ? THR A 107 LEU A 113 A I LEU A 119 ? ALA A 125 ? LEU A 119 ALA A 125 A J VAL A 128 ? ARG A 136 ? VAL A 128 ARG A 136 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length OTHER OTHER1 . PRO A 1 ? SER A 4 ? PRO A 1 SER A 4 . . . STRN STRN1 . GLY A 5 ? GLU A 13 ? GLY A 5 GLU A 13 . . . BEND BEND1 . ASN A 14 ? ASN A 14 ? ASN A 14 ASN A 14 . . . HELX_RH_AL_P HELX_RH_AL_P1 . PHE A 15 ? VAL A 21 ? PHE A 15 VAL A 21 . . . TURN_TY1_P TURN_TY1_P1 . LEU A 22 ? GLY A 23 ? LEU A 22 GLY A 23 . . . OTHER OTHER2 . VAL A 24 ? ASN A 25 ? VAL A 24 ASN A 25 . . . HELX_RH_AL_P HELX_RH_AL_P2 . VAL A 26 ? ALA A 36 ? VAL A 26 ALA A 36 . . . TURN_TY1_P TURN_TY1_P2 . SER A 37 ? SER A 37 ? SER A 37 SER A 37 . . . BEND BEND2 . LYS A 38 ? LYS A 38 ? LYS A 38 LYS A 38 . . . OTHER OTHER3 . PRO A 39 ? PRO A 39 ? PRO A 39 PRO A 39 . . . STRN STRN2 . ALA A 40 ? GLU A 46 ? ALA A 40 GLU A 46 . . . TURN_TY1_P TURN_TY1_P3 . GLY A 47 ? ASP A 48 ? GLY A 47 ASP A 48 . . . STRN STRN3 . THR A 49 ? SER A 55 ? THR A 49 SER A 55 . . . OTHER OTHER4 . THR A 56 ? THR A 56 ? THR A 56 THR A 56 . . . BEND BEND3 . THR A 57 ? VAL A 58 ? THR A 57 VAL A 58 . . . OTHER OTHER5 . ARG A 59 ? ARG A 59 ? ARG A 59 ARG A 59 . . . STRN STRN4 . THR A 60 ? LYS A 66 ? THR A 60 LYS A 66 . . . TURN_TY1_P TURN_TY1_P4 . VAL A 67 ? GLY A 68 ? VAL A 67 GLY A 68 . . . BEND BEND4 . GLU A 69 ? GLU A 69 ? GLU A 69 GLU A 69 . . . OTHER OTHER6 . GLU A 70 ? GLU A 70 ? GLU A 70 GLU A 70 . . . STRN STRN5 . PHE A 71 ? GLN A 74 ? PHE A 71 GLN A 74 . . . OTHER OTHER7 . THR A 75 ? THR A 75 ? THR A 75 THR A 75 . . . TURN_TY1_P TURN_TY1_P5 . VAL A 76 ? ASP A 77 ? VAL A 76 ASP A 77 . . . BEND BEND5 . GLY A 78 ? GLY A 78 ? GLY A 78 GLY A 78 . . . OTHER OTHER8 . ARG A 79 ? ARG A 79 ? ARG A 79 ARG A 79 . . . STRN STRN6 . PRO A 80 ? SER A 89 ? PRO A 80 SER A 89 . . . TURN_TY1_P TURN_TY1_P6 . GLU A 90 ? ASN A 91 ? GLU A 90 ASN A 91 . . . STRN STRN7 . LYS A 92 ? LEU A 99 ? LYS A 92 LEU A 99 . . . BEND BEND6 . LEU A 100 ? GLY A 102 ? LEU A 100 GLY A 102 . . . OTHER OTHER9 . GLU A 103 ? LYS A 106 ? GLU A 103 LYS A 106 . . . STRN STRN8 . THR A 107 ? LEU A 113 ? THR A 107 LEU A 113 . . . OTHER OTHER10 . THR A 114 ? THR A 114 ? THR A 114 THR A 114 . . . TURN_TY1_P TURN_TY1_P7 . ASN A 115 ? ASP A 116 ? ASN A 115 ASP A 116 . . . BEND BEND7 . GLY A 117 ? GLY A 117 ? GLY A 117 GLY A 117 . . . OTHER OTHER11 . GLU A 118 ? GLU A 118 ? GLU A 118 GLU A 118 . . . STRN STRN9 . LEU A 119 ? ALA A 125 ? LEU A 119 ALA A 125 . . . TURN_TY1_P TURN_TY1_P8 . ASP A 126 ? ASP A 127 ? ASP A 126 ASP A 127 . . . STRN STRN10 . VAL A 128 ? ARG A 136 ? VAL A 128 ARG A 136 . . . OTHER OTHER12 . GLU A 137 ? GLU A 137 ? GLU A 137 GLU A 137 . . . # PDB-REDO-dssp-ca06797/test/1cbs.cif.gz000066400000000000000000001104731516741327300171070ustar00rootroot00000000000000ʳ_1cbs.cif\s⸲Py`O్:@9@&@2ske|$[m<띙RZV-ޚi(UaP7O%`aqko${~3OP?=;2Èl}xK[HզoX8xh[ JO藸4㛤Kdž"˲SUX)_Mt-'*(S/c}j}l ۵Ct-=xBBD {Iߤ&Q iʾy.e:+"mQٜHB;t(_чf s釨s`ST5}S{k#_eyG6bj5|~Ʊ5J@.G%?MI{E}` > F,8Gzv=pXz.;R ȔLv CO;qZoA+MpV+5~o_EgnIxQC¦n&I}ˊZ4n S'DzG-a8hriڀȽnsȸ C`I7<./Txm S +sLC:SyeO #`:|=Gth0N6t? *FQ!B@+0/&vrlwǭ<$]ݘmBfW~]0/dsê<[껎5(\4A +{WT(XQUFUv3QU'8BTã4A}vMb*s%3QmØ$FUg&(VED>Ex{j0j#u) 6L]W e2}cr7^߾N֫eF}xLe|\4F p{x|Mxw!_wt~\h|y}YN >Ht2cّ.iXfs;,;#CpZg"('\b!gLy F:$݋ItdĺF7]zn D"Ut9ts w"˻Fځyo4۩lpd=DMw!F&<ȋ>oTTx'$\ H8Y7ip iLot. d:TNZM8nbh(h=NoZUd} c$X&5*h5x,|MsZFU^]^]%B* qvp1n[υ)qxe( (B_osk];\}^\p'6u0P8x Qfր'ASՀ `(O7EnsENDE z(ro ӎN1#DE Nt8 N1zb&(8EۀN1kb: KN1u(INg#Sn)èSXSNhP)r5]KEοS\ XT쇛 F}Hw&nU5qRu$:@m;Cbp9BTs Rvcy{> 1 F`{oUʣ˚i??s2Z74խj"uv/ApOGagŻ*M˫PgM6y@0 y!X9P:9]pgoKV;o?73j@3,R6fd.C*vz },~^yALR\&mlXcmZ6Sj+:&ɝrmquEx =5aXIh~ƴԓ+IԷFa$m % qۛV%JFa7Zc@uȳQpGKT &^7vt;.sKOxg|oef8{uCqR[PO{\ qJy?g7ObURC-O$3$G@gނjLmPHT|;Y7) oc%t[3vϒEt;+c\B8^Dk yr<| 84} Km-a ϤwjLR tio|NqHx}LS &w֠^ *nM:շ[5ɕ]rҸl?RCX&+'r+qaN{'LVcTY zoo̢ sņx A8)Ml,^}t#%Tqn/EPlŰf*s` *$,OkVo;5 gfn*$̯ 17xMӵ, b8rjXf@q-ճ$ڬ$@8pL9M$[>'ӹ\.GҐ/Ŭg+cSԉˣzh܋0MɚnCYJdj2`cbFp&`>0,cimv/À,(k17][2pȧ}>e)jvo0 0(&!E!Y Ր4.j %bk$ )$-8mF/Cˡ%ZW$|RhNZ͉|tkOV{v54ZjX5+W\^.b.5^ ~W[N/DWDDWug4rBnIun +Ȕ1~Lg:'l'>]}6k|ʿ:Y<׎[3{Q~Z(Wu"d\/o `!{j4{@-̎ '*LE>[v! A]y 'j,%c|; kE OuS ϜA`x N`_ `F߬<0\QK: Tl/Dt'?ѨMRAzoGgGsÌ'KuxK<ҰӅ< <!W45"ZXuSnBjx՝]]1@a0mOf Sg:j=d/Ҵ m?rcGJxEwYiZ vn&fە[Pfޓq'CZła^(mq.EǾ#)-,];r^{ooLD-S7اOhǡUAyhr  (g] By֙*VS1YiڋɊӟ:dy_+&w6D+60~iwI]u$=Ҡ9@P[:mJ۞_?V$SןvUUd e&y<>cw97y>>A,V,HZX!I>|)TOE1˟rC7|IOY!y;o'|)'?d,L> H.lǟrI7D}x7ǟ?bcW9ߕ2FؗO &CRO1>$dt L>tRZPB6+O-g?i%_ߗ/{̟{|9~qYe W{O?mD_9QWNueD_7QMue=>$O=̫OԎ>iI 3>$O~>̴O;N>P?5Svzl E>$f}v,#2~wfYn˾?.Aן߶:ϾoO*].&~?йm9mZYer?fO_׃?`t~l.m׍+W$}m=~u侈dòщ~76_ye~ؾoVop׍ΚaN l'+xi.aԖ%?>|aV4"{|w9=wwEh^ӟw_p$/ZܯQ,;T y+wyvބ]K?MOY Bouk ɀ~7w~o_qea{\R_-cT~7fT:3`/+M_|O_~M jH}cz.ScSyӠO&uP4[ Jj+DBђj=׼)P{ϻ%Rhn/S%Uz WrSm\f{[Uzj늢.D!iQ\T驭+zI B4YuEa 謧f蛃 5=bS_`4%iI+ޠ^?7}L"%i^9K@s1\MTiuܖ]7ĽLm)]RPLP$9;2A}PLߗzo~zÕRhP%)2]@{uAԙi~=3 ЦiI2 ~t#c#]*JMe}%@`j%οdx5̵hw~hϑ@4L{3^-T*Eo%o+^ ^~1ٟWT;M޻}A=t^Q(4s}}p ׿]t^Q (~'y_yCqTIeiw TWm u//;4-AKV/%J{x>Cm3:uJ%Iz1V:;c3cLoI(S(m0)HJ{,td_ oZV=q 4ܦ=:7K:<ԧIOPЀvwߗit 4Oz^[ߖ[t2zQ_u-*= פ 0-AMɘ(>p-JOC]Q6MrsKZ- Ь>{$1[Wz }P(b(~ ЬG1mVA/YvlBӴ~$+ I+͠JzF}|Sե%I"c%iv) K(p׾㘶>R.i@ٰp{r7]yBTzfڥ6PypͰOWP-vړ=׍#TRMj8@isXK=h~ڥ6΋q47]*{ܠ}El1UXWԛh1-{Uޯ4oh>?F;\XS-Y멺SW~~h}kRǿmm_&נ7LW$:8T+}}>U7( ˺一*I[@ͽm~A6]I׷KǍ-'I3;=P~\R핿&wGРgTj+g?ROCUx%hOS[QICh^͉)9s?;j%Xp~FJ~׷0KoT $F\LP~ɱ@堧]Ҁ<<Tiz:@1QNn>Un<YK4H긡d;(Af{ h \ }COYh1zAOA e)7>'=Y7(p1 G&v\4IO7P05b[RBWtiP9Nz&z{/jq;1 4MzFO㡧WP q t<yׁcE[*ߕIɘ^`ˆܟ@1Qɘ@Ᾰuҭ 2& 63g/Z1Q +nr `Tޣ>6'xo.Ғ~B?kF=.FeZfj%}W+TK:{&eݦ i6\2gt=:oIKOZ$!N8.Vt:pORj;$-qq1|]@]|\H}v i EOZz9M-OjwRot p'@/7hFBӸ.'@-cH\t p_am7tx&}]$]f?Mz( IʼnC*ieؤfݤv,Ik ʁOB@*\2 3r!+ABBʍEVvUQsH*6'5mڳ;D$xkLkՒ=c(?q^́xs=Q`K J:xrD[][$Džv~lY.ԙ-DeJ YJd|=RᢤYi]s[*Oƈ7QE%YljuwQP\@2u`Kj9dufQ붟Z8el)TlC["3-8!̣T($MlTz; 늊Om6ܝT42'/O4e#Ș"gĠ@A"(e`ՒzsP~MFIx} (o o.R[.I$V~ʟ2o|G.J9z)ʟ+Y& ڥApPʤg?7 YVV~ʟڿlOe[|ߙUE}o*h*=g?vaJJ@nt"#j]kE⦫񌊒lCURNqUby0ͯL>rLZzoOF&J6dNamo,Pc%{UzAOKS'du6p%-zAOEf%)G.zAOK{fxCjE|f1UKɊl堧nQܑC^FK4^=-uF0]4=f9(n^EEOACr9x0R툎zV=-{J-6"HDHty(eFq F=BpD9 _qT_#n_y^$ Nꅬ% o8qQKs j&'jj9'\_誧=jE0҉)\{Le)S͑[m)bK EO9'>{HPrZ8N='R-ARt eL;']$Gv_*^[8N?' 4#ݞ"4tcIT蕴Rzx8NZߋ\H I(83*O/\3Z%CDRl S[( q2PIpzۻImRxM> JgWf-#)Ԡ/qS.qa* t6|}[GwLXFK׷UuHm5-‘ TWל ]^iźW+yF=Q:njpow$2n368:njxZ%!m*is֜M7WeX:@W=͇E$2NS0F^ t`_鞖摈q)EOuz)b%lȤt7I 1;F`j5gBo}m T<Bzi^lsӅYЕX.g_9EX@o̺FIObd z<(އlIttL,%AL y? tU3"E U.U tQ3$e_P& 9Egg/>OT"(*<[w~Ly&< hdJ%pQ;MQ&L j7ܢY ^aR k@'uPlaKCDZwuIqFI>3,` 7 q8臈p8A-^s*sCDx5Pq^E̘(ABtv|yIA]s&/{)'qFuyH9g4K.h q{Lx}ʹH9s?XQ13@=s&P\K%9j!Hj" ;fFllF˹H9J~(Vj=s&/ariԠZO眉 Թ1hP ; ɈH?gRz?ui/^% 5@WEL" jɃl}nf %z^n֑17;!A陰-ц+ĶLT/!-]ut8GedrTG0vt|ZQM҄o؆TLT>VP$!g'*5|=I'*ݥR p!>$ϝIUAᏋEew)jVT\ͥ*~DD@I"N1ܖtiEmḨgBο<$-tWP9CQ.`mLC'JeϸG.<"YGc4R<MR4M&:9.<MR# L]trL}h\sE>IdT~9y&rrVyQ6S42'τz5XCB2jD9y&:(nn{} j՞rL1E n-əT{&tFƇndr аǮ;^k:LRkS,#~.tFmbi`߇$$+ZO_x}# >oإ% ?ML>&MmD To5gԱs hcZgU uw栥Lr-z5-I=M嬰˝`1w:aPh|~T:)9({Hq ( Hf eEDΓA+(>E9!M$eP-O띰 aV3JyF5V`f e}}NVn:T[(A"BQQX2 [=RWUmw0c͑*nJfR.y@M{# T^]Gy^^ ҊGftk]$\@8G05M]?y^R^QZC>)0=, }OMm/_y;n5GOAל mׯyURկ(4IcykT)3j#}j*%S\0Qv$ɧis(tzhIP7LlcW{Cܞ t4쥡 ۿ6hHm/g_gC%SyF0E:O"ю gYξ4, Ӏ\#"[AQ F"ڐniЋGa|M L|h$3J͙u|""^ dAv$Uf^?<:ooAT9gOni4 ݖrB[w=s&6,9x7yjr$颧5kvP#}yor%W3$lH%ճ\=oj铆GƣS.9Ӡt0̒<^*E=@#xK"=^ܬJJϩitQ05QWrTTvPC t ZA֗Aȴljr#xX?NTem{HLTР_&OS~0Y.rt9e@Q\,8,#[k{[@3[|X!@CCGb]$E4VQ5L˔)I nrvwTc,3q$e_p&PLKt"},^ADi噐 v9\T4k}޵L9HZؘi>812j>ekě؞+nH#:ZR; (&#eJڍ(Z%/3Ҧc+R7]gPdO/J{) [@ 3osuKk4(6Rp7Pp.itIVl҇wHKk1͒;_mLyՒW2B:|={34`WV7շ~!ؤ]Y@sEEX~w/&P/= ZI<8'uB*) tF-((1 :Q.zj3j~R1Qw~.{>HnC j#ٓ 픅FR+v7@rSؐy( IS_@4 IUpnB^ +Pq3Ljrn"E7_*IR/􋆈Rdž"qCq__-iYsqj4:__he7|-<7S2>l(뒢: gWuPac׏i$2__Ęv7]&jPA0'IAZu@ şΨV DOjGFwRtF5МT߈Er3*Ut`a–} [Z@IOgT-rۨe?Q@zz6$*'IJ莼dF?ևwtQժP$3f-RyOJ@EB:^S C-0I/v#w|Na: njIٓ+'& Hgpm(e]T*LgQlm9ZԻi>'_3D4cF)IV3aO [@7_4ܛF0|(Rd4˹ (ҁԳIa;hNjk;a|]$POFaKNƣRS^j&}H  Ͻ9PCN!P4"HZzs@/f pW'1Ț3fed͵`xR)}9@T\t3.Ӭ>+1IR}~g4a-beƄZdSV:beLA2s&qFV/Q=Fјs&vP˵9htYsE/)5|z%]3^H;?l}x]3>xBaӨ;1z&m)'שіO?ݘ{ fJ.)רb$;Twɷ"⹣J%PHb?T D6T a'ZER Z-ZΤU ~@)wg:`]r$.gIK{ :u ]@sE1~Z9e'Џ4htP8p7L֮:6Ԝ F: ҕ8QiJp=W2:IBDbҠ֫l1s%5y&u;&wr<,@*τ (ut{sS!6iw8Y]re3YQ\qܡP@=YrXJCšG0$_o|8Da8PHrKڛC*($e%Wi>Nj΄KGWwiNAJ P|ؕ_lbӀ#](p1 s0FE}ڕ_@=<S+iSYE'EҼ+Et/ax_vPVtNy$](y7\LI[)u'P/t}Rΐ%&u'-Zkoz$͟p4l ӘjnW&%!PNYUӻ{ٱK'BA@#{b !N6ral4&EҴ;(F:fP@;4ϬvB 4%]NW&zw@cL('B΍-eN3a7P%硒UZ5*=vw"h!,3 bPjěY"ʨ TKw'B%h #g=KH#&P}3ʊJQs˴劉a3f\@鹒, tYtF:Q1݅Q(C0e'׌S/*eU_!$FkT/t:lFµ.f6īÐNgT}TQÐNg$gŊ81+*Ψ*iFPՉRjnPfDbw-n' =x3τeL{G7CtQgʥ:WX?_&EtP~ה?0Ł0S{a]$MB΍3̧)C_@ٞ J?T-=V|G=A9(^ łMG_$< MxZ@g.&b|(5dG^FO;#qRFNjq:-Wg~)٤9/̽9O:5B9iPO9""JSLQZܛc%=cVf-IH-\y.VssoM\~#݉-7I{ :e!-Y:|A<@t;I RxMYHDUTgk~xHD՛3!WKi`N@D3__T9VP>P)AW:uP/9h|C3__T96X-a61e.*zsN'Ptחd*e$ tՠi__ESا*A0ʇ́x4$]lUzj9R"#mc7.T[!rG)P=>pOԥ@=5@1Lf"mN[XѠiuЫ`)`zJ8h,Ra8D)އ8X@/!"Rw cV eL(m®5I*8@qq$E h.c:@ᥴHq`D oT7#Y6c͙xs~}賂=hcJѠq/^Iz YaPaaIdaTaL򰡧BX4VQ!Ag'䒔aP@ܩ#[tl"Wi#z.: hbv Ji) tБ"=Ŏ3TtYБJ;`hfhI2ulmp53pC=?4^Б)=~^ ^sjTQ.y'˔%;8LhH#n $77@W_ wotU[_2IPjRs h tt-V)L|G;haxCsLGCiv\!  SfԞ:? (Xeu[]fźPb\#SGOz]$=5Pc==S:v1udZ)Wut"zQ2v&)A6nm?O Ś(lI9)T.@Ӕx:QKrTabni Cx6ix\JҌNTP1L-+( -yA 240@s zeIj-R ?{]$[4h`8$LLk򇉹E|ԋkzԜgUKJpF5IRa7ȓN|%j^Da@ٟVII[C!*َpՒƩ>jfVO8U0o.( ICT^I8GiPO|PgLݱI>J.& OQs&Рf~Pe9ח7N2qzmVi8`9gBfQ~x\1EO眉URja t{.wF[^)6kUOZ)M HL Z[Z;jOoaOatTT:Y}FE~FTJS )?nj,ȍ^z%Rd P`0&O³]$=Y}YrzZ%>,\tQtb=Mqd䕯[FJ()s<1lxM C$@֗NV_VnDS0VӇZNV_[Sl9IzdE+- ~{s_'SbAMmݔY͡A3myi27Mn A{so9C6iݥ"׷&mH@x@soq&Ye UZT-b ͱJZlPl`>FZv3s͡AIOS'*n[^IOTmҕg.ia3c6W?N.A?Q qͱHjSnY+Ng;PlnP&P@k'3%*>kI+AREl*m ?Xy0jI 齡"M@y{F &P-L\;]:QpFqș %c9d6P#b@Odr9dX 1c]s x~dza4pȘs`,L\0<>3% .Cl( IگYG)$M C ruMvg@_kCle&aa`Vm.$4Oc6t2eskA$mlwZ/!if>_3i͡Aʶ0T3Iso1_8Pkdš@I1@4Bn~+rc&ͽ9vIo<7fpmtQrp̴1R29L5gNOv$s```>oOAÊ*l*%~ -`]f*'%(4a C![2v6 =fp;pX}Pd:{t;z9$ճob]RYϾg e]f.6^X|">s`+ϙ/2}?5To}.AAW̎i2vU[)sSAbVƦfKƦJ3kSSw ,⅍YjoP~|tQ~;Ex7P QP[BH(sE S.-NlsBg.o"P08PߩJԒjSwM4K26 ߆2bmp%vBkemꯏtIӒ#YRvl]Hr1/vckd3C0{BF/Նy&;{5(bG_ Xo"!plͅTA 'F~\x%<ԱJ[ԝfEO=_A(iTi͙x}2-fcY@&]s&Ab('L \HD}ϠdF&=\N9͟w t)YΙX@TEx^m04sz}<"S&)yFuѽ+U?]Ι@9?3Zgm$+cFi;G!S}5p5UVYm pʄ5oJCKe#;(P, 5%iͱj 3=o&b3 E4e=td*'H4e* ``Rk(jI{shD*eRkbYHZ-$Fߊ:ZbAacOJ;vURgœ@ي `YE}LcLqB+ش%̌ao,Ӝv);}LSJ~Q1]4m_ΟiG²0KY,@I__eҕVśISU5O/E5yGiPþ҃!kPyGiPD2* LAwITMVQ"eTϏq$D ~^r~O-J׳(1@9U4&Ibu3B=@=J:qG0M@" t4jy4K"d*Z+y.ʟ{l(vBIE' RJXX\Z51_&vl!L/rǿ닳kjl4p!g,jy&}ѿ/Vtx3τ&IyX3f?I1]tXA܃?NJrE]j]$ %c +Ǽm}BР<2AI&;;$zZҮ~wMRtu 袧yZBD-zZv=mrjNTGI|3& -uFxeZe(s'c"_f7&(XT9ggGz/]RxVnR- !AInLI"=I\)ZwcI+|0O^ݘhc$`Z)A &Џ4h܍Z f?>o֠i7&ژ Km[;Ԏ wc2UfwLz-5VP-%VZl실H_5_#gPi(e<E!3_#5(y{IL@I|ԯD%EwrW9~)CC+I=6';Qb h"%0:h:]l(nRknqj"HwKM (uL~+Im$,cdNWy&&Ib z~GZ6PbAa0.=@b/Aa )}K~Su5ϕgB*a %7|ck VQ3:M+.hXCn9Q(ZUđb'6o,zqI.99E2oVq7XCY*QتfP@^9V8Ds-iګ8 'Ff%34Uc&Bb(ṟFE!BJ.w,:=:=4f!;ٿGX t٥9=Գ:CIhER{0{4ص3K+(9S.PGh@(IzJ`׿@$$_I`(rEPʓ3!^$fOY+-H.+>5кNL9,7BWAWY7;ʤ.iI4GVW,_]^]T*,uFRkn+Z$*gu5[\H=KT|yL,V+=(V_Z%Ț3*"H8|<% DFI52E@w53vIكԌ?~;104eFÉi,!iUpݔlkߞ#);@SBc]%Aep(32[=G$!SV@q)&ײ8iT(LڷcXRZkВeZ4K鋉lPj T/rȔf֪xBGS i9dvP{/x6j>T)A}OڝV6 Ry(.-ʴ.U/gs<\3J{5dAL?3@/"-UjШAI!~!)=l Ь@kJJ~FHBHTRIkйW8oI&Џ4=tP\qӠ~zSH Pu9+7CP+Ꮄbl=VI<@X!%}ApS-y^fԒV4?quJ,j=-3t`oU"i:ut8I.A]4&齇@00>Ӕh3avPO F@HH8nHby^%]K0}E{Hs0md:e4?ܩ~>jyg#-Q:\ET"ok@1jxנS}Xpx);)83Gm."ҁq4k2jh#j=&PU U_AttKIؖR{s.)<]eF-OJOLTw}V( $ڹO"AO< 41YhIЉX@1ʕl]$U< XFLts tS3H\xEzkz%zy&P12z(}$&PgBFyP)k=qo%vBl7j8nUzj!uZhdIP~HcrKra^l4qMb=j Av'v/crKq!FUJVO~K6Uǻiqt7mފ9Ts"Ԏ(tSNw,gTjZE_ "?M'YrKp'Z]4 WIwt7ͲK19nZj#(jCj}[V8֠t7./I. KQx7-gbTayfIB=-}UNw"*sLmḺLnZ9MK5bNNFwl-{{VPd^ww]lY@InZ_e$LX?GOJ^VI@6%mK Pc=x}/. #-'Q~N>I[w y_3:誧'__%D4H&骧'__{}ܾxe&@Z@='__r6H4|}ѧ=k^Z2fOgkIP+ cU*|}鉺rw4wARƓ϶IfLǢSԞ}}kH ҁҠƓO@##5?SB.6.|}otlhFj]^ӓI l)%qY$]khɢ̮!Og yV|H4ݣgAS24Jc7sw+iG-a"?r%I܃vG{j 8yAb\@I{~1)*tQ4ݣ1 ?hfo(}sG{H*BnCL- zCJWAs<yJr;頚Ԝ7PrU&,T4p>l}>5>9) ٥f*Zf<9) I@seJVH HzBnWE*.|$颧$')#A!̑OYH  0z9תxOC#iƋ$c T|}!̑,eq\#gs;JYHH75QLMRsE6HdzjE9 iT+>& vEʜi C9JZ9->XNi8qOmeLEţfPп "Ip#i[X*샟xm:j!TERw"y}Qڎ7gWQs/*_Sdjcїt(Ae@Nl+y}t[)# w-+h}_%-[Z;P/53P)e[1K) *}3u KtS]O+h[4'82:425aS<#! JjzZAiJhIjz4."w{phhP7?iwQOZs6@?Z@AO<Z~X3f+=5X׻`VhRh! k j5h(u~‰b W .YJ+ wMOK Kr9<9RvP$>gF>R5]O7P;'d-颧r hd5NٲGZ>[66j2REQAf6S4?uV)*U/8R%JٮR;}ֱI7J*KM'kdrtS|P:>~TT t[]<*UYȏpN:QJlD FSq~biAmW6 L7iU*FGEײ'kw to,4Kn]UʆR  CZxla!R=4 (*"M3jϖԦK^6|LYsAW/FB`Q~'wmZZ..LIE[~ѡUҼ[VqvPuMRz@\R8mkDbH,pd2,3Kò}3u\ߤ}\AJ;َ_%5E:%& >Q5i~N~gU1ASyedgm~)ߒ:RcBf6 y(v|,aRBvoJ8uLxϙiF5Gl4CUR7Pd`L )r!eTY]3R6]6ZWP+QRJ?w[$:U7i7Z i`vԣ[H:ΨMR3fH\ͶӴ.gmzԱ\HDgC 3AFQP 7xL4Pt&Xh]~TڹI4tJxHTDA6$'#K 8Iphe7I%\n'YzHph2-m.̝0P""Q+dBgoÔMSG฼I{~ZIicwE"EVr!W$GYOza{l'le;{C.KD u%e8..<Y2Ip-Qo* WpcQ׿U 5cjt,14Ы0W|?7'KD #n2_d+D5bvchKDF3rsa0jͥi g~@4Vc߿A?~_3`L͇//C蚜n8f^ +@/oޗ[Q#@厠`9mR0@3d PJ#½dM~ GI2 7]crK+*' d%T?kjиrEp2g{k=M'дGIAh֨sfr4.O]#lhY@y=w:);+AeEhNYut]QFrE{(W[DSPA;JK+G PA?;ilPAc$I*\SتR8vgPf)7bBJ<4jP@{Xsʄ)oY0fP{Yv)l{ᔉvO-L+MRqٳ_D e+3-RZy+0u:Sջԧ=QF8 =hܗN&P{ǟ~|@Mva6qhRtw6@hPx_tf_nZ 4>IjysD>Pa!$gs(h~r4嬌s@˓bB +@D-㸤ⰵ*H'h|5ϠE&ؾ6MO 4\ ;`) }PoIxt%} Aӊ DҘ`ouO+ S#H˚NP/m3HiE%!bm=Q.2Ɩ3O+^laY"Iv*Ϗ2Ч4$d5 }ZQqEa_c&EHuO+ ޞ{e$lwGIЧW4t5ԙVT$ ڢ΅;<@VKC5%r{l=>QAʬSNn|! <9m=>(x{-cLKD@3I:9iH7@VuIQ6iE3* aa{"oGk}ZQqE]dcsh2u.y}ZQqERoyxqI}j@Vg\Q uڧVT&! ^خ<6RpiE[H"O+?QۢJzhM"Ƅ{ZQiE7u[sO+?( p%RiESh%vA@rO+?(v+k@VT$eOt$%*AVTx0^\Q)n3oʹϨ[30L`Yx:QO+*(+9y%{")neƯx%ZQ/R (ʼnI8΅( =UV Hy}ZQL6YpQlGYq"oO-9O!F'piE[Hg ki fgg/\ycjЧ+T3$ia͸8iEupǜ(_}kׅWTbݨVZe~ZQCfhnA8tiE"!+\&WT^VT _HKLečJh1> Ϩ&$o4eVTz\QG>FӊB:B4Ҵ˘>x&vIϓFӊʏV!  ЋQAЧW$xZ2QO+*?(0,rI(!F,gDӊ?ᙈRBUAO:=d!sR6Fmӊ构6ZIiE{Ť;yILT9>>Qdm~l 4?xFE{ R[;NW.=b 覻ӊ*O+ } aE5nӊ*O+*I\Ivk?RO+t(#͔D .?Ykg"O+<<)q!yJ|(]c<ʋǴ0=>Oӊ*g*Ax. -tτ>()\kޞ,r{xK<?4?({=z&Xi]ש6VT~XQ0\H`ِ?&E[_~XQH~~F"Gqmb|)iyXQzj&JnJF!qaE'(a&Sm ~yXQz<.hUې| /+^O+ [=p;#l_)+ MKo8uLF2cHe8fn$@-E/O+<(VYn'ăZvS<(3d@m}ErzF},;VpC,.+꿼|W/|o޾|Ż^??o۟oW_yz˿_Ӳ,?ۯ~wş3y߽,탟o{g'|;{G?~L݇*}ZG[}* mM*?KؽD탟|탟?(#|{ؑ afgK|~"{lq+s};9( gϦ"9 #t>2sSx}VnÛ~탟;$[u9StD'ۇmtS0wg5G%(簩 X|~zwCJ|axAq>Wn!+>'TX5w2sؑesG9=VusзXusXOc|aÏ4w 9L30wP}ËX'd: w#|1#o9i9Uszւ9l5 6}i9 /}[M9B9İpT}9a탟 9x_}{'`s}v|FJ|axs}|I$|龐Eq>EBoZ^>^elnPꨓô~Nw'` j2͵~K~bRi9i9,Rm"|MsV\\+y =_E:$NQśBs]9׃~W ~x?QW*"5DV*"pS?,\ۅ}N[5_~NS_;}IT⩟w6Rn9M}m>G֝9ioZo>G4fB9[m&9HA&nÕ}NPə>DŽp[6U|ʶ9lAenHepwLe"cQe6ڨ%~h([>?/oVGy{]W^8W^Oq)X]ʇgG24/5R'7 w .nЁ|^=5^=@~^=@5x^O=` +6nN׹j90{o0akBYyI{Qj2kdo0p:V-<$ܺd2#FMt$^?.`$l>$ؘ0p٢`$(0pӢަ`$AphFYt#I,rH%LQ3z$IHa$zj5I𳸇a$h{I^ƥ@`$Z=Fқ^?СzF{#*z.F# w)[Hsϗy-}WcH2a$۞_?V0({F=FOb|T˭H1<$ܜ%#{{$LJS9-x#I #-wsw0# %i[N/rϏ`?D0pO"`$h:=$\ m?$ATI4O# #r"[^܍ol9I^凑y-p#y?0H# "rZ~F2?ig~'K=n#:0p"`$0$HH5< ?jy]?*0S-wjA JivUN_|oׯD3OO/}~{ۯO߼ }߿w~!ʟwVOſU8~xݷ?xD]&_67߾J</xoI u?V?<7_??WW/M;~u~o,7z_?7B????=N/'sq}ׯ{u_n{}/?W_} ?onn)o?{C׿AvڕwYw|J3nއRm;?;_' Oc|{Yow?~w /xs|?}jϨH-N(J) , SAME NUMBER PER 100 RESIDUES . 0 0.0 TOTAL NUMBER OF HYDROGEN BONDS IN PARALLEL BRIDGES, SAME NUMBER PER 100 RESIDUES . 65 47.4 TOTAL NUMBER OF HYDROGEN BONDS IN ANTIPARALLEL BRIDGES, SAME NUMBER PER 100 RESIDUES . 0 0.0 TOTAL NUMBER OF HYDROGEN BONDS OF TYPE O(I)-->H-N(I-5), SAME NUMBER PER 100 RESIDUES . 3 2.2 TOTAL NUMBER OF HYDROGEN BONDS OF TYPE O(I)-->H-N(I-4), SAME NUMBER PER 100 RESIDUES . 4 2.9 TOTAL NUMBER OF HYDROGEN BONDS OF TYPE O(I)-->H-N(I-3), SAME NUMBER PER 100 RESIDUES . 0 0.0 TOTAL NUMBER OF HYDROGEN BONDS OF TYPE O(I)-->H-N(I-2), SAME NUMBER PER 100 RESIDUES . 0 0.0 TOTAL NUMBER OF HYDROGEN BONDS OF TYPE O(I)-->H-N(I-1), SAME NUMBER PER 100 RESIDUES . 0 0.0 TOTAL NUMBER OF HYDROGEN BONDS OF TYPE O(I)-->H-N(I+0), SAME NUMBER PER 100 RESIDUES . 0 0.0 TOTAL NUMBER OF HYDROGEN BONDS OF TYPE O(I)-->H-N(I+1), SAME NUMBER PER 100 RESIDUES . 7 5.1 TOTAL NUMBER OF HYDROGEN BONDS OF TYPE O(I)-->H-N(I+2), SAME NUMBER PER 100 RESIDUES . 9 6.6 TOTAL NUMBER OF HYDROGEN BONDS OF TYPE O(I)-->H-N(I+3), SAME NUMBER PER 100 RESIDUES . 14 10.2 TOTAL NUMBER OF HYDROGEN BONDS OF TYPE O(I)-->H-N(I+4), SAME NUMBER PER 100 RESIDUES . 1 0.7 TOTAL NUMBER OF HYDROGEN BONDS OF TYPE O(I)-->H-N(I+5), SAME NUMBER PER 100 RESIDUES . 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 *** HISTOGRAMS OF *** . 0 0 0 0 0 0 1 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 RESIDUES PER ALPHA HELIX . 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 PARALLEL BRIDGES PER LADDER . 0 0 1 1 1 1 4 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 ANTIPARALLEL BRIDGES PER LADDER . 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 LADDERS PER SHEET . # RESIDUE AA STRUCTURE BP1 BP2 ACC N-H-->O O-->H-N N-H-->O O-->H-N TCO KAPPA ALPHA PHI PSI X-CA Y-CA Z-CA 1 1 A P 0 0 64 0, 0.0 2,-0.5 0, 0.0 91,-0.0 0.000 360.0 360.0 360.0 151.2 18.1 13.5 43.7 2 2 A N + 0 0 89 1,-0.1 89,-0.0 2,-0.1 44,-0.0 -0.903 360.0 172.5-124.5 100.5 20.6 16.5 43.6 3 3 A F + 0 0 1 -2,-0.5 40,-0.2 110,-0.0 -1,-0.1 0.524 40.0 127.0 -80.0 -9.9 21.1 17.8 40.1 4 4 A S + 0 0 28 41,-0.1 2,-0.3 38,-0.1 40,-0.2 -0.158 37.2 69.9 -55.6 140.2 23.2 20.8 41.5 5 5 A G E S-A 43 0A 19 38,-2.5 38,-2.6 2,-0.1 2,-0.6 -0.868 82.5 -67.6 145.0 177.2 26.6 21.5 40.1 6 6 A N E -A 42 0A 78 -2,-0.3 131,-2.8 36,-0.2 2,-0.4 -0.958 54.1-159.8-104.9 115.8 28.8 22.7 37.2 7 7 A W E -AB 41 136A 1 34,-2.8 34,-1.4 -2,-0.6 2,-0.4 -0.824 13.0-164.1-107.0 141.0 28.5 20.1 34.4 8 8 A K E - B 0 135A 92 127,-3.0 127,-2.3 -2,-0.4 2,-0.1 -0.933 28.2-112.8-119.6 141.9 30.8 19.4 31.5 9 9 A I E + B 0 134A 26 30,-0.4 125,-0.3 -2,-0.4 3,-0.1 -0.449 32.7 170.7 -78.1 144.9 29.7 17.4 28.4 10 10 A I E + 0 0A 86 123,-3.1 2,-0.3 1,-0.4 124,-0.2 0.456 69.4 21.2-126.0 -12.2 31.3 14.0 27.7 11 11 A R E - B 0 133A 141 122,-1.3 122,-2.5 2,-0.0 -1,-0.4 -0.954 53.6-178.8-159.0 138.7 29.0 12.7 24.9 12 12 A S E - B 0 132A 48 -2,-0.3 2,-0.4 120,-0.2 120,-0.2 -0.982 9.1-177.7-140.7 127.1 26.6 14.2 22.3 13 13 A E E - B 0 131A 95 118,-2.5 118,-1.5 -2,-0.4 -2,-0.0 -0.986 62.7 -1.8-128.8 138.0 24.6 12.3 19.8 14 14 A N S > S+ 0 0 64 -2,-0.4 4,-1.6 116,-0.2 5,-0.1 0.655 75.6 137.6 65.5 22.9 22.2 13.4 17.0 15 15 A F H > S+ 0 0 23 2,-0.2 4,-1.9 1,-0.2 5,-0.1 0.940 73.9 44.8 -66.9 -48.6 22.4 17.2 17.7 16 16 A E H > S+ 0 0 67 1,-0.2 4,-2.0 2,-0.2 -1,-0.2 0.902 111.2 55.1 -61.6 -39.6 22.6 18.3 14.1 17 17 A E H > S+ 0 0 91 1,-0.2 4,-1.8 2,-0.2 -1,-0.2 0.857 106.0 52.0 -60.9 -36.1 19.8 15.9 13.1 18 18 A L H X S+ 0 0 1 -4,-1.6 4,-1.7 1,-0.2 -1,-0.2 0.921 109.6 49.8 -65.5 -43.2 17.5 17.5 15.8 19 19 A L H <>S+ 0 0 5 -4,-1.9 5,-2.4 1,-0.2 -2,-0.2 0.852 106.3 56.4 -65.4 -32.2 18.3 20.9 14.3 20 20 A K H ><5S+ 0 0 103 -4,-2.0 3,-1.5 1,-0.2 -1,-0.2 0.929 106.5 48.6 -65.1 -45.5 17.4 19.6 10.8 21 21 A V H 3<5S+ 0 0 53 -4,-1.8 -1,-0.2 1,-0.3 -2,-0.2 0.860 107.3 56.5 -62.3 -36.0 14.0 18.5 11.9 22 22 A L T 3<5S- 0 0 10 -4,-1.7 -1,-0.3 -5,-0.1 -2,-0.2 0.481 120.3-112.1 -75.2 -4.6 13.4 21.9 13.6 23 23 A G T < 5 + 0 0 63 -3,-1.5 2,-0.4 1,-0.2 -3,-0.2 0.696 58.8 158.5 84.0 20.3 14.1 23.5 10.2 24 24 A V < - 0 0 28 -5,-2.4 -1,-0.2 1,-0.1 -2,-0.1 -0.661 41.2-117.3 -79.6 130.0 17.4 25.2 10.9 25 25 A N > - 0 0 92 -2,-0.4 4,-2.5 1,-0.1 3,-0.2 -0.143 25.5-100.1 -67.0 161.3 19.4 25.9 7.6 26 26 A V H > S+ 0 0 97 1,-0.2 4,-1.9 2,-0.2 5,-0.1 0.835 117.9 43.9 -47.2 -52.0 22.8 24.4 6.7 27 27 A M H > S+ 0 0 148 2,-0.2 4,-1.7 1,-0.2 -1,-0.2 0.862 114.2 48.8 -67.6 -38.7 24.9 27.4 7.6 28 28 A L H > S+ 0 0 97 -3,-0.2 4,-2.6 2,-0.2 -1,-0.2 0.872 110.3 54.0 -68.8 -34.0 23.2 28.2 10.9 29 29 A R H X S+ 0 0 26 -4,-2.5 4,-3.0 2,-0.2 5,-0.3 0.924 104.0 54.4 -63.4 -44.3 23.5 24.5 11.8 30 30 A K H X S+ 0 0 164 -4,-1.9 4,-1.6 1,-0.2 -1,-0.2 0.928 111.7 44.7 -54.8 -47.3 27.2 24.6 11.2 31 31 A I H X S+ 0 0 93 -4,-1.7 4,-1.9 1,-0.2 -2,-0.2 0.935 114.7 48.3 -62.9 -48.6 27.6 27.5 13.7 32 32 A A H X S+ 0 0 28 -4,-2.6 4,-2.6 1,-0.2 -2,-0.2 0.914 109.1 51.5 -61.0 -48.3 25.3 25.9 16.3 33 33 A V H X S+ 0 0 49 -4,-3.0 4,-0.5 1,-0.2 -1,-0.2 0.880 110.3 48.7 -59.1 -41.5 26.9 22.5 16.3 34 34 A A H >< S+ 0 0 61 -4,-1.6 3,-0.8 -5,-0.3 4,-0.2 0.933 115.2 43.9 -65.9 -45.8 30.4 23.9 16.8 35 35 A A H >< S+ 0 0 4 -4,-1.9 3,-1.2 1,-0.2 22,-0.2 0.878 110.0 56.3 -68.1 -36.3 29.4 26.1 19.7 36 36 A A H 3< S+ 0 0 10 -4,-2.6 -1,-0.2 1,-0.2 -2,-0.2 0.552 88.7 76.5 -73.9 -8.6 27.3 23.4 21.3 37 37 A S T << S+ 0 0 74 -3,-0.8 -1,-0.2 -4,-0.5 -2,-0.1 0.667 103.3 35.9 -76.7 -14.7 30.2 21.0 21.5 38 38 A K S < S+ 0 0 129 -3,-1.2 -1,-0.2 -4,-0.2 19,-0.1 -0.500 80.2 163.6-135.8 65.0 31.7 22.9 24.5 39 39 A P - 0 0 13 0, 0.0 2,-0.5 0, 0.0 -30,-0.4 -0.429 32.9-139.6 -84.3 157.8 28.9 24.2 26.7 40 40 A A E - C 0 55A 56 15,-2.1 15,-3.0 -2,-0.1 2,-0.5 -0.988 25.8-169.0-111.4 121.5 29.2 25.4 30.3 41 41 A V E -AC 7 54A 7 -34,-1.4 -34,-2.8 -2,-0.5 2,-0.5 -0.976 9.8-176.7-119.1 128.1 26.2 24.2 32.3 42 42 A E E -AC 6 53A 56 11,-2.5 11,-2.6 -2,-0.5 2,-0.4 -0.984 2.8-175.2-124.9 124.3 25.3 25.3 35.8 43 43 A I E -AC 5 52A 3 -38,-2.6 -38,-2.5 -2,-0.5 2,-0.4 -0.963 6.0-174.1-121.0 134.3 22.4 23.9 37.8 44 44 A K E - C 0 51A 114 7,-2.2 7,-1.8 -2,-0.4 2,-0.4 -0.998 10.8-174.0-126.7 121.9 21.1 25.1 41.2 45 45 A Q E + C 0 50A 29 -2,-0.4 2,-0.4 5,-0.2 5,-0.2 -0.969 17.1 177.2-122.2 135.7 18.4 23.0 42.9 46 46 A E E > S- C 0 49A 166 3,-2.5 3,-1.7 -2,-0.4 2,-0.5 -0.849 71.6 -60.6-134.0 90.9 16.4 23.7 46.1 47 47 A G T 3 S- 0 0 51 -2,-0.4 -1,-0.0 1,-0.3 19,-0.0 -0.529 121.1 -13.7 71.2-119.2 13.9 21.0 46.5 48 48 A D T 3 S+ 0 0 67 -2,-0.5 19,-2.4 -3,-0.1 2,-0.5 0.233 116.9 99.1-101.2 12.8 11.6 21.1 43.4 49 49 A T E < -CD 46 66A 69 -3,-1.7 -3,-2.5 17,-0.2 2,-0.3 -0.888 54.3-172.5-104.0 129.6 12.9 24.6 42.3 50 50 A F E -CD 45 65A 2 15,-3.0 15,-2.1 -2,-0.5 2,-0.4 -0.901 22.3-170.5-127.8 149.5 15.5 24.7 39.6 51 51 A Y E -CD 44 64A 41 -7,-1.8 -7,-2.2 -2,-0.3 2,-0.4 -0.995 16.4-175.9-132.3 124.9 17.7 27.3 37.9 52 52 A I E -CD 43 63A 2 11,-2.3 11,-2.5 -2,-0.4 2,-0.5 -0.980 5.8-174.6-131.1 119.3 19.5 26.0 34.8 53 53 A K E -CD 42 62A 71 -11,-2.6 -11,-2.5 -2,-0.4 2,-0.5 -0.967 0.6-175.0-115.1 121.8 22.0 28.1 32.9 54 54 A T E -CD 41 61A 32 7,-2.5 7,-2.3 -2,-0.5 2,-0.4 -0.969 11.8-170.1-118.9 119.0 23.5 26.7 29.6 55 55 A S E +CD 40 60A 40 -15,-3.0 -15,-2.1 -2,-0.5 2,-0.3 -0.888 16.2 157.5-120.5 137.5 26.2 28.9 28.0 56 56 A T - 0 0 29 3,-0.9 3,-0.3 -2,-0.4 -20,-0.1 -0.899 55.0 -98.1-140.6 168.5 28.0 28.8 24.7 57 57 A T S S+ 0 0 113 -2,-0.3 3,-0.1 -22,-0.2 -21,-0.0 0.701 122.9 34.9 -62.8 -20.9 29.9 31.5 22.6 58 58 A V S S+ 0 0 85 1,-0.3 2,-0.3 -26,-0.1 -1,-0.2 0.543 126.6 14.3-112.4 -10.4 26.7 32.1 20.5 59 59 A R - 0 0 97 -3,-0.3 -3,-0.9 -24,-0.1 2,-0.4 -0.899 52.0-169.3-169.0 135.3 23.8 31.7 22.9 60 60 A T E -D 55 0A 67 -2,-0.3 2,-0.4 -5,-0.2 -5,-0.2 -0.986 9.4-169.0-129.9 134.7 23.1 31.5 26.6 61 61 A T E -D 54 0A 51 -7,-2.3 -7,-2.5 -2,-0.4 2,-0.4 -0.957 4.9-170.6-124.3 144.3 19.8 30.4 28.2 62 62 A E E -D 53 0A 112 -2,-0.4 2,-0.3 -9,-0.2 -9,-0.2 -0.978 10.4-175.8-133.9 117.2 18.7 30.7 31.8 63 63 A I E -D 52 0A 20 -11,-2.5 -11,-2.3 -2,-0.4 2,-0.4 -0.892 10.3-166.6-118.8 147.4 15.5 29.0 32.9 64 64 A N E +D 51 0A 109 -2,-0.3 2,-0.3 -13,-0.2 -13,-0.2 -0.987 23.9 152.5-130.4 122.4 13.8 29.1 36.3 65 65 A F E -D 50 0A 10 -15,-2.1 -15,-3.0 -2,-0.4 2,-0.4 -0.977 38.3-140.1-149.7 160.9 11.1 26.6 37.1 66 66 A K E > -D 49 0A 82 3,-0.4 3,-2.0 -2,-0.3 19,-0.3 -0.972 44.0-104.7-117.8 132.7 9.3 24.7 39.8 67 67 A V T 3 S+ 0 0 16 -19,-2.4 19,-0.2 -2,-0.4 3,-0.1 -0.410 107.2 20.4 -59.2 130.3 8.3 21.1 39.0 68 68 A G T 3 S+ 0 0 48 17,-2.7 2,-0.5 1,-0.2 -1,-0.3 0.378 103.5 101.8 91.4 -2.6 4.6 21.0 38.3 69 69 A E S < S- 0 0 111 -3,-2.0 -3,-0.4 16,-0.1 16,-0.4 -0.957 74.5-116.4-119.7 127.6 4.2 24.7 37.6 70 70 A E + 0 0 126 -2,-0.5 2,-0.3 14,-0.1 14,-0.2 -0.295 39.9 168.6 -62.3 140.7 3.9 26.1 34.1 71 71 A F E -E 83 0A 25 12,-2.4 12,-3.2 -6,-0.1 2,-0.4 -0.902 30.8-112.1-143.5 174.1 6.6 28.4 32.8 72 72 A E E +E 82 0A 112 -2,-0.3 10,-0.2 10,-0.2 2,-0.2 -0.936 45.1 135.3-119.4 132.7 7.8 30.1 29.6 73 73 A E E -E 81 0A 25 8,-2.1 8,-2.4 -2,-0.4 2,-0.3 -0.644 46.1 -93.1-144.9-154.3 11.1 29.3 27.8 74 74 A Q E -E 80 0A 83 6,-0.3 25,-0.0 -2,-0.2 2,-0.0 -0.963 28.5-111.5-135.1 153.8 12.2 28.7 24.2 75 75 A T > - 0 0 1 4,-2.6 3,-2.1 -2,-0.3 6,-0.0 -0.283 47.6 -93.9 -71.7 171.4 12.7 25.7 22.1 76 76 A V T 3 S+ 0 0 54 1,-0.3 -1,-0.1 2,-0.1 -57,-0.0 0.849 128.4 51.8 -56.9 -37.1 16.3 24.8 21.0 77 77 A D T 3 S- 0 0 49 2,-0.1 -1,-0.3 1,-0.0 -2,-0.0 0.327 127.9 -97.4 -83.5 6.0 15.9 26.7 17.8 78 78 A G S < S+ 0 0 23 -3,-2.1 -2,-0.1 1,-0.2 -1,-0.0 0.611 72.7 141.1 93.1 16.9 14.7 29.8 19.7 79 79 A R - 0 0 64 1,-0.1 -4,-2.6 21,-0.0 -1,-0.2 -0.765 54.5-109.8 -96.9 133.7 10.9 29.8 19.6 80 80 A P E +E 74 0A 50 0, 0.0 20,-1.6 0, 0.0 21,-0.5 -0.292 46.8 167.2 -58.4 138.3 8.8 30.9 22.7 81 81 A C E -EF 73 99A 1 -8,-2.4 -8,-2.1 18,-0.2 2,-0.5 -0.957 38.3-118.4-150.0 160.5 6.9 28.1 24.3 82 82 A K E -EF 72 98A 60 16,-2.5 16,-2.1 -2,-0.3 2,-0.3 -0.910 38.2-165.0-100.8 129.3 5.0 27.2 27.5 83 83 A S E -EF 71 97A 1 -12,-3.2 -12,-2.4 -2,-0.5 2,-0.4 -0.889 17.2-169.4-121.5 152.9 6.6 24.4 29.4 84 84 A L E - F 0 96A 43 12,-1.4 12,-2.0 -2,-0.3 2,-0.4 -0.956 10.3-159.2-142.2 117.6 5.6 22.0 32.2 85 85 A V E + F 0 95A 0 -16,-0.4 -17,-2.7 -2,-0.4 2,-0.3 -0.800 14.0 174.8-100.5 138.7 8.0 19.7 34.0 86 86 A K E - F 0 94A 129 8,-2.4 8,-2.6 -2,-0.4 2,-0.8 -0.944 39.0-104.1-136.9 158.9 6.9 16.6 35.9 87 87 A W E - F 0 93A 77 -2,-0.3 6,-0.2 6,-0.2 3,-0.1 -0.765 29.3-178.2 -84.3 111.9 8.8 13.8 37.7 88 88 A E E S- 0 0A 121 4,-2.5 2,-0.3 -2,-0.8 -1,-0.2 0.875 78.2 -15.4 -73.2 -40.5 8.5 10.8 35.4 89 89 A S E > S- F 0 92A 60 3,-1.7 3,-1.2 -3,-0.2 -1,-0.3 -0.870 89.8 -77.8-147.6 178.8 10.4 9.0 38.2 90 90 A E T 3 S+ 0 0 148 -2,-0.3 3,-0.0 1,-0.2 -3,-0.0 0.832 129.7 27.0 -53.9 -37.5 12.4 9.8 41.3 91 91 A N T 3 S+ 0 0 59 1,-0.1 22,-2.1 22,-0.0 2,-0.4 0.218 112.5 75.7-112.6 15.7 15.6 10.8 39.3 92 92 A K E < -FG 89 112A 38 -3,-1.2 -4,-2.5 20,-0.2 -3,-1.7 -0.974 53.0-169.2-137.7 122.3 14.0 11.8 36.0 93 93 A M E -FG 87 111A 0 18,-2.6 18,-2.0 -2,-0.4 2,-0.4 -0.837 8.1-161.9-106.2 143.0 12.2 15.0 35.0 94 94 A V E -FG 86 110A 39 -8,-2.6 -8,-2.4 -2,-0.4 2,-0.5 -0.986 1.9-157.3-125.6 138.7 10.3 15.3 31.7 95 95 A C E -FG 85 109A 0 14,-3.1 14,-1.5 -2,-0.4 2,-0.4 -0.966 1.7-159.1-122.0 124.5 9.2 18.6 30.1 96 96 A E E -FG 84 108A 123 -12,-2.0 -12,-1.4 -2,-0.5 2,-0.4 -0.855 15.7-156.1 -99.8 132.1 6.3 19.0 27.6 97 97 A Q E -F 83 0A 12 10,-1.5 10,-0.4 -2,-0.4 2,-0.4 -0.895 10.9-169.7-114.4 144.9 6.5 22.1 25.4 98 98 A K E -F 82 0A 131 -16,-2.1 -16,-2.5 -2,-0.4 2,-0.1 -0.988 28.2-118.8-134.2 119.6 3.7 24.0 23.6 99 99 A L E -F 81 0A 37 -2,-0.4 -18,-0.2 -18,-0.2 3,-0.1 -0.354 11.5-147.7 -60.2 132.2 4.4 26.7 21.0 100 100 A L S S+ 0 0 52 -20,-1.6 2,-0.3 1,-0.2 -1,-0.1 0.859 84.4 11.3 -67.3 -37.4 2.9 30.1 22.1 101 101 A K S S+ 0 0 148 -21,-0.5 -1,-0.2 2,-0.0 2,-0.1 -0.997 113.0 4.8-144.1 142.6 2.3 31.0 18.4 102 102 A G S S- 0 0 59 -2,-0.3 2,-0.3 -3,-0.1 -3,-0.1 -0.340 76.5 -76.8 87.0-168.2 2.4 29.0 15.2 103 103 A E + 0 0 184 -2,-0.1 -2,-0.0 3,-0.0 3,-0.0 -0.879 52.2 128.8-132.0 164.5 3.0 25.3 14.4 104 104 A G - 0 0 44 -2,-0.3 -5,-0.1 -5,-0.0 -82,-0.1 -0.963 58.5 -33.3 169.2-177.6 6.0 23.0 14.2 105 105 A P - 0 0 23 0, 0.0 2,-0.4 0, 0.0 -83,-0.0 -0.225 67.0-102.9 -59.3 151.2 7.3 19.6 15.4 106 106 A K - 0 0 96 -8,-0.1 20,-2.7 -3,-0.0 2,-0.3 -0.674 48.7-165.6 -76.9 125.9 6.3 18.5 18.9 107 107 A T E + H 0 125A 11 -2,-0.4 -10,-1.5 -10,-0.4 2,-0.3 -0.856 18.9 154.7-118.8 155.7 9.2 19.1 21.2 108 108 A S E -GH 96 124A 32 16,-1.4 16,-2.7 -2,-0.3 2,-0.3 -0.947 19.8-150.9-161.2 170.5 10.2 18.0 24.7 109 109 A W E -GH 95 123A 14 -14,-1.5 -14,-3.1 -2,-0.3 2,-0.3 -0.975 4.3-163.0-149.0 154.2 13.2 17.4 26.9 110 110 A T E -GH 94 122A 13 12,-2.0 12,-2.3 -2,-0.3 2,-0.4 -0.971 1.6-163.6-137.0 150.2 14.2 15.2 29.8 111 111 A R E +GH 93 121A 25 -18,-2.0 -18,-2.6 -2,-0.3 2,-0.3 -0.997 16.0 174.7-134.8 130.2 17.0 15.4 32.4 112 112 A E E -GH 92 120A 52 8,-2.0 8,-2.7 -2,-0.4 2,-0.6 -1.000 28.6-136.1-142.5 143.9 18.0 12.4 34.5 113 113 A L E - H 0 119A 28 -22,-2.1 6,-0.2 -2,-0.3 2,-0.1 -0.866 30.0-148.1 -95.8 122.9 20.6 11.5 37.1 114 114 A T > - 0 0 40 4,-2.4 3,-1.7 -2,-0.6 -22,-0.0 -0.402 26.2-103.8 -89.5 168.1 22.1 8.1 36.5 115 115 A N T 3 S+ 0 0 179 1,-0.3 -1,-0.1 2,-0.1 -2,-0.0 0.705 117.8 58.2 -62.1 -23.8 23.4 5.5 39.0 116 116 A D T 3 S- 0 0 108 2,-0.0 -1,-0.3 0, 0.0 -3,-0.0 0.354 122.5-100.0 -88.4 4.3 27.1 6.4 38.1 117 117 A G S < S+ 0 0 37 -3,-1.7 19,-0.3 1,-0.3 -2,-0.1 0.513 82.4 124.3 91.4 6.2 26.7 10.0 39.0 118 118 A E - 0 0 53 17,-0.1 -4,-2.4 15,-0.0 2,-0.4 -0.405 55.4-126.8 -95.6 171.5 26.2 11.4 35.5 119 119 A L E -HI 113 134A 2 15,-2.3 15,-2.7 -6,-0.2 2,-0.5 -0.980 15.1-160.0-121.9 126.8 23.5 13.5 33.9 120 120 A I E -HI 112 133A 38 -8,-2.7 -8,-2.0 -2,-0.4 2,-0.4 -0.956 6.4-170.8-109.9 123.8 21.6 12.5 30.7 121 121 A L E -HI 111 132A 10 11,-3.1 11,-2.7 -2,-0.5 2,-0.4 -0.932 3.2-171.6-108.9 129.8 19.8 15.2 28.8 122 122 A T E -HI 110 131A 22 -12,-2.3 -12,-2.0 -2,-0.4 2,-0.4 -0.970 3.8-167.5-121.6 141.7 17.5 14.2 25.9 123 123 A M E -HI 109 130A 24 7,-2.0 7,-3.1 -2,-0.4 2,-0.4 -0.998 9.6-161.5-125.0 135.5 15.9 16.6 23.5 124 124 A T E +HI 108 129A 30 -16,-2.7 -16,-1.4 -2,-0.4 2,-0.4 -0.935 19.0 178.7-124.9 143.7 13.1 15.5 21.1 125 125 A A E > S-HI 107 128A 0 3,-2.1 3,-2.5 -2,-0.4 -18,-0.2 -0.925 73.9 -54.0-140.0 107.7 11.6 17.0 17.9 126 126 A D T 3 S- 0 0 88 -20,-2.7 -18,-0.0 -2,-0.4 -1,-0.0 -0.384 123.7 -18.3 55.7-116.0 8.9 14.7 16.5 127 127 A D T 3 S+ 0 0 160 -2,-0.2 2,-0.5 -3,-0.1 -1,-0.3 0.444 114.9 98.5-100.3 2.3 10.7 11.3 16.3 128 128 A V E < - I 0 125A 37 -3,-2.5 -3,-2.1 -110,-0.1 2,-0.4 -0.776 54.5-163.7 -93.6 129.4 14.3 12.5 16.4 129 129 A V E - I 0 124A 65 -2,-0.5 2,-0.5 -5,-0.2 -5,-0.2 -0.950 7.7-158.5-118.4 128.4 16.1 12.3 19.8 130 130 A C E - I 0 123A 0 -7,-3.1 -7,-2.0 -2,-0.4 2,-0.5 -0.908 11.2-160.7-103.2 129.9 19.3 14.0 20.8 131 131 A T E +BI 13 122A 49 -118,-1.5 -118,-2.5 -2,-0.5 2,-0.4 -0.947 11.6 176.6-116.6 123.9 21.2 12.5 23.7 132 132 A R E -BI 12 121A 14 -11,-2.7 -11,-3.1 -2,-0.5 2,-0.4 -0.990 10.2-160.7-128.1 136.6 23.9 14.4 25.7 133 133 A V E -BI 11 120A 16 -122,-2.5 -123,-3.1 -2,-0.4 -122,-1.3 -0.947 10.3-175.8-120.4 137.5 25.7 13.1 28.7 134 134 A Y E -BI 9 119A 11 -15,-2.7 -15,-2.3 -2,-0.4 2,-0.3 -0.896 12.9-164.0-131.0 162.0 27.5 15.2 31.3 135 135 A V E -B 8 0A 51 -127,-2.3 -127,-3.0 -2,-0.3 -17,-0.1 -0.938 40.8 -90.9-137.8 151.6 29.7 14.8 34.4 136 136 A R E B 7 0A 96 -19,-0.3 -129,-0.3 -2,-0.3 -131,-0.0 -0.432 360.0 360.0 -67.1 146.1 30.5 17.4 37.0 137 137 A E 0 0 182 -131,-2.8 -131,-0.2 -2,-0.1 -1,-0.1 -0.363 360.0 360.0 -61.5 360.0 33.6 19.4 36.4PDB-REDO-dssp-ca06797/test/CMakeLists.txt000066400000000000000000000027531516741327300177160ustar00rootroot00000000000000CPMFindPackage( NAME Catch2 3 GIT_REPOSITORY https://github.com/catchorg/Catch2.git GIT_TAG v3.4.0 EXCLUDE_FROM_ALL YES) add_executable(unit-test-dssp ${CMAKE_CURRENT_SOURCE_DIR}/unit-test-dssp.cpp ${PROJECT_SOURCE_DIR}/libdssp/src/dssp-io.cpp) target_include_directories(unit-test-dssp PRIVATE ${CMAKE_CURRENT_SOURCE_DIR}/src ${CMAKE_CURRENT_SOURCE_DIR}/include ) target_link_libraries(unit-test-dssp PRIVATE dssp cifpp::cifpp Catch2::Catch2) if(MSVC) # Specify unwind semantics so that MSVC knowns how to handle exceptions target_compile_options(unit-test-dssp PRIVATE /EHsc) endif() add_test(NAME unit-test-dssp COMMAND $ --data-dir ${CMAKE_CURRENT_SOURCE_DIR} --rsrc-dir ${CIFPP_DATA_DIR}) if(BUILD_PYTHON_MODULE) find_package(Python REQUIRED Interpreter) add_test(NAME python_module COMMAND ${Python_EXECUTABLE} "${CMAKE_CURRENT_SOURCE_DIR}/test-python.py") set_tests_properties(python_module PROPERTIES ENVIRONMENT "PYTHONPATH=$;LIBCIFPP_DATA_DIR=${CIFPP_DATA_DIR}" WORKING_DIRECTORY "${CMAKE_CURRENT_SOURCE_DIR}") add_test(NAME python_module_numpy COMMAND ${Python_EXECUTABLE} "${CMAKE_CURRENT_SOURCE_DIR}/test_numpy2_compat.py") set_tests_properties(python_module_numpy PROPERTIES ENVIRONMENT "PYTHONPATH=$;LIBCIFPP_DATA_DIR=${CIFPP_DATA_DIR}" WORKING_DIRECTORY "${CMAKE_CURRENT_SOURCE_DIR}") endif() PDB-REDO-dssp-ca06797/test/minimal-components.cif000066400000000000000000003643561516741327300214640ustar00rootroot00000000000000# This file contains only a subset of the Components.cif file from CCD # It is here to enable testing the software without having the full CCD # installed. # The original components.cif file can be found at: # http://www.wwpdb.org/data/ccd # and the data herein is available under the CC0 1.0 Universal (CC0 1.0) Public Domain Dedication. data_ALA # _chem_comp.id ALA _chem_comp.name ALANINE _chem_comp.type "L-PEPTIDE LINKING" _chem_comp.pdbx_type ATOMP _chem_comp.formula "C3 H7 N O2" _chem_comp.mon_nstd_parent_comp_id ? _chem_comp.pdbx_synonyms ? _chem_comp.pdbx_formal_charge 0 _chem_comp.pdbx_initial_date 1999-07-08 _chem_comp.pdbx_modified_date 2011-06-04 _chem_comp.pdbx_ambiguous_flag N _chem_comp.pdbx_release_status REL _chem_comp.pdbx_replaced_by ? _chem_comp.pdbx_replaces ? _chem_comp.formula_weight 89.093 _chem_comp.one_letter_code A _chem_comp.three_letter_code ALA _chem_comp.pdbx_model_coordinates_details ? _chem_comp.pdbx_model_coordinates_missing_flag N _chem_comp.pdbx_ideal_coordinates_details ? _chem_comp.pdbx_ideal_coordinates_missing_flag N _chem_comp.pdbx_model_coordinates_db_code ? _chem_comp.pdbx_subcomponent_list ? _chem_comp.pdbx_processing_site RCSB # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.alt_atom_id _chem_comp_atom.type_symbol _chem_comp_atom.charge _chem_comp_atom.pdbx_align _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_leaving_atom_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.model_Cartn_x _chem_comp_atom.model_Cartn_y _chem_comp_atom.model_Cartn_z _chem_comp_atom.pdbx_model_Cartn_x_ideal _chem_comp_atom.pdbx_model_Cartn_y_ideal _chem_comp_atom.pdbx_model_Cartn_z_ideal _chem_comp_atom.pdbx_component_atom_id _chem_comp_atom.pdbx_component_comp_id _chem_comp_atom.pdbx_ordinal ALA N N N 0 1 N N N 2.281 26.213 12.804 -0.966 0.493 1.500 N ALA 1 ALA CA CA C 0 1 N N S 1.169 26.942 13.411 0.257 0.418 0.692 CA ALA 2 ALA C C C 0 1 N N N 1.539 28.344 13.874 -0.094 0.017 -0.716 C ALA 3 ALA O O O 0 1 N N N 2.709 28.647 14.114 -1.056 -0.682 -0.923 O ALA 4 ALA CB CB C 0 1 N N N 0.601 26.143 14.574 1.204 -0.620 1.296 CB ALA 5 ALA OXT OXT O 0 1 N Y N 0.523 29.194 13.997 0.661 0.439 -1.742 OXT ALA 6 ALA H H H 0 1 N N N 2.033 25.273 12.493 -1.383 -0.425 1.482 H ALA 7 ALA H2 HN2 H 0 1 N Y N 3.080 26.184 13.436 -0.676 0.661 2.452 H2 ALA 8 ALA HA HA H 0 1 N N N 0.399 27.067 12.613 0.746 1.392 0.682 HA ALA 9 ALA HB1 1HB H 0 1 N N N -0.247 26.699 15.037 1.459 -0.330 2.316 HB1 ALA 10 ALA HB2 2HB H 0 1 N N N 0.308 25.110 14.270 0.715 -1.594 1.307 HB2 ALA 11 ALA HB3 3HB H 0 1 N N N 1.384 25.876 15.321 2.113 -0.676 0.697 HB3 ALA 12 ALA HXT HXT H 0 1 N Y N 0.753 30.069 14.286 0.435 0.182 -2.647 HXT ALA 13 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA SING N N 1 ALA N H SING N N 2 ALA N H2 SING N N 3 ALA CA C SING N N 4 ALA CA CB SING N N 5 ALA CA HA SING N N 6 ALA C O DOUB N N 7 ALA C OXT SING N N 8 ALA CB HB1 SING N N 9 ALA CB HB2 SING N N 10 ALA CB HB3 SING N N 11 ALA OXT HXT SING N N 12 # loop_ _pdbx_chem_comp_descriptor.comp_id _pdbx_chem_comp_descriptor.type _pdbx_chem_comp_descriptor.program _pdbx_chem_comp_descriptor.program_version _pdbx_chem_comp_descriptor.descriptor ALA SMILES ACDLabs 10.04 "O=C(O)C(N)C" ALA SMILES_CANONICAL CACTVS 3.341 "C[C@H](N)C(O)=O" ALA SMILES CACTVS 3.341 "C[CH](N)C(O)=O" ALA SMILES_CANONICAL "OpenEye OEToolkits" 1.5.0 "C[C@@H](C(=O)O)N" ALA SMILES "OpenEye OEToolkits" 1.5.0 "CC(C(=O)O)N" ALA InChI InChI 1.03 "InChI=1S/C3H7NO2/c1-2(4)3(5)6/h2H,4H2,1H3,(H,5,6)/t2-/m0/s1" ALA InChIKey InChI 1.03 QNAYBMKLOCPYGJ-REOHCLBHSA-N # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier ALA "SYSTEMATIC NAME" ACDLabs 10.04 L-alanine ALA "SYSTEMATIC NAME" "OpenEye OEToolkits" 1.5.0 "(2S)-2-aminopropanoic acid" # loop_ _pdbx_chem_comp_audit.comp_id _pdbx_chem_comp_audit.action_type _pdbx_chem_comp_audit.date _pdbx_chem_comp_audit.processing_site ALA "Create component" 1999-07-08 RCSB ALA "Modify descriptor" 2011-06-04 RCSB # data_ARG # _chem_comp.id ARG _chem_comp.name ARGININE _chem_comp.type "L-PEPTIDE LINKING" _chem_comp.pdbx_type ATOMP _chem_comp.formula "C6 H15 N4 O2" _chem_comp.mon_nstd_parent_comp_id ? _chem_comp.pdbx_synonyms ? _chem_comp.pdbx_formal_charge 1 _chem_comp.pdbx_initial_date 1999-07-08 _chem_comp.pdbx_modified_date 2011-06-04 _chem_comp.pdbx_ambiguous_flag N _chem_comp.pdbx_release_status REL _chem_comp.pdbx_replaced_by ? _chem_comp.pdbx_replaces ? _chem_comp.formula_weight 175.209 _chem_comp.one_letter_code R _chem_comp.three_letter_code ARG _chem_comp.pdbx_model_coordinates_details ? _chem_comp.pdbx_model_coordinates_missing_flag N _chem_comp.pdbx_ideal_coordinates_details "OpenEye/OEToolkits V1.4.2" _chem_comp.pdbx_ideal_coordinates_missing_flag N _chem_comp.pdbx_model_coordinates_db_code ? _chem_comp.pdbx_subcomponent_list ? _chem_comp.pdbx_processing_site RCSB # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.alt_atom_id _chem_comp_atom.type_symbol _chem_comp_atom.charge _chem_comp_atom.pdbx_align _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_leaving_atom_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.model_Cartn_x _chem_comp_atom.model_Cartn_y _chem_comp_atom.model_Cartn_z _chem_comp_atom.pdbx_model_Cartn_x_ideal _chem_comp_atom.pdbx_model_Cartn_y_ideal _chem_comp_atom.pdbx_model_Cartn_z_ideal _chem_comp_atom.pdbx_component_atom_id _chem_comp_atom.pdbx_component_comp_id _chem_comp_atom.pdbx_ordinal ARG N N N 0 1 N N N 69.812 14.685 89.810 -0.469 1.110 -0.993 N ARG 1 ARG CA CA C 0 1 N N S 70.052 14.573 91.280 0.004 2.294 -1.708 CA ARG 2 ARG C C C 0 1 N N N 71.542 14.389 91.604 -0.907 2.521 -2.901 C ARG 3 ARG O O O 0 1 N N N 72.354 14.342 90.659 -1.827 1.789 -3.242 O ARG 4 ARG CB CB C 0 1 N N N 69.227 13.419 91.854 1.475 2.150 -2.127 CB ARG 5 ARG CG CG C 0 1 N N N 67.722 13.607 91.686 1.745 1.017 -3.130 CG ARG 6 ARG CD CD C 0 1 N N N 66.952 12.344 92.045 3.210 0.954 -3.557 CD ARG 7 ARG NE NE N 0 1 N N N 67.307 11.224 91.178 4.071 0.726 -2.421 NE ARG 8 ARG CZ CZ C 0 1 N N N 66.932 9.966 91.380 5.469 0.624 -2.528 CZ ARG 9 ARG NH1 NH1 N 0 1 N N N 66.176 9.651 92.421 6.259 0.404 -1.405 NH1 ARG 10 ARG NH2 NH2 N 1 1 N N N 67.344 9.015 90.554 6.078 0.744 -3.773 NH2 ARG 11 ARG OXT OXT O 0 1 N Y N 71.901 14.320 92.798 -0.588 3.659 -3.574 OXT ARG 12 ARG H H H 0 1 N N N 68.822 14.807 89.594 -0.058 0.903 -0.109 H ARG 13 ARG H2 HN2 H 0 1 N Y N 70.205 13.888 89.308 -1.024 0.452 -1.494 H2 ARG 14 ARG HA HA H 0 1 N N N 69.728 15.528 91.756 -0.103 3.152 -1.034 HA ARG 15 ARG HB2 1HB H 0 1 N N N 69.554 12.445 91.420 2.086 1.988 -1.230 HB2 ARG 16 ARG HB3 2HB H 0 1 N N N 69.486 13.241 92.923 1.814 3.099 -2.563 HB3 ARG 17 ARG HG2 1HG H 0 1 N N N 67.355 14.485 92.266 1.136 1.170 -4.029 HG2 ARG 18 ARG HG3 2HG H 0 1 N N N 67.468 13.958 90.658 1.447 0.054 -2.698 HG3 ARG 19 ARG HD2 1HD H 0 1 N N N 67.083 12.081 93.120 3.348 0.133 -4.269 HD2 ARG 20 ARG HD3 2HD H 0 1 N N N 65.851 12.525 92.042 3.505 1.880 -4.062 HD3 ARG 21 ARG HE HE H 0 1 N N N 68.324 11.220 91.100 3.674 0.627 -1.479 HE ARG 22 ARG HH11 1HH1 H 0 0 N N N 65.888 8.684 92.576 7.271 0.331 -1.484 HH11 ARG 23 ARG HH12 2HH1 H 0 0 N N N 65.339 10.234 92.397 5.858 0.307 -0.476 HH12 ARG 24 ARG HH21 1HH2 H 0 0 N N N 67.926 9.257 89.752 5.530 0.906 -4.614 HH21 ARG 25 ARG HH22 2HH2 H 0 0 N N N 67.056 8.048 90.709 7.088 0.675 -3.874 HH22 ARG 26 ARG HXT HXT H 0 1 N Y N 72.822 14.206 92.998 -1.149 3.855 -4.355 HXT ARG 27 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA SING N N 1 ARG N H SING N N 2 ARG N H2 SING N N 3 ARG CA C SING N N 4 ARG CA CB SING N N 5 ARG CA HA SING N N 6 ARG C O DOUB N N 7 ARG C OXT SING N N 8 ARG CB CG SING N N 9 ARG CB HB2 SING N N 10 ARG CB HB3 SING N N 11 ARG CG CD SING N N 12 ARG CG HG2 SING N N 13 ARG CG HG3 SING N N 14 ARG CD NE SING N N 15 ARG CD HD2 SING N N 16 ARG CD HD3 SING N N 17 ARG NE CZ SING N N 18 ARG NE HE SING N N 19 ARG CZ NH1 SING N N 20 ARG CZ NH2 DOUB N N 21 ARG NH1 HH11 SING N N 22 ARG NH1 HH12 SING N N 23 ARG NH2 HH21 SING N N 24 ARG NH2 HH22 SING N N 25 ARG OXT HXT SING N N 26 # loop_ _pdbx_chem_comp_descriptor.comp_id _pdbx_chem_comp_descriptor.type _pdbx_chem_comp_descriptor.program _pdbx_chem_comp_descriptor.program_version _pdbx_chem_comp_descriptor.descriptor ARG SMILES ACDLabs 10.04 "O=C(O)C(N)CCCN\C(=[NH2+])N" ARG SMILES_CANONICAL CACTVS 3.341 "N[C@@H](CCCNC(N)=[NH2+])C(O)=O" ARG SMILES CACTVS 3.341 "N[CH](CCCNC(N)=[NH2+])C(O)=O" ARG SMILES_CANONICAL "OpenEye OEToolkits" 1.5.0 "C(C[C@@H](C(=O)O)N)CNC(=[NH2+])N" ARG SMILES "OpenEye OEToolkits" 1.5.0 "C(CC(C(=O)O)N)CNC(=[NH2+])N" ARG InChI InChI 1.03 "InChI=1S/C6H14N4O2/c7-4(5(11)12)2-1-3-10-6(8)9/h4H,1-3,7H2,(H,11,12)(H4,8,9,10)/p+1/t4-/m0/s1" ARG InChIKey InChI 1.03 ODKSFYDXXFIFQN-BYPYZUCNSA-O # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier ARG "SYSTEMATIC NAME" ACDLabs 10.04 "amino{[(4S)-4-amino-4-carboxybutyl]amino}methaniminium" ARG "SYSTEMATIC NAME" "OpenEye OEToolkits" 1.5.0 "[amino-[[(4S)-4-amino-5-hydroxy-5-oxo-pentyl]amino]methylidene]azanium" # loop_ _pdbx_chem_comp_audit.comp_id _pdbx_chem_comp_audit.action_type _pdbx_chem_comp_audit.date _pdbx_chem_comp_audit.processing_site ARG "Create component" 1999-07-08 RCSB ARG "Modify descriptor" 2011-06-04 RCSB # data_ASN # _chem_comp.id ASN _chem_comp.name ASPARAGINE _chem_comp.type "L-PEPTIDE LINKING" _chem_comp.pdbx_type ATOMP _chem_comp.formula "C4 H8 N2 O3" _chem_comp.mon_nstd_parent_comp_id ? _chem_comp.pdbx_synonyms ? _chem_comp.pdbx_formal_charge 0 _chem_comp.pdbx_initial_date 1999-07-08 _chem_comp.pdbx_modified_date 2014-11-11 _chem_comp.pdbx_ambiguous_flag N _chem_comp.pdbx_release_status REL _chem_comp.pdbx_replaced_by ? _chem_comp.pdbx_replaces ? _chem_comp.formula_weight 132.118 _chem_comp.one_letter_code N _chem_comp.three_letter_code ASN _chem_comp.pdbx_model_coordinates_details ? _chem_comp.pdbx_model_coordinates_missing_flag N _chem_comp.pdbx_ideal_coordinates_details Corina _chem_comp.pdbx_ideal_coordinates_missing_flag N _chem_comp.pdbx_model_coordinates_db_code ? _chem_comp.pdbx_subcomponent_list ? _chem_comp.pdbx_processing_site EBI # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.alt_atom_id _chem_comp_atom.type_symbol _chem_comp_atom.charge _chem_comp_atom.pdbx_align _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_leaving_atom_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.model_Cartn_x _chem_comp_atom.model_Cartn_y _chem_comp_atom.model_Cartn_z _chem_comp_atom.pdbx_model_Cartn_x_ideal _chem_comp_atom.pdbx_model_Cartn_y_ideal _chem_comp_atom.pdbx_model_Cartn_z_ideal _chem_comp_atom.pdbx_component_atom_id _chem_comp_atom.pdbx_component_comp_id _chem_comp_atom.pdbx_ordinal ASN N N N 0 1 N N N 15.295 16.641 19.776 -0.293 1.686 0.094 N ASN 1 ASN CA CA C 0 1 N N S 15.702 17.913 20.397 -0.448 0.292 -0.340 CA ASN 2 ASN C C C 0 1 N N N 14.630 18.500 21.234 -1.846 -0.179 -0.031 C ASN 3 ASN O O O 0 1 N N N 14.949 19.152 22.234 -2.510 0.402 0.794 O ASN 4 ASN CB CB C 0 1 N N N 16.088 18.882 19.297 0.562 -0.588 0.401 CB ASN 5 ASN CG CG C 0 1 N N N 17.262 18.512 18.462 1.960 -0.197 -0.002 CG ASN 6 ASN OD1 OD1 O 0 1 N N N 18.123 17.705 18.780 2.132 0.697 -0.804 OD1 ASN 7 ASN ND2 ND2 N 0 1 N N N 17.281 19.172 17.284 3.019 -0.841 0.527 ND2 ASN 8 ASN OXT OXT O 0 1 N Y N 13.386 18.353 20.865 -2.353 -1.243 -0.673 OXT ASN 9 ASN H H H 0 1 N N N 16.048 16.284 19.223 -0.904 2.297 -0.427 H ASN 10 ASN H2 HN2 H 0 1 N Y N 15.064 15.980 20.490 -0.453 1.776 1.086 H2 ASN 11 ASN HA HA H 0 1 N N N 16.555 17.716 21.063 -0.270 0.223 -1.413 HA ASN 12 ASN HB2 1HB H 0 1 N N N 15.224 18.966 18.622 0.442 -0.451 1.476 HB2 ASN 13 ASN HB3 2HB H 0 1 N N N 16.323 19.842 19.779 0.389 -1.633 0.146 HB3 ASN 14 ASN HD21 1HD2 H 0 0 N N N 18.021 19.008 16.631 2.881 -1.556 1.168 HD21 ASN 15 ASN HD22 2HD2 H 0 0 N N N 16.555 19.824 17.065 3.919 -0.590 0.268 HD22 ASN 16 ASN HXT HXT H 0 1 N Y N 12.819 18.813 21.473 -3.254 -1.508 -0.441 HXT ASN 17 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ASN N CA SING N N 1 ASN N H SING N N 2 ASN N H2 SING N N 3 ASN CA C SING N N 4 ASN CA CB SING N N 5 ASN CA HA SING N N 6 ASN C O DOUB N N 7 ASN C OXT SING N N 8 ASN CB CG SING N N 9 ASN CB HB2 SING N N 10 ASN CB HB3 SING N N 11 ASN CG OD1 DOUB N N 12 ASN CG ND2 SING N N 13 ASN ND2 HD21 SING N N 14 ASN ND2 HD22 SING N N 15 ASN OXT HXT SING N N 16 # loop_ _pdbx_chem_comp_descriptor.comp_id _pdbx_chem_comp_descriptor.type _pdbx_chem_comp_descriptor.program _pdbx_chem_comp_descriptor.program_version _pdbx_chem_comp_descriptor.descriptor ASN SMILES ACDLabs 12.01 "O=C(N)CC(N)C(=O)O" ASN InChI InChI 1.03 "InChI=1S/C4H8N2O3/c5-2(4(8)9)1-3(6)7/h2H,1,5H2,(H2,6,7)(H,8,9)/t2-/m0/s1" ASN InChIKey InChI 1.03 DCXYFEDJOCDNAF-REOHCLBHSA-N ASN SMILES_CANONICAL CACTVS 3.370 "N[C@@H](CC(N)=O)C(O)=O" ASN SMILES CACTVS 3.370 "N[CH](CC(N)=O)C(O)=O" ASN SMILES_CANONICAL "OpenEye OEToolkits" 1.7.2 "C([C@@H](C(=O)O)N)C(=O)N" ASN SMILES "OpenEye OEToolkits" 1.7.2 "C(C(C(=O)O)N)C(=O)N" # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier ASN "SYSTEMATIC NAME" ACDLabs 12.01 L-asparagine ASN "SYSTEMATIC NAME" "OpenEye OEToolkits" 1.7.2 "(2S)-2,4-bis(azanyl)-4-oxidanylidene-butanoic acid" # loop_ _pdbx_chem_comp_audit.comp_id _pdbx_chem_comp_audit.action_type _pdbx_chem_comp_audit.date _pdbx_chem_comp_audit.processing_site ASN "Create component" 1999-07-08 EBI ASN "Modify leaving atom flag" 2010-12-17 RCSB ASN "Modify descriptor" 2011-06-04 RCSB ASN "Modify leaving atom flag" 2011-08-05 RCSB ASN "Other modification" 2014-11-11 RCSB # data_ASP # _chem_comp.id ASP _chem_comp.name "ASPARTIC ACID" _chem_comp.type "L-PEPTIDE LINKING" _chem_comp.pdbx_type ATOMP _chem_comp.formula "C4 H7 N O4" _chem_comp.mon_nstd_parent_comp_id ? _chem_comp.pdbx_synonyms ? _chem_comp.pdbx_formal_charge 0 _chem_comp.pdbx_initial_date 1999-07-08 _chem_comp.pdbx_modified_date 2011-06-04 _chem_comp.pdbx_ambiguous_flag N _chem_comp.pdbx_release_status REL _chem_comp.pdbx_replaced_by ? _chem_comp.pdbx_replaces ? _chem_comp.formula_weight 133.103 _chem_comp.one_letter_code D _chem_comp.three_letter_code ASP _chem_comp.pdbx_model_coordinates_details ? _chem_comp.pdbx_model_coordinates_missing_flag N _chem_comp.pdbx_ideal_coordinates_details Corina _chem_comp.pdbx_ideal_coordinates_missing_flag N _chem_comp.pdbx_model_coordinates_db_code ? _chem_comp.pdbx_subcomponent_list ? _chem_comp.pdbx_processing_site EBI # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.alt_atom_id _chem_comp_atom.type_symbol _chem_comp_atom.charge _chem_comp_atom.pdbx_align _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_leaving_atom_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.model_Cartn_x _chem_comp_atom.model_Cartn_y _chem_comp_atom.model_Cartn_z _chem_comp_atom.pdbx_model_Cartn_x_ideal _chem_comp_atom.pdbx_model_Cartn_y_ideal _chem_comp_atom.pdbx_model_Cartn_z_ideal _chem_comp_atom.pdbx_component_atom_id _chem_comp_atom.pdbx_component_comp_id _chem_comp_atom.pdbx_ordinal ASP N N N 0 1 N N N 33.487 17.736 39.094 -0.317 1.688 0.066 N ASP 1 ASP CA CA C 0 1 N N S 34.909 17.506 38.709 -0.470 0.286 -0.344 CA ASP 2 ASP C C C 0 1 N N N 34.993 16.527 37.537 -1.868 -0.180 -0.029 C ASP 3 ASP O O O 0 1 N N N 36.106 16.031 37.261 -2.534 0.415 0.786 O ASP 4 ASP CB CB C 0 1 N N N 35.682 16.954 39.915 0.539 -0.580 0.413 CB ASP 5 ASP CG CG C 0 1 N N N 35.231 15.544 40.306 1.938 -0.195 0.004 CG ASP 6 ASP OD1 OD1 O 0 1 N N N 35.793 14.986 41.279 2.109 0.681 -0.810 OD1 ASP 7 ASP OD2 OD2 O 0 1 N N N 34.327 14.999 39.631 2.992 -0.826 0.543 OD2 ASP 8 ASP OXT OXT O 0 1 N Y N 33.935 16.265 36.913 -2.374 -1.256 -0.652 OXT ASP 9 ASP H H H 0 1 N N N 33.448 18.377 39.860 -0.928 2.289 -0.467 H ASP 10 ASP H2 HN2 H 0 1 N Y N 32.988 18.117 38.315 -0.478 1.795 1.056 H2 ASP 11 ASP HA HA H 0 1 N N N 35.356 18.461 38.395 -0.292 0.199 -1.416 HA ASP 12 ASP HB2 HB1 H 0 1 N N N 36.751 16.919 39.657 0.419 -0.425 1.485 HB2 ASP 13 ASP HB3 HB2 H 0 1 N N N 35.515 17.623 40.772 0.367 -1.630 0.176 HB3 ASP 14 ASP HD2 HD2 H 0 1 N N N 34.155 14.130 39.974 3.869 -0.545 0.250 HD2 ASP 15 ASP HXT HXT H 0 1 N Y N 34.122 15.645 36.218 -3.275 -1.517 -0.416 HXT ASP 16 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ASP N CA SING N N 1 ASP N H SING N N 2 ASP N H2 SING N N 3 ASP CA C SING N N 4 ASP CA CB SING N N 5 ASP CA HA SING N N 6 ASP C O DOUB N N 7 ASP C OXT SING N N 8 ASP CB CG SING N N 9 ASP CB HB2 SING N N 10 ASP CB HB3 SING N N 11 ASP CG OD1 DOUB N N 12 ASP CG OD2 SING N N 13 ASP OD2 HD2 SING N N 14 ASP OXT HXT SING N N 15 # loop_ _pdbx_chem_comp_descriptor.comp_id _pdbx_chem_comp_descriptor.type _pdbx_chem_comp_descriptor.program _pdbx_chem_comp_descriptor.program_version _pdbx_chem_comp_descriptor.descriptor ASP SMILES ACDLabs 12.01 "O=C(O)CC(N)C(=O)O" ASP SMILES_CANONICAL CACTVS 3.370 "N[C@@H](CC(O)=O)C(O)=O" ASP SMILES CACTVS 3.370 "N[CH](CC(O)=O)C(O)=O" ASP SMILES_CANONICAL "OpenEye OEToolkits" 1.7.0 "C([C@@H](C(=O)O)N)C(=O)O" ASP SMILES "OpenEye OEToolkits" 1.7.0 "C(C(C(=O)O)N)C(=O)O" ASP InChI InChI 1.03 "InChI=1S/C4H7NO4/c5-2(4(8)9)1-3(6)7/h2H,1,5H2,(H,6,7)(H,8,9)/t2-/m0/s1" ASP InChIKey InChI 1.03 CKLJMWTZIZZHCS-REOHCLBHSA-N # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier ASP "SYSTEMATIC NAME" ACDLabs 12.01 "L-aspartic acid" ASP "SYSTEMATIC NAME" "OpenEye OEToolkits" 1.7.0 "(2S)-2-azanylbutanedioic acid" # loop_ _pdbx_chem_comp_audit.comp_id _pdbx_chem_comp_audit.action_type _pdbx_chem_comp_audit.date _pdbx_chem_comp_audit.processing_site ASP "Create component" 1999-07-08 EBI ASP "Modify leaving atom flag" 2011-01-28 RCSB ASP "Modify descriptor" 2011-06-04 RCSB # data_CYS # _chem_comp.id CYS _chem_comp.name CYSTEINE _chem_comp.type "L-PEPTIDE LINKING" _chem_comp.pdbx_type ATOMP _chem_comp.formula "C3 H7 N O2 S" _chem_comp.mon_nstd_parent_comp_id ? _chem_comp.pdbx_synonyms ? _chem_comp.pdbx_formal_charge 0 _chem_comp.pdbx_initial_date 1999-07-08 _chem_comp.pdbx_modified_date 2011-06-04 _chem_comp.pdbx_ambiguous_flag N _chem_comp.pdbx_release_status REL _chem_comp.pdbx_replaced_by ? _chem_comp.pdbx_replaces BTC _chem_comp.formula_weight 121.158 _chem_comp.one_letter_code C _chem_comp.three_letter_code CYS _chem_comp.pdbx_model_coordinates_details ? _chem_comp.pdbx_model_coordinates_missing_flag N _chem_comp.pdbx_ideal_coordinates_details ? _chem_comp.pdbx_ideal_coordinates_missing_flag N _chem_comp.pdbx_model_coordinates_db_code ? _chem_comp.pdbx_subcomponent_list ? _chem_comp.pdbx_processing_site RCSB # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.alt_atom_id _chem_comp_atom.type_symbol _chem_comp_atom.charge _chem_comp_atom.pdbx_align _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_leaving_atom_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.model_Cartn_x _chem_comp_atom.model_Cartn_y _chem_comp_atom.model_Cartn_z _chem_comp_atom.pdbx_model_Cartn_x_ideal _chem_comp_atom.pdbx_model_Cartn_y_ideal _chem_comp_atom.pdbx_model_Cartn_z_ideal _chem_comp_atom.pdbx_component_atom_id _chem_comp_atom.pdbx_component_comp_id _chem_comp_atom.pdbx_ordinal CYS N N N 0 1 N N N 22.585 13.716 37.715 1.585 0.483 -0.081 N CYS 1 CYS CA CA C 0 1 N N R 22.372 13.468 39.168 0.141 0.450 0.186 CA CYS 2 CYS C C C 0 1 N N N 21.806 14.686 39.893 -0.095 0.006 1.606 C CYS 3 CYS O O O 0 1 N N N 22.614 15.553 40.277 0.685 -0.742 2.143 O CYS 4 CYS CB CB C 0 1 N N N 23.683 13.019 39.828 -0.533 -0.530 -0.774 CB CYS 5 CYS SG SG S 0 1 N N N 25.202 13.440 38.921 -0.247 0.004 -2.484 SG CYS 6 CYS OXT OXT O 0 1 N Y N 20.565 14.747 40.076 -1.174 0.443 2.275 OXT CYS 7 CYS H H H 0 1 N N N 22.963 12.902 37.230 1.928 -0.454 0.063 H CYS 8 CYS H2 HN2 H 0 1 N Y N 23.171 14.537 37.565 1.693 0.682 -1.065 H2 CYS 9 CYS HA HA H 0 1 N N N 21.614 12.654 39.253 -0.277 1.446 0.042 HA CYS 10 CYS HB2 1HB H 0 1 N N N 23.739 13.412 40.869 -0.114 -1.526 -0.630 HB2 CYS 11 CYS HB3 2HB H 0 1 N N N 23.651 11.923 40.031 -1.604 -0.554 -0.575 HB3 CYS 12 CYS HG HG H 0 1 N N N 26.013 13.162 39.329 -0.904 -0.965 -3.145 HG CYS 13 CYS HXT HXT H 0 1 N Y N 20.212 15.505 40.527 -1.326 0.158 3.186 HXT CYS 14 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal CYS N CA SING N N 1 CYS N H SING N N 2 CYS N H2 SING N N 3 CYS CA C SING N N 4 CYS CA CB SING N N 5 CYS CA HA SING N N 6 CYS C O DOUB N N 7 CYS C OXT SING N N 8 CYS CB SG SING N N 9 CYS CB HB2 SING N N 10 CYS CB HB3 SING N N 11 CYS SG HG SING N N 12 CYS OXT HXT SING N N 13 # loop_ _pdbx_chem_comp_descriptor.comp_id _pdbx_chem_comp_descriptor.type _pdbx_chem_comp_descriptor.program _pdbx_chem_comp_descriptor.program_version _pdbx_chem_comp_descriptor.descriptor CYS SMILES ACDLabs 10.04 "O=C(O)C(N)CS" CYS SMILES_CANONICAL CACTVS 3.341 "N[C@@H](CS)C(O)=O" CYS SMILES CACTVS 3.341 "N[CH](CS)C(O)=O" CYS SMILES_CANONICAL "OpenEye OEToolkits" 1.5.0 "C([C@@H](C(=O)O)N)S" CYS SMILES "OpenEye OEToolkits" 1.5.0 "C(C(C(=O)O)N)S" CYS InChI InChI 1.03 "InChI=1S/C3H7NO2S/c4-2(1-7)3(5)6/h2,7H,1,4H2,(H,5,6)/t2-/m0/s1" CYS InChIKey InChI 1.03 XUJNEKJLAYXESH-REOHCLBHSA-N # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier CYS "SYSTEMATIC NAME" ACDLabs 10.04 L-cysteine CYS "SYSTEMATIC NAME" "OpenEye OEToolkits" 1.5.0 "(2R)-2-amino-3-sulfanyl-propanoic acid" # loop_ _pdbx_chem_comp_audit.comp_id _pdbx_chem_comp_audit.action_type _pdbx_chem_comp_audit.date _pdbx_chem_comp_audit.processing_site CYS "Create component" 1999-07-08 RCSB CYS "Modify descriptor" 2011-06-04 RCSB # data_GLN # _chem_comp.id GLN _chem_comp.name GLUTAMINE _chem_comp.type "L-PEPTIDE LINKING" _chem_comp.pdbx_type ATOMP _chem_comp.formula "C5 H10 N2 O3" _chem_comp.mon_nstd_parent_comp_id ? _chem_comp.pdbx_synonyms ? _chem_comp.pdbx_formal_charge 0 _chem_comp.pdbx_initial_date 1999-07-08 _chem_comp.pdbx_modified_date 2011-06-04 _chem_comp.pdbx_ambiguous_flag N _chem_comp.pdbx_release_status REL _chem_comp.pdbx_replaced_by ? _chem_comp.pdbx_replaces ? _chem_comp.formula_weight 146.144 _chem_comp.one_letter_code Q _chem_comp.three_letter_code GLN _chem_comp.pdbx_model_coordinates_details ? _chem_comp.pdbx_model_coordinates_missing_flag N _chem_comp.pdbx_ideal_coordinates_details ? _chem_comp.pdbx_ideal_coordinates_missing_flag N _chem_comp.pdbx_model_coordinates_db_code ? _chem_comp.pdbx_subcomponent_list ? _chem_comp.pdbx_processing_site EBI # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.alt_atom_id _chem_comp_atom.type_symbol _chem_comp_atom.charge _chem_comp_atom.pdbx_align _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_leaving_atom_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.model_Cartn_x _chem_comp_atom.model_Cartn_y _chem_comp_atom.model_Cartn_z _chem_comp_atom.pdbx_model_Cartn_x_ideal _chem_comp_atom.pdbx_model_Cartn_y_ideal _chem_comp_atom.pdbx_model_Cartn_z_ideal _chem_comp_atom.pdbx_component_atom_id _chem_comp_atom.pdbx_component_comp_id _chem_comp_atom.pdbx_ordinal GLN N N N 0 1 N N N -12.869 34.883 120.983 1.858 -0.148 1.125 N GLN 1 GLN CA CA C 0 1 N N S -12.048 35.305 119.985 0.517 0.451 1.112 CA GLN 2 GLN C C C 0 1 N N N -10.724 35.797 120.549 -0.236 0.022 2.344 C GLN 3 GLN O O O 0 1 N N N -9.691 35.852 119.806 -0.005 -1.049 2.851 O GLN 4 GLN CB CB C 0 1 N N N -12.660 36.476 119.161 -0.236 -0.013 -0.135 CB GLN 5 GLN CG CG C 0 1 N N N -13.110 37.658 120.071 0.529 0.421 -1.385 CG GLN 6 GLN CD CD C 0 1 N N N -13.701 38.830 119.321 -0.213 -0.036 -2.614 CD GLN 7 GLN OE1 OE1 O 0 1 N N N -14.715 38.686 118.658 -1.252 -0.650 -2.500 OE1 GLN 8 GLN NE2 NE2 N 0 1 N N N -13.069 39.999 119.445 0.277 0.236 -3.839 NE2 GLN 9 GLN OXT OXT O 0 1 N Y N -10.665 36.169 121.753 -1.165 0.831 2.878 OXT GLN 10 GLN H H H 0 1 N N N -13.756 34.553 120.604 1.729 -1.148 1.137 H GLN 11 GLN H2 HN2 H 0 1 N Y N -13.004 35.604 121.691 2.286 0.078 0.240 H2 GLN 12 GLN HA HA H 0 1 N N N -11.902 34.421 119.320 0.605 1.537 1.099 HA GLN 13 GLN HB2 1HB H 0 1 N N N -11.958 36.821 118.366 -0.324 -1.100 -0.122 HB2 GLN 14 GLN HB3 2HB H 0 1 N N N -13.496 36.121 118.514 -1.231 0.431 -0.144 HB3 GLN 15 GLN HG2 1HG H 0 1 N N N -13.818 37.299 120.853 0.617 1.508 -1.398 HG2 GLN 16 GLN HG3 2HG H 0 1 N N N -12.266 37.994 120.717 1.524 -0.023 -1.375 HG3 GLN 17 GLN HE21 1HE2 H 0 0 N N N -12.221 40.119 119.999 -0.200 -0.058 -4.630 HE21 GLN 18 GLN HE22 2HE2 H 0 0 N N N -13.467 40.789 118.939 1.109 0.727 -3.930 HE22 GLN 19 GLN HXT HXT H 0 1 N Y N -9.838 36.476 122.105 -1.649 0.556 3.669 HXT GLN 20 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal GLN N CA SING N N 1 GLN N H SING N N 2 GLN N H2 SING N N 3 GLN CA C SING N N 4 GLN CA CB SING N N 5 GLN CA HA SING N N 6 GLN C O DOUB N N 7 GLN C OXT SING N N 8 GLN CB CG SING N N 9 GLN CB HB2 SING N N 10 GLN CB HB3 SING N N 11 GLN CG CD SING N N 12 GLN CG HG2 SING N N 13 GLN CG HG3 SING N N 14 GLN CD OE1 DOUB N N 15 GLN CD NE2 SING N N 16 GLN NE2 HE21 SING N N 17 GLN NE2 HE22 SING N N 18 GLN OXT HXT SING N N 19 # loop_ _pdbx_chem_comp_descriptor.comp_id _pdbx_chem_comp_descriptor.type _pdbx_chem_comp_descriptor.program _pdbx_chem_comp_descriptor.program_version _pdbx_chem_comp_descriptor.descriptor GLN SMILES ACDLabs 10.04 "O=C(N)CCC(N)C(=O)O" GLN SMILES_CANONICAL CACTVS 3.341 "N[C@@H](CCC(N)=O)C(O)=O" GLN SMILES CACTVS 3.341 "N[CH](CCC(N)=O)C(O)=O" GLN SMILES_CANONICAL "OpenEye OEToolkits" 1.5.0 "C(CC(=O)N)[C@@H](C(=O)O)N" GLN SMILES "OpenEye OEToolkits" 1.5.0 "C(CC(=O)N)C(C(=O)O)N" GLN InChI InChI 1.03 "InChI=1S/C5H10N2O3/c6-3(5(9)10)1-2-4(7)8/h3H,1-2,6H2,(H2,7,8)(H,9,10)/t3-/m0/s1" GLN InChIKey InChI 1.03 ZDXPYRJPNDTMRX-VKHMYHEASA-N # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier GLN "SYSTEMATIC NAME" ACDLabs 10.04 L-glutamine GLN "SYSTEMATIC NAME" "OpenEye OEToolkits" 1.5.0 "(2S)-2,5-diamino-5-oxo-pentanoic acid" # loop_ _pdbx_chem_comp_audit.comp_id _pdbx_chem_comp_audit.action_type _pdbx_chem_comp_audit.date _pdbx_chem_comp_audit.processing_site GLN "Create component" 1999-07-08 EBI GLN "Modify descriptor" 2011-06-04 RCSB # data_GLU # _chem_comp.id GLU _chem_comp.name "GLUTAMIC ACID" _chem_comp.type "L-PEPTIDE LINKING" _chem_comp.pdbx_type ATOMP _chem_comp.formula "C5 H9 N O4" _chem_comp.mon_nstd_parent_comp_id ? _chem_comp.pdbx_synonyms ? _chem_comp.pdbx_formal_charge 0 _chem_comp.pdbx_initial_date 1999-07-08 _chem_comp.pdbx_modified_date 2011-06-04 _chem_comp.pdbx_ambiguous_flag N _chem_comp.pdbx_release_status REL _chem_comp.pdbx_replaced_by ? _chem_comp.pdbx_replaces ? _chem_comp.formula_weight 147.129 _chem_comp.one_letter_code E _chem_comp.three_letter_code GLU _chem_comp.pdbx_model_coordinates_details ? _chem_comp.pdbx_model_coordinates_missing_flag N _chem_comp.pdbx_ideal_coordinates_details Corina _chem_comp.pdbx_ideal_coordinates_missing_flag N _chem_comp.pdbx_model_coordinates_db_code ? _chem_comp.pdbx_subcomponent_list ? _chem_comp.pdbx_processing_site EBI # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.alt_atom_id _chem_comp_atom.type_symbol _chem_comp_atom.charge _chem_comp_atom.pdbx_align _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_leaving_atom_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.model_Cartn_x _chem_comp_atom.model_Cartn_y _chem_comp_atom.model_Cartn_z _chem_comp_atom.pdbx_model_Cartn_x_ideal _chem_comp_atom.pdbx_model_Cartn_y_ideal _chem_comp_atom.pdbx_model_Cartn_z_ideal _chem_comp_atom.pdbx_component_atom_id _chem_comp_atom.pdbx_component_comp_id _chem_comp_atom.pdbx_ordinal GLU N N N 0 1 N N N 88.261 -7.660 -9.990 1.199 1.867 -0.117 N GLU 1 GLU CA CA C 0 1 N N S 87.744 -7.276 -11.334 1.138 0.515 0.453 CA GLU 2 GLU C C C 0 1 N N N 88.474 -6.030 -11.811 2.364 -0.260 0.041 C GLU 3 GLU O O O 0 1 N N N 88.969 -5.292 -10.943 3.010 0.096 -0.916 O GLU 4 GLU CB CB C 0 1 N N N 86.234 -7.012 -11.267 -0.113 -0.200 -0.062 CB GLU 5 GLU CG CG C 0 1 N N N 85.437 -8.194 -10.746 -1.360 0.517 0.461 CG GLU 6 GLU CD CD C 0 1 N N N 83.937 -7.944 -10.707 -2.593 -0.187 -0.046 CD GLU 7 GLU OE1 OE1 O 0 1 N N N 83.425 -7.140 -11.520 -2.485 -1.161 -0.753 OE1 GLU 8 GLU OE2 OE2 O 0 1 N N N 83.260 -8.567 -9.862 -3.811 0.269 0.287 OE2 GLU 9 GLU OXT OXT O 0 1 N Y N 88.543 -5.801 -13.033 2.737 -1.345 0.737 OXT GLU 10 GLU H H H 0 1 N N N 87.785 -8.479 -9.671 1.237 1.834 -1.125 H GLU 11 GLU H2 HN2 H 0 1 N Y N 89.241 -7.847 -10.051 0.421 2.427 0.197 H2 GLU 12 GLU HA HA H 0 1 N N N 87.920 -8.099 -12.043 1.098 0.580 1.540 HA GLU 13 GLU HB2 HB1 H 0 1 N N N 86.064 -6.160 -10.592 -0.117 -0.187 -1.152 HB2 GLU 14 GLU HB3 HB2 H 0 1 N N N 85.881 -6.781 -12.283 -0.113 -1.231 0.289 HB3 GLU 15 GLU HG2 HG1 H 0 1 N N N 85.624 -9.052 -11.408 -1.357 0.504 1.551 HG2 GLU 16 GLU HG3 HG2 H 0 1 N N N 85.775 -8.411 -9.722 -1.360 1.548 0.109 HG3 GLU 17 GLU HE2 HE2 H 0 1 N N N 82.345 -8.328 -9.951 -4.571 -0.215 -0.062 HE2 GLU 18 GLU HXT HXT H 0 1 N Y N 89.022 -4.994 -13.178 3.530 -1.809 0.435 HXT GLU 19 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal GLU N CA SING N N 1 GLU N H SING N N 2 GLU N H2 SING N N 3 GLU CA C SING N N 4 GLU CA CB SING N N 5 GLU CA HA SING N N 6 GLU C O DOUB N N 7 GLU C OXT SING N N 8 GLU CB CG SING N N 9 GLU CB HB2 SING N N 10 GLU CB HB3 SING N N 11 GLU CG CD SING N N 12 GLU CG HG2 SING N N 13 GLU CG HG3 SING N N 14 GLU CD OE1 DOUB N N 15 GLU CD OE2 SING N N 16 GLU OE2 HE2 SING N N 17 GLU OXT HXT SING N N 18 # loop_ _pdbx_chem_comp_descriptor.comp_id _pdbx_chem_comp_descriptor.type _pdbx_chem_comp_descriptor.program _pdbx_chem_comp_descriptor.program_version _pdbx_chem_comp_descriptor.descriptor GLU SMILES ACDLabs 12.01 "O=C(O)C(N)CCC(=O)O" GLU SMILES_CANONICAL CACTVS 3.370 "N[C@@H](CCC(O)=O)C(O)=O" GLU SMILES CACTVS 3.370 "N[CH](CCC(O)=O)C(O)=O" GLU SMILES_CANONICAL "OpenEye OEToolkits" 1.7.0 "C(CC(=O)O)[C@@H](C(=O)O)N" GLU SMILES "OpenEye OEToolkits" 1.7.0 "C(CC(=O)O)C(C(=O)O)N" GLU InChI InChI 1.03 "InChI=1S/C5H9NO4/c6-3(5(9)10)1-2-4(7)8/h3H,1-2,6H2,(H,7,8)(H,9,10)/t3-/m0/s1" GLU InChIKey InChI 1.03 WHUUTDBJXJRKMK-VKHMYHEASA-N # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier GLU "SYSTEMATIC NAME" ACDLabs 12.01 "L-glutamic acid" GLU "SYSTEMATIC NAME" "OpenEye OEToolkits" 1.7.0 "(2S)-2-azanylpentanedioic acid" # loop_ _pdbx_chem_comp_audit.comp_id _pdbx_chem_comp_audit.action_type _pdbx_chem_comp_audit.date _pdbx_chem_comp_audit.processing_site GLU "Create component" 1999-07-08 EBI GLU "Modify leaving atom flag" 2011-01-28 RCSB GLU "Other modification" 2011-02-09 RCSB GLU "Modify descriptor" 2011-06-04 RCSB # data_GLY # _chem_comp.id GLY _chem_comp.name GLYCINE _chem_comp.type "PEPTIDE LINKING" _chem_comp.pdbx_type ATOMP _chem_comp.formula "C2 H5 N O2" _chem_comp.mon_nstd_parent_comp_id ? _chem_comp.pdbx_synonyms ? _chem_comp.pdbx_formal_charge 0 _chem_comp.pdbx_initial_date 1999-07-08 _chem_comp.pdbx_modified_date 2011-06-04 _chem_comp.pdbx_ambiguous_flag N _chem_comp.pdbx_release_status REL _chem_comp.pdbx_replaced_by ? _chem_comp.pdbx_replaces ? _chem_comp.formula_weight 75.067 _chem_comp.one_letter_code G _chem_comp.three_letter_code GLY _chem_comp.pdbx_model_coordinates_details ? _chem_comp.pdbx_model_coordinates_missing_flag N _chem_comp.pdbx_ideal_coordinates_details Corina _chem_comp.pdbx_ideal_coordinates_missing_flag N _chem_comp.pdbx_model_coordinates_db_code ? _chem_comp.pdbx_subcomponent_list ? _chem_comp.pdbx_processing_site RCSB # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.alt_atom_id _chem_comp_atom.type_symbol _chem_comp_atom.charge _chem_comp_atom.pdbx_align _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_leaving_atom_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.model_Cartn_x _chem_comp_atom.model_Cartn_y _chem_comp_atom.model_Cartn_z _chem_comp_atom.pdbx_model_Cartn_x_ideal _chem_comp_atom.pdbx_model_Cartn_y_ideal _chem_comp_atom.pdbx_model_Cartn_z_ideal _chem_comp_atom.pdbx_component_atom_id _chem_comp_atom.pdbx_component_comp_id _chem_comp_atom.pdbx_ordinal GLY N N N 0 1 N N N 25.463 35.609 47.047 1.931 0.090 -0.034 N GLY 1 GLY CA CA C 0 1 N N N 25.329 37.024 46.850 0.761 -0.799 -0.008 CA GLY 2 GLY C C C 0 1 N N N 26.081 37.335 45.572 -0.498 0.029 -0.005 C GLY 3 GLY O O O 0 1 N N N 27.024 36.627 45.222 -0.429 1.235 -0.023 O GLY 4 GLY OXT OXT O 0 1 N Y N 25.702 38.256 44.874 -1.697 -0.574 0.018 OXT GLY 5 GLY H H H 0 1 N N N 25.494 35.150 46.159 1.910 0.738 0.738 H GLY 6 GLY H2 HN2 H 0 1 N Y N 26.307 35.421 47.549 2.788 -0.442 -0.037 H2 GLY 7 GLY HA2 HA1 H 0 1 N N N 24.270 37.305 46.757 0.772 -1.440 -0.889 HA2 GLY 8 GLY HA3 HA2 H 0 1 N N N 25.731 37.590 47.703 0.793 -1.415 0.891 HA3 GLY 9 GLY HXT HXT H 0 1 N Y N 26.236 38.300 44.090 -2.477 -0.002 0.019 HXT GLY 10 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal GLY N CA SING N N 1 GLY N H SING N N 2 GLY N H2 SING N N 3 GLY CA C SING N N 4 GLY CA HA2 SING N N 5 GLY CA HA3 SING N N 6 GLY C O DOUB N N 7 GLY C OXT SING N N 8 GLY OXT HXT SING N N 9 # loop_ _pdbx_chem_comp_descriptor.comp_id _pdbx_chem_comp_descriptor.type _pdbx_chem_comp_descriptor.program _pdbx_chem_comp_descriptor.program_version _pdbx_chem_comp_descriptor.descriptor GLY SMILES ACDLabs 10.04 "O=C(O)CN" GLY SMILES_CANONICAL CACTVS 3.341 "NCC(O)=O" GLY SMILES CACTVS 3.341 "NCC(O)=O" GLY SMILES_CANONICAL "OpenEye OEToolkits" 1.5.0 "C(C(=O)O)N" GLY SMILES "OpenEye OEToolkits" 1.5.0 "C(C(=O)O)N" GLY InChI InChI 1.03 "InChI=1S/C2H5NO2/c3-1-2(4)5/h1,3H2,(H,4,5)" GLY InChIKey InChI 1.03 DHMQDGOQFOQNFH-UHFFFAOYSA-N # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier GLY "SYSTEMATIC NAME" ACDLabs 10.04 glycine GLY "SYSTEMATIC NAME" "OpenEye OEToolkits" 1.5.0 "2-aminoethanoic acid" # loop_ _pdbx_chem_comp_audit.comp_id _pdbx_chem_comp_audit.action_type _pdbx_chem_comp_audit.date _pdbx_chem_comp_audit.processing_site GLY "Create component" 1999-07-08 RCSB GLY "Modify descriptor" 2011-06-04 RCSB # data_ILE # _chem_comp.id ILE _chem_comp.name ISOLEUCINE _chem_comp.type "L-PEPTIDE LINKING" _chem_comp.pdbx_type ATOMP _chem_comp.formula "C6 H13 N O2" _chem_comp.mon_nstd_parent_comp_id ? _chem_comp.pdbx_synonyms ? _chem_comp.pdbx_formal_charge 0 _chem_comp.pdbx_initial_date 1999-07-08 _chem_comp.pdbx_modified_date 2011-06-04 _chem_comp.pdbx_ambiguous_flag N _chem_comp.pdbx_release_status REL _chem_comp.pdbx_replaced_by ? _chem_comp.pdbx_replaces ? _chem_comp.formula_weight 131.173 _chem_comp.one_letter_code I _chem_comp.three_letter_code ILE _chem_comp.pdbx_model_coordinates_details ? _chem_comp.pdbx_model_coordinates_missing_flag N _chem_comp.pdbx_ideal_coordinates_details ? _chem_comp.pdbx_ideal_coordinates_missing_flag N _chem_comp.pdbx_model_coordinates_db_code ? _chem_comp.pdbx_subcomponent_list ? _chem_comp.pdbx_processing_site RCSB # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.alt_atom_id _chem_comp_atom.type_symbol _chem_comp_atom.charge _chem_comp_atom.pdbx_align _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_leaving_atom_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.model_Cartn_x _chem_comp_atom.model_Cartn_y _chem_comp_atom.model_Cartn_z _chem_comp_atom.pdbx_model_Cartn_x_ideal _chem_comp_atom.pdbx_model_Cartn_y_ideal _chem_comp_atom.pdbx_model_Cartn_z_ideal _chem_comp_atom.pdbx_component_atom_id _chem_comp_atom.pdbx_component_comp_id _chem_comp_atom.pdbx_ordinal ILE N N N 0 1 N N N 52.625 76.235 68.049 -1.944 0.335 -0.343 N ILE 1 ILE CA CA C 0 1 N N S 52.964 77.620 67.705 -0.487 0.519 -0.369 CA ILE 2 ILE C C C 0 1 N N N 51.910 78.234 66.791 0.066 -0.032 -1.657 C ILE 3 ILE O O O 0 1 N N N 51.409 77.508 65.911 -0.484 -0.958 -2.203 O ILE 4 ILE CB CB C 0 1 N N S 54.346 77.727 66.970 0.140 -0.219 0.814 CB ILE 5 ILE CG1 CG1 C 0 1 N N N 54.852 79.179 66.992 -0.421 0.341 2.122 CG1 ILE 6 ILE CG2 CG2 C 0 1 N N N 54.218 77.237 65.524 1.658 -0.027 0.788 CG2 ILE 7 ILE CD1 CD1 C 0 1 N N N 56.126 79.382 66.170 0.206 -0.397 3.305 CD1 ILE 8 ILE OXT OXT O 0 1 N Y N 51.631 79.444 66.958 1.171 0.504 -2.197 OXT ILE 9 ILE H H H 0 1 N N N 53.330 75.824 68.660 -2.112 -0.656 -0.410 H ILE 10 ILE H2 HN2 H 0 1 N Y N 52.475 75.667 67.215 -2.256 0.622 0.572 H2 ILE 11 ILE HA HA H 0 1 N N N 53.012 78.169 68.673 -0.253 1.582 -0.299 HA ILE 12 ILE HB HB H 0 1 N N N 55.082 77.082 67.504 -0.092 -1.281 0.744 HB ILE 13 ILE HG12 1HG1 H 0 0 N N N 54.051 79.883 66.666 -1.502 0.204 2.141 HG12 ILE 14 ILE HG13 2HG1 H 0 0 N N N 54.993 79.535 68.039 -0.188 1.403 2.192 HG13 ILE 15 ILE HG21 1HG2 H 0 0 N N N 55.200 77.313 65.001 1.891 1.034 0.857 HG21 ILE 16 ILE HG22 2HG2 H 0 0 N N N 53.796 76.206 65.469 2.105 -0.554 1.631 HG22 ILE 17 ILE HG23 3HG2 H 0 0 N N N 53.411 77.773 64.972 2.059 -0.427 -0.143 HG23 ILE 18 ILE HD11 1HD1 H 0 0 N N N 56.492 80.434 66.185 -0.193 0.001 4.237 HD11 ILE 19 ILE HD12 2HD1 H 0 0 N N N 56.926 78.677 66.496 -0.026 -1.460 3.235 HD12 ILE 20 ILE HD13 3HD1 H 0 0 N N N 55.984 79.026 65.122 1.287 -0.261 3.286 HD13 ILE 21 ILE HXT HXT H 0 1 N Y N 50.974 79.826 66.388 1.527 0.150 -3.024 HXT ILE 22 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ILE N CA SING N N 1 ILE N H SING N N 2 ILE N H2 SING N N 3 ILE CA C SING N N 4 ILE CA CB SING N N 5 ILE CA HA SING N N 6 ILE C O DOUB N N 7 ILE C OXT SING N N 8 ILE CB CG1 SING N N 9 ILE CB CG2 SING N N 10 ILE CB HB SING N N 11 ILE CG1 CD1 SING N N 12 ILE CG1 HG12 SING N N 13 ILE CG1 HG13 SING N N 14 ILE CG2 HG21 SING N N 15 ILE CG2 HG22 SING N N 16 ILE CG2 HG23 SING N N 17 ILE CD1 HD11 SING N N 18 ILE CD1 HD12 SING N N 19 ILE CD1 HD13 SING N N 20 ILE OXT HXT SING N N 21 # loop_ _pdbx_chem_comp_descriptor.comp_id _pdbx_chem_comp_descriptor.type _pdbx_chem_comp_descriptor.program _pdbx_chem_comp_descriptor.program_version _pdbx_chem_comp_descriptor.descriptor ILE SMILES ACDLabs 10.04 "O=C(O)C(N)C(C)CC" ILE SMILES_CANONICAL CACTVS 3.341 "CC[C@H](C)[C@H](N)C(O)=O" ILE SMILES CACTVS 3.341 "CC[CH](C)[CH](N)C(O)=O" ILE SMILES_CANONICAL "OpenEye OEToolkits" 1.5.0 "CC[C@H](C)[C@@H](C(=O)O)N" ILE SMILES "OpenEye OEToolkits" 1.5.0 "CCC(C)C(C(=O)O)N" ILE InChI InChI 1.03 "InChI=1S/C6H13NO2/c1-3-4(2)5(7)6(8)9/h4-5H,3,7H2,1-2H3,(H,8,9)/t4-,5-/m0/s1" ILE InChIKey InChI 1.03 AGPKZVBTJJNPAG-WHFBIAKZSA-N # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier ILE "SYSTEMATIC NAME" ACDLabs 10.04 L-isoleucine ILE "SYSTEMATIC NAME" "OpenEye OEToolkits" 1.5.0 "(2S,3S)-2-amino-3-methyl-pentanoic acid" # loop_ _pdbx_chem_comp_audit.comp_id _pdbx_chem_comp_audit.action_type _pdbx_chem_comp_audit.date _pdbx_chem_comp_audit.processing_site ILE "Create component" 1999-07-08 RCSB ILE "Modify descriptor" 2011-06-04 RCSB # data_LEU # _chem_comp.id LEU _chem_comp.name LEUCINE _chem_comp.type "L-PEPTIDE LINKING" _chem_comp.pdbx_type ATOMP _chem_comp.formula "C6 H13 N O2" _chem_comp.mon_nstd_parent_comp_id ? _chem_comp.pdbx_synonyms ? _chem_comp.pdbx_formal_charge 0 _chem_comp.pdbx_initial_date 1999-07-08 _chem_comp.pdbx_modified_date 2011-06-04 _chem_comp.pdbx_ambiguous_flag N _chem_comp.pdbx_release_status REL _chem_comp.pdbx_replaced_by ? _chem_comp.pdbx_replaces ? _chem_comp.formula_weight 131.173 _chem_comp.one_letter_code L _chem_comp.three_letter_code LEU _chem_comp.pdbx_model_coordinates_details ? _chem_comp.pdbx_model_coordinates_missing_flag N _chem_comp.pdbx_ideal_coordinates_details ? _chem_comp.pdbx_ideal_coordinates_missing_flag N _chem_comp.pdbx_model_coordinates_db_code ? _chem_comp.pdbx_subcomponent_list ? _chem_comp.pdbx_processing_site EBI # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.alt_atom_id _chem_comp_atom.type_symbol _chem_comp_atom.charge _chem_comp_atom.pdbx_align _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_leaving_atom_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.model_Cartn_x _chem_comp_atom.model_Cartn_y _chem_comp_atom.model_Cartn_z _chem_comp_atom.pdbx_model_Cartn_x_ideal _chem_comp_atom.pdbx_model_Cartn_y_ideal _chem_comp_atom.pdbx_model_Cartn_z_ideal _chem_comp_atom.pdbx_component_atom_id _chem_comp_atom.pdbx_component_comp_id _chem_comp_atom.pdbx_ordinal LEU N N N 0 1 N N N 16.293 15.907 52.123 -1.661 0.627 -0.406 N LEU 1 LEU CA CA C 0 1 N N S 15.121 16.772 51.804 -0.205 0.441 -0.467 CA LEU 2 LEU C C C 0 1 N N N 13.865 15.975 51.517 0.180 -0.055 -1.836 C LEU 3 LEU O O O 0 1 N N N 12.808 16.576 51.643 -0.591 -0.731 -2.474 O LEU 4 LEU CB CB C 0 1 N N N 15.395 17.657 50.575 0.221 -0.583 0.585 CB LEU 5 LEU CG CG C 0 1 N N N 16.407 18.798 50.632 -0.170 -0.079 1.976 CG LEU 6 LEU CD1 CD1 C 0 1 N N N 16.398 19.395 52.065 0.256 -1.104 3.029 CD1 LEU 7 LEU CD2 CD2 C 0 1 N N N 17.792 18.247 50.210 0.526 1.254 2.250 CD2 LEU 8 LEU OXT OXT O 0 1 N Y N 13.877 14.786 51.211 1.382 0.254 -2.348 OXT LEU 9 LEU H H H 0 1 N N N 17.138 16.443 52.316 -2.077 -0.272 -0.592 H LEU 10 LEU H2 HN2 H 0 1 N Y N 16.454 15.223 51.383 -1.884 0.858 0.550 H2 LEU 11 LEU HA HA H 0 1 N N N 14.962 17.396 52.714 0.291 1.391 -0.271 HA LEU 12 LEU HB2 1HB H 0 1 N N N 15.673 16.990 49.725 1.301 -0.722 0.540 HB2 LEU 13 LEU HB3 2HB H 0 1 N N N 14.421 18.076 50.228 -0.275 -1.534 0.390 HB3 LEU 14 LEU HG HG H 0 1 N N N 16.148 19.623 49.927 -1.250 0.058 2.021 HG LEU 15 LEU HD11 1HD1 H 0 0 N N N 17.137 20.228 52.106 -0.022 -0.745 4.019 HD11 LEU 16 LEU HD12 2HD1 H 0 0 N N N 15.379 19.710 52.390 -0.240 -2.055 2.833 HD12 LEU 17 LEU HD13 3HD1 H 0 0 N N N 16.577 18.624 52.850 1.336 -1.243 2.984 HD13 LEU 18 LEU HD21 1HD2 H 0 0 N N N 18.531 19.080 50.251 1.606 1.115 2.205 HD21 LEU 19 LEU HD22 2HD2 H 0 0 N N N 18.105 17.366 50.817 0.222 1.984 1.500 HD22 LEU 20 LEU HD23 3HD2 H 0 0 N N N 17.768 17.745 49.214 0.247 1.613 3.241 HD23 LEU 21 LEU HXT HXT H 0 1 N Y N 13.089 14.286 51.031 1.630 -0.064 -3.226 HXT LEU 22 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal LEU N CA SING N N 1 LEU N H SING N N 2 LEU N H2 SING N N 3 LEU CA C SING N N 4 LEU CA CB SING N N 5 LEU CA HA SING N N 6 LEU C O DOUB N N 7 LEU C OXT SING N N 8 LEU CB CG SING N N 9 LEU CB HB2 SING N N 10 LEU CB HB3 SING N N 11 LEU CG CD1 SING N N 12 LEU CG CD2 SING N N 13 LEU CG HG SING N N 14 LEU CD1 HD11 SING N N 15 LEU CD1 HD12 SING N N 16 LEU CD1 HD13 SING N N 17 LEU CD2 HD21 SING N N 18 LEU CD2 HD22 SING N N 19 LEU CD2 HD23 SING N N 20 LEU OXT HXT SING N N 21 # loop_ _pdbx_chem_comp_descriptor.comp_id _pdbx_chem_comp_descriptor.type _pdbx_chem_comp_descriptor.program _pdbx_chem_comp_descriptor.program_version _pdbx_chem_comp_descriptor.descriptor LEU SMILES ACDLabs 10.04 "O=C(O)C(N)CC(C)C" LEU SMILES_CANONICAL CACTVS 3.341 "CC(C)C[C@H](N)C(O)=O" LEU SMILES CACTVS 3.341 "CC(C)C[CH](N)C(O)=O" LEU SMILES_CANONICAL "OpenEye OEToolkits" 1.5.0 "CC(C)C[C@@H](C(=O)O)N" LEU SMILES "OpenEye OEToolkits" 1.5.0 "CC(C)CC(C(=O)O)N" LEU InChI InChI 1.03 "InChI=1S/C6H13NO2/c1-4(2)3-5(7)6(8)9/h4-5H,3,7H2,1-2H3,(H,8,9)/t5-/m0/s1" LEU InChIKey InChI 1.03 ROHFNLRQFUQHCH-YFKPBYRVSA-N # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier LEU "SYSTEMATIC NAME" ACDLabs 10.04 L-leucine LEU "SYSTEMATIC NAME" "OpenEye OEToolkits" 1.5.0 "(2S)-2-amino-4-methyl-pentanoic acid" # loop_ _pdbx_chem_comp_audit.comp_id _pdbx_chem_comp_audit.action_type _pdbx_chem_comp_audit.date _pdbx_chem_comp_audit.processing_site LEU "Create component" 1999-07-08 EBI LEU "Modify descriptor" 2011-06-04 RCSB # data_LYS # _chem_comp.id LYS _chem_comp.name LYSINE _chem_comp.type "L-PEPTIDE LINKING" _chem_comp.pdbx_type ATOMP _chem_comp.formula "C6 H15 N2 O2" _chem_comp.mon_nstd_parent_comp_id ? _chem_comp.pdbx_synonyms ? _chem_comp.pdbx_formal_charge 1 _chem_comp.pdbx_initial_date 1999-07-08 _chem_comp.pdbx_modified_date 2011-06-04 _chem_comp.pdbx_ambiguous_flag N _chem_comp.pdbx_release_status REL _chem_comp.pdbx_replaced_by ? _chem_comp.pdbx_replaces ? _chem_comp.formula_weight 147.195 _chem_comp.one_letter_code K _chem_comp.three_letter_code LYS _chem_comp.pdbx_model_coordinates_details ? _chem_comp.pdbx_model_coordinates_missing_flag N _chem_comp.pdbx_ideal_coordinates_details ? _chem_comp.pdbx_ideal_coordinates_missing_flag N _chem_comp.pdbx_model_coordinates_db_code ? _chem_comp.pdbx_subcomponent_list ? _chem_comp.pdbx_processing_site RCSB # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.alt_atom_id _chem_comp_atom.type_symbol _chem_comp_atom.charge _chem_comp_atom.pdbx_align _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_leaving_atom_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.model_Cartn_x _chem_comp_atom.model_Cartn_y _chem_comp_atom.model_Cartn_z _chem_comp_atom.pdbx_model_Cartn_x_ideal _chem_comp_atom.pdbx_model_Cartn_y_ideal _chem_comp_atom.pdbx_model_Cartn_z_ideal _chem_comp_atom.pdbx_component_atom_id _chem_comp_atom.pdbx_component_comp_id _chem_comp_atom.pdbx_ordinal LYS N N N 0 1 N N N 37.577 40.385 -3.968 1.422 1.796 0.198 N LYS 1 LYS CA CA C 0 1 N N S 38.631 39.459 -4.356 1.394 0.355 0.484 CA LYS 2 LYS C C C 0 1 N N N 38.094 38.304 -5.212 2.657 -0.284 -0.032 C LYS 3 LYS O O O 0 1 N N N 36.873 38.235 -5.490 3.316 0.275 -0.876 O LYS 4 LYS CB CB C 0 1 N N N 39.374 38.919 -3.139 0.184 -0.278 -0.206 CB LYS 5 LYS CG CG C 0 1 N N N 38.523 38.111 -2.181 -1.102 0.282 0.407 CG LYS 6 LYS CD CD C 0 1 N N N 39.164 36.749 -1.903 -2.313 -0.351 -0.283 CD LYS 7 LYS CE CE C 0 1 N N N 38.106 35.761 -1.382 -3.598 0.208 0.329 CE LYS 8 LYS NZ NZ N 1 1 N N N 37.176 36.546 -0.539 -4.761 -0.400 -0.332 NZ LYS 9 LYS OXT OXT O 0 1 N Y N 38.961 37.678 -5.886 3.050 -1.476 0.446 OXT LYS 10 LYS H H H 0 1 N N N 37.933 41.152 -3.399 1.489 1.891 -0.804 H LYS 11 LYS H2 HN2 H 0 1 N Y N 36.812 39.900 -3.498 0.521 2.162 0.464 H2 LYS 12 LYS HA HA H 0 1 N N N 39.352 40.037 -4.979 1.322 0.200 1.560 HA LYS 13 LYS HB2 1HB H 0 1 N N N 40.262 38.326 -3.460 0.210 -0.047 -1.270 HB2 LYS 14 LYS HB3 2HB H 0 1 N N N 39.882 39.750 -2.596 0.211 -1.359 -0.068 HB3 LYS 15 LYS HG2 1HG H 0 1 N N N 38.317 38.670 -1.238 -1.128 0.050 1.471 HG2 LYS 16 LYS HG3 2HG H 0 1 N N N 37.474 38.007 -2.546 -1.130 1.363 0.269 HG3 LYS 17 LYS HD2 1HD H 0 1 N N N 39.701 36.351 -2.795 -2.287 -0.120 -1.348 HD2 LYS 18 LYS HD3 2HD H 0 1 N N N 40.034 36.831 -1.210 -2.285 -1.432 -0.145 HD3 LYS 19 LYS HE2 1HE H 0 1 N N N 37.593 35.194 -2.194 -3.625 -0.023 1.394 HE2 LYS 20 LYS HE3 2HE H 0 1 N N N 38.544 34.882 -0.854 -3.626 1.289 0.192 HE3 LYS 21 LYS HZ1 1HZ H 0 1 N N N 36.474 35.891 -0.193 -4.736 -0.185 -1.318 HZ1 LYS 22 LYS HZ2 2HZ H 0 1 N N N 37.644 37.064 0.203 -4.735 -1.400 -0.205 HZ2 LYS 23 LYS HZ3 3HZ H 0 1 N N N 36.774 37.350 -1.021 -5.609 -0.031 0.071 HZ3 LYS 24 LYS HXT HXT H 0 1 N Y N 38.628 36.963 -6.415 3.861 -1.886 0.115 HXT LYS 25 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal LYS N CA SING N N 1 LYS N H SING N N 2 LYS N H2 SING N N 3 LYS CA C SING N N 4 LYS CA CB SING N N 5 LYS CA HA SING N N 6 LYS C O DOUB N N 7 LYS C OXT SING N N 8 LYS CB CG SING N N 9 LYS CB HB2 SING N N 10 LYS CB HB3 SING N N 11 LYS CG CD SING N N 12 LYS CG HG2 SING N N 13 LYS CG HG3 SING N N 14 LYS CD CE SING N N 15 LYS CD HD2 SING N N 16 LYS CD HD3 SING N N 17 LYS CE NZ SING N N 18 LYS CE HE2 SING N N 19 LYS CE HE3 SING N N 20 LYS NZ HZ1 SING N N 21 LYS NZ HZ2 SING N N 22 LYS NZ HZ3 SING N N 23 LYS OXT HXT SING N N 24 # loop_ _pdbx_chem_comp_descriptor.comp_id _pdbx_chem_comp_descriptor.type _pdbx_chem_comp_descriptor.program _pdbx_chem_comp_descriptor.program_version _pdbx_chem_comp_descriptor.descriptor LYS SMILES ACDLabs 10.04 "O=C(O)C(N)CCCC[NH3+]" LYS SMILES_CANONICAL CACTVS 3.341 "N[C@@H](CCCC[NH3+])C(O)=O" LYS SMILES CACTVS 3.341 "N[CH](CCCC[NH3+])C(O)=O" LYS SMILES_CANONICAL "OpenEye OEToolkits" 1.5.0 "C(CC[NH3+])C[C@@H](C(=O)O)N" LYS SMILES "OpenEye OEToolkits" 1.5.0 "C(CC[NH3+])CC(C(=O)O)N" LYS InChI InChI 1.03 "InChI=1S/C6H14N2O2/c7-4-2-1-3-5(8)6(9)10/h5H,1-4,7-8H2,(H,9,10)/p+1/t5-/m0/s1" LYS InChIKey InChI 1.03 KDXKERNSBIXSRK-YFKPBYRVSA-O # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier LYS "SYSTEMATIC NAME" ACDLabs 10.04 6-ammonio-L-norleucine LYS "SYSTEMATIC NAME" "OpenEye OEToolkits" 1.5.0 "[(5S)-5-amino-6-hydroxy-6-oxo-hexyl]azanium" # loop_ _pdbx_chem_comp_audit.comp_id _pdbx_chem_comp_audit.action_type _pdbx_chem_comp_audit.date _pdbx_chem_comp_audit.processing_site LYS "Create component" 1999-07-08 RCSB LYS "Modify descriptor" 2011-06-04 RCSB # data_MET # _chem_comp.id MET _chem_comp.name METHIONINE _chem_comp.type "L-PEPTIDE LINKING" _chem_comp.pdbx_type ATOMP _chem_comp.formula "C5 H11 N O2 S" _chem_comp.mon_nstd_parent_comp_id ? _chem_comp.pdbx_synonyms ? _chem_comp.pdbx_formal_charge 0 _chem_comp.pdbx_initial_date 1999-07-08 _chem_comp.pdbx_modified_date 2011-06-04 _chem_comp.pdbx_ambiguous_flag N _chem_comp.pdbx_release_status REL _chem_comp.pdbx_replaced_by ? _chem_comp.pdbx_replaces ? _chem_comp.formula_weight 149.211 _chem_comp.one_letter_code M _chem_comp.three_letter_code MET _chem_comp.pdbx_model_coordinates_details ? _chem_comp.pdbx_model_coordinates_missing_flag N _chem_comp.pdbx_ideal_coordinates_details ? _chem_comp.pdbx_ideal_coordinates_missing_flag N _chem_comp.pdbx_model_coordinates_db_code ? _chem_comp.pdbx_subcomponent_list ? _chem_comp.pdbx_processing_site EBI # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.alt_atom_id _chem_comp_atom.type_symbol _chem_comp_atom.charge _chem_comp_atom.pdbx_align _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_leaving_atom_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.model_Cartn_x _chem_comp_atom.model_Cartn_y _chem_comp_atom.model_Cartn_z _chem_comp_atom.pdbx_model_Cartn_x_ideal _chem_comp_atom.pdbx_model_Cartn_y_ideal _chem_comp_atom.pdbx_model_Cartn_z_ideal _chem_comp_atom.pdbx_component_atom_id _chem_comp_atom.pdbx_component_comp_id _chem_comp_atom.pdbx_ordinal MET N N N 0 1 N N N 16.161 15.756 51.903 -1.816 0.142 -1.166 N MET 1 MET CA CA C 0 1 N N S 15.084 16.739 51.596 -0.392 0.499 -1.214 CA MET 2 MET C C C 0 1 N N N 13.846 15.930 51.367 0.206 0.002 -2.504 C MET 3 MET O O O 0 1 N N N 12.795 16.510 51.424 -0.236 -0.989 -3.033 O MET 4 MET CB CB C 0 1 N N N 15.401 17.530 50.317 0.334 -0.145 -0.032 CB MET 5 MET CG CG C 0 1 N N N 16.183 18.846 50.502 -0.273 0.359 1.277 CG MET 6 MET SD SD S 0 1 N N N 17.852 18.653 51.063 0.589 -0.405 2.678 SD MET 7 MET CE CE C 0 1 N N N 18.614 17.814 49.556 -0.314 0.353 4.056 CE MET 8 MET OXT OXT O 0 1 N Y N 13.865 14.721 51.154 1.232 0.661 -3.066 OXT MET 9 MET H H H 0 1 N N N 17.004 16.307 52.059 -1.865 -0.864 -1.220 H MET 10 MET H2 HN2 H 0 1 N Y N 16.270 15.035 51.189 -2.149 0.399 -0.248 H2 MET 11 MET HA HA H 0 1 N N N 14.975 17.472 52.429 -0.287 1.582 -1.158 HA MET 12 MET HB2 1HB H 0 1 N N N 15.935 16.873 49.591 1.391 0.119 -0.068 HB2 MET 13 MET HB3 2HB H 0 1 N N N 14.459 17.728 49.754 0.229 -1.229 -0.088 HB3 MET 14 MET HG2 1HG H 0 1 N N N 16.160 19.442 49.560 -1.330 0.094 1.313 HG2 MET 15 MET HG3 2HG H 0 1 N N N 15.625 19.532 51.181 -0.168 1.442 1.333 HG3 MET 16 MET HE1 1HE H 0 1 N N N 19.664 17.692 49.909 0.090 -0.010 5.000 HE1 MET 17 MET HE2 2HE H 0 1 N N N 18.107 16.882 49.211 -0.207 1.436 4.008 HE2 MET 18 MET HE3 3HE H 0 1 N N N 18.487 18.349 48.586 -1.369 0.088 3.988 HE3 MET 19 MET HXT HXT H 0 1 N Y N 13.079 14.207 51.008 1.616 0.342 -3.894 HXT MET 20 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal MET N CA SING N N 1 MET N H SING N N 2 MET N H2 SING N N 3 MET CA C SING N N 4 MET CA CB SING N N 5 MET CA HA SING N N 6 MET C O DOUB N N 7 MET C OXT SING N N 8 MET CB CG SING N N 9 MET CB HB2 SING N N 10 MET CB HB3 SING N N 11 MET CG SD SING N N 12 MET CG HG2 SING N N 13 MET CG HG3 SING N N 14 MET SD CE SING N N 15 MET CE HE1 SING N N 16 MET CE HE2 SING N N 17 MET CE HE3 SING N N 18 MET OXT HXT SING N N 19 # loop_ _pdbx_chem_comp_descriptor.comp_id _pdbx_chem_comp_descriptor.type _pdbx_chem_comp_descriptor.program _pdbx_chem_comp_descriptor.program_version _pdbx_chem_comp_descriptor.descriptor MET SMILES ACDLabs 10.04 "O=C(O)C(N)CCSC" MET SMILES_CANONICAL CACTVS 3.341 "CSCC[C@H](N)C(O)=O" MET SMILES CACTVS 3.341 "CSCC[CH](N)C(O)=O" MET SMILES_CANONICAL "OpenEye OEToolkits" 1.5.0 "CSCC[C@@H](C(=O)O)N" MET SMILES "OpenEye OEToolkits" 1.5.0 "CSCCC(C(=O)O)N" MET InChI InChI 1.03 "InChI=1S/C5H11NO2S/c1-9-3-2-4(6)5(7)8/h4H,2-3,6H2,1H3,(H,7,8)/t4-/m0/s1" MET InChIKey InChI 1.03 FFEARJCKVFRZRR-BYPYZUCNSA-N # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier MET "SYSTEMATIC NAME" ACDLabs 10.04 L-methionine MET "SYSTEMATIC NAME" "OpenEye OEToolkits" 1.5.0 "(2S)-2-amino-4-methylsulfanyl-butanoic acid" # loop_ _pdbx_chem_comp_audit.comp_id _pdbx_chem_comp_audit.action_type _pdbx_chem_comp_audit.date _pdbx_chem_comp_audit.processing_site MET "Create component" 1999-07-08 EBI MET "Modify descriptor" 2011-06-04 RCSB # data_PHE # _chem_comp.id PHE _chem_comp.name PHENYLALANINE _chem_comp.type "L-PEPTIDE LINKING" _chem_comp.pdbx_type ATOMP _chem_comp.formula "C9 H11 N O2" _chem_comp.mon_nstd_parent_comp_id ? _chem_comp.pdbx_synonyms ? _chem_comp.pdbx_formal_charge 0 _chem_comp.pdbx_initial_date 1999-07-08 _chem_comp.pdbx_modified_date 2011-06-04 _chem_comp.pdbx_ambiguous_flag N _chem_comp.pdbx_release_status REL _chem_comp.pdbx_replaced_by ? _chem_comp.pdbx_replaces ? _chem_comp.formula_weight 165.189 _chem_comp.one_letter_code F _chem_comp.three_letter_code PHE _chem_comp.pdbx_model_coordinates_details ? _chem_comp.pdbx_model_coordinates_missing_flag N _chem_comp.pdbx_ideal_coordinates_details ? _chem_comp.pdbx_ideal_coordinates_missing_flag N _chem_comp.pdbx_model_coordinates_db_code ? _chem_comp.pdbx_subcomponent_list ? _chem_comp.pdbx_processing_site EBI # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.alt_atom_id _chem_comp_atom.type_symbol _chem_comp_atom.charge _chem_comp_atom.pdbx_align _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_leaving_atom_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.model_Cartn_x _chem_comp_atom.model_Cartn_y _chem_comp_atom.model_Cartn_z _chem_comp_atom.pdbx_model_Cartn_x_ideal _chem_comp_atom.pdbx_model_Cartn_y_ideal _chem_comp_atom.pdbx_model_Cartn_z_ideal _chem_comp_atom.pdbx_component_atom_id _chem_comp_atom.pdbx_component_comp_id _chem_comp_atom.pdbx_ordinal PHE N N N 0 1 N N N 3.260 22.302 6.000 1.317 0.962 1.014 N PHE 1 PHE CA CA C 0 1 N N S 4.252 21.272 5.710 -0.020 0.426 1.300 CA PHE 2 PHE C C C 0 1 N N N 5.559 21.899 5.229 -0.109 0.047 2.756 C PHE 3 PHE O O O 0 1 N N N 5.836 21.838 4.012 0.879 -0.317 3.346 O PHE 4 PHE CB CB C 0 1 N N N 3.708 20.298 4.656 -0.270 -0.809 0.434 CB PHE 5 PHE CG CG C 0 1 Y N N 4.596 19.106 4.406 -0.181 -0.430 -1.020 CG PHE 6 PHE CD1 CD1 C 0 1 Y N N 5.077 18.339 5.467 1.031 -0.498 -1.680 CD1 PHE 7 PHE CD2 CD2 C 0 1 Y N N 4.927 18.732 3.109 -1.314 -0.018 -1.698 CD2 PHE 8 PHE CE1 CE1 C 0 1 Y N N 5.874 17.219 5.237 1.112 -0.150 -3.015 CE1 PHE 9 PHE CE2 CE2 C 0 1 Y N N 5.718 17.618 2.867 -1.231 0.333 -3.032 CE2 PHE 10 PHE CZ CZ C 0 1 Y N N 6.193 16.860 3.932 -0.018 0.265 -3.691 CZ PHE 11 PHE OXT OXT O 0 1 N Y N 6.283 22.460 6.079 -1.286 0.113 3.396 OXT PHE 12 PHE H H H 0 1 N N N 2.387 21.883 6.321 1.975 0.230 1.235 H PHE 13 PHE H2 HN2 H 0 1 N Y N 3.111 22.918 5.201 1.365 1.104 0.017 H2 PHE 14 PHE HA HA H 0 1 N N N 4.460 20.708 6.649 -0.770 1.184 1.076 HA PHE 15 PHE HB2 1HB H 0 1 N N N 2.676 19.968 4.922 0.480 -1.568 0.659 HB2 PHE 16 PHE HB3 2HB H 0 1 N N N 3.493 20.833 3.701 -1.262 -1.207 0.646 HB3 PHE 17 PHE HD1 HD1 H 0 1 N N N 4.823 18.622 6.502 1.915 -0.824 -1.152 HD1 PHE 18 PHE HD2 HD2 H 0 1 N N N 4.556 19.328 2.258 -2.262 0.034 -1.183 HD2 PHE 19 PHE HE1 HE1 H 0 1 N N N 6.250 16.619 6.083 2.060 -0.203 -3.530 HE1 PHE 20 PHE HE2 HE2 H 0 1 N N N 5.968 17.335 1.830 -2.116 0.659 -3.560 HE2 PHE 21 PHE HZ HZ H 0 1 N N N 6.822 15.974 3.741 0.045 0.538 -4.734 HZ PHE 22 PHE HXT HXT H 0 1 N Y N 7.096 22.850 5.779 -1.343 -0.130 4.330 HXT PHE 23 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal PHE N CA SING N N 1 PHE N H SING N N 2 PHE N H2 SING N N 3 PHE CA C SING N N 4 PHE CA CB SING N N 5 PHE CA HA SING N N 6 PHE C O DOUB N N 7 PHE C OXT SING N N 8 PHE CB CG SING N N 9 PHE CB HB2 SING N N 10 PHE CB HB3 SING N N 11 PHE CG CD1 DOUB Y N 12 PHE CG CD2 SING Y N 13 PHE CD1 CE1 SING Y N 14 PHE CD1 HD1 SING N N 15 PHE CD2 CE2 DOUB Y N 16 PHE CD2 HD2 SING N N 17 PHE CE1 CZ DOUB Y N 18 PHE CE1 HE1 SING N N 19 PHE CE2 CZ SING Y N 20 PHE CE2 HE2 SING N N 21 PHE CZ HZ SING N N 22 PHE OXT HXT SING N N 23 # loop_ _pdbx_chem_comp_descriptor.comp_id _pdbx_chem_comp_descriptor.type _pdbx_chem_comp_descriptor.program _pdbx_chem_comp_descriptor.program_version _pdbx_chem_comp_descriptor.descriptor PHE SMILES ACDLabs 10.04 "O=C(O)C(N)Cc1ccccc1" PHE SMILES_CANONICAL CACTVS 3.341 "N[C@@H](Cc1ccccc1)C(O)=O" PHE SMILES CACTVS 3.341 "N[CH](Cc1ccccc1)C(O)=O" PHE SMILES_CANONICAL "OpenEye OEToolkits" 1.5.0 "c1ccc(cc1)C[C@@H](C(=O)O)N" PHE SMILES "OpenEye OEToolkits" 1.5.0 "c1ccc(cc1)CC(C(=O)O)N" PHE InChI InChI 1.03 "InChI=1S/C9H11NO2/c10-8(9(11)12)6-7-4-2-1-3-5-7/h1-5,8H,6,10H2,(H,11,12)/t8-/m0/s1" PHE InChIKey InChI 1.03 COLNVLDHVKWLRT-QMMMGPOBSA-N # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier PHE "SYSTEMATIC NAME" ACDLabs 10.04 L-phenylalanine PHE "SYSTEMATIC NAME" "OpenEye OEToolkits" 1.5.0 "(2S)-2-amino-3-phenyl-propanoic acid" # loop_ _pdbx_chem_comp_audit.comp_id _pdbx_chem_comp_audit.action_type _pdbx_chem_comp_audit.date _pdbx_chem_comp_audit.processing_site PHE "Create component" 1999-07-08 EBI PHE "Modify descriptor" 2011-06-04 RCSB # data_PRO # _chem_comp.id PRO _chem_comp.name PROLINE _chem_comp.type "L-PEPTIDE LINKING" _chem_comp.pdbx_type ATOMP _chem_comp.formula "C5 H9 N O2" _chem_comp.mon_nstd_parent_comp_id ? _chem_comp.pdbx_synonyms ? _chem_comp.pdbx_formal_charge 0 _chem_comp.pdbx_initial_date 1999-07-08 _chem_comp.pdbx_modified_date 2011-06-04 _chem_comp.pdbx_ambiguous_flag N _chem_comp.pdbx_release_status REL _chem_comp.pdbx_replaced_by ? _chem_comp.pdbx_replaces ? _chem_comp.formula_weight 115.130 _chem_comp.one_letter_code P _chem_comp.three_letter_code PRO _chem_comp.pdbx_model_coordinates_details ? _chem_comp.pdbx_model_coordinates_missing_flag N _chem_comp.pdbx_ideal_coordinates_details ? _chem_comp.pdbx_ideal_coordinates_missing_flag N _chem_comp.pdbx_model_coordinates_db_code ? _chem_comp.pdbx_subcomponent_list ? _chem_comp.pdbx_processing_site RCSB # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.alt_atom_id _chem_comp_atom.type_symbol _chem_comp_atom.charge _chem_comp_atom.pdbx_align _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_leaving_atom_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.model_Cartn_x _chem_comp_atom.model_Cartn_y _chem_comp_atom.model_Cartn_z _chem_comp_atom.pdbx_model_Cartn_x_ideal _chem_comp_atom.pdbx_model_Cartn_y_ideal _chem_comp_atom.pdbx_model_Cartn_z_ideal _chem_comp_atom.pdbx_component_atom_id _chem_comp_atom.pdbx_component_comp_id _chem_comp_atom.pdbx_ordinal PRO N N N 0 1 N N N 39.165 37.768 82.966 -0.816 1.108 0.254 N PRO 1 PRO CA CA C 0 1 N N S 38.579 38.700 82.008 0.001 -0.107 0.509 CA PRO 2 PRO C C C 0 1 N N N 37.217 39.126 82.515 1.408 0.091 0.005 C PRO 3 PRO O O O 0 1 N N N 36.256 38.332 82.370 1.650 0.980 -0.777 O PRO 4 PRO CB CB C 0 1 N N N 38.491 37.874 80.720 -0.703 -1.227 -0.286 CB PRO 5 PRO CG CG C 0 1 N N N 38.311 36.445 81.200 -2.163 -0.753 -0.439 CG PRO 6 PRO CD CD C 0 1 N N N 38.958 36.358 82.579 -2.218 0.614 0.276 CD PRO 7 PRO OXT OXT O 0 1 N Y N 37.131 40.263 83.047 2.391 -0.721 0.424 OXT PRO 8 PRO H HT1 H 0 1 N Y N 40.152 37.928 82.959 -0.707 1.708 1.057 H PRO 9 PRO HA HA H 0 1 N N N 39.160 39.638 81.850 0.009 -0.343 1.573 HA PRO 10 PRO HB2 1HB H 0 1 N N N 37.703 38.219 80.010 -0.240 -1.345 -1.266 HB2 PRO 11 PRO HB3 2HB H 0 1 N N N 39.352 38.017 80.027 -0.666 -2.165 0.267 HB3 PRO 12 PRO HG2 1HG H 0 1 N N N 37.247 36.109 81.191 -2.416 -0.638 -1.493 HG2 PRO 13 PRO HG3 2HG H 0 1 N N N 38.703 35.687 80.482 -2.843 -1.458 0.040 HG3 PRO 14 PRO HD2 1HD H 0 1 N N N 38.378 35.759 83.320 -2.872 1.300 -0.263 HD2 PRO 15 PRO HD3 2HD H 0 1 N N N 39.880 35.732 82.614 -2.559 0.492 1.304 HD3 PRO 16 PRO HXT HXT H 0 1 N Y N 36.276 40.530 83.365 3.293 -0.594 0.101 HXT PRO 17 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal PRO N CA SING N N 1 PRO N CD SING N N 2 PRO N H SING N N 3 PRO CA C SING N N 4 PRO CA CB SING N N 5 PRO CA HA SING N N 6 PRO C O DOUB N N 7 PRO C OXT SING N N 8 PRO CB CG SING N N 9 PRO CB HB2 SING N N 10 PRO CB HB3 SING N N 11 PRO CG CD SING N N 12 PRO CG HG2 SING N N 13 PRO CG HG3 SING N N 14 PRO CD HD2 SING N N 15 PRO CD HD3 SING N N 16 PRO OXT HXT SING N N 17 # loop_ _pdbx_chem_comp_descriptor.comp_id _pdbx_chem_comp_descriptor.type _pdbx_chem_comp_descriptor.program _pdbx_chem_comp_descriptor.program_version _pdbx_chem_comp_descriptor.descriptor PRO SMILES ACDLabs 10.04 "O=C(O)C1NCCC1" PRO SMILES_CANONICAL CACTVS 3.341 "OC(=O)[C@@H]1CCCN1" PRO SMILES CACTVS 3.341 "OC(=O)[CH]1CCCN1" PRO SMILES_CANONICAL "OpenEye OEToolkits" 1.5.0 "C1C[C@H](NC1)C(=O)O" PRO SMILES "OpenEye OEToolkits" 1.5.0 "C1CC(NC1)C(=O)O" PRO InChI InChI 1.03 "InChI=1S/C5H9NO2/c7-5(8)4-2-1-3-6-4/h4,6H,1-3H2,(H,7,8)/t4-/m0/s1" PRO InChIKey InChI 1.03 ONIBWKKTOPOVIA-BYPYZUCNSA-N # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier PRO "SYSTEMATIC NAME" ACDLabs 10.04 L-proline PRO "SYSTEMATIC NAME" "OpenEye OEToolkits" 1.5.0 "(2S)-pyrrolidine-2-carboxylic acid" # loop_ _pdbx_chem_comp_audit.comp_id _pdbx_chem_comp_audit.action_type _pdbx_chem_comp_audit.date _pdbx_chem_comp_audit.processing_site PRO "Create component" 1999-07-08 RCSB PRO "Modify descriptor" 2011-06-04 RCSB # data_REA # _chem_comp.id REA _chem_comp.name "RETINOIC ACID" _chem_comp.type NON-POLYMER _chem_comp.pdbx_type HETAIN _chem_comp.formula "C20 H28 O2" _chem_comp.mon_nstd_parent_comp_id ? _chem_comp.pdbx_synonyms ? _chem_comp.pdbx_formal_charge 0 _chem_comp.pdbx_initial_date 1999-07-08 _chem_comp.pdbx_modified_date 2016-10-18 _chem_comp.pdbx_ambiguous_flag N _chem_comp.pdbx_release_status REL _chem_comp.pdbx_replaced_by ? _chem_comp.pdbx_replaces 3KV _chem_comp.formula_weight 300.435 _chem_comp.one_letter_code ? _chem_comp.three_letter_code REA _chem_comp.pdbx_model_coordinates_details ? _chem_comp.pdbx_model_coordinates_missing_flag N _chem_comp.pdbx_ideal_coordinates_details Corina _chem_comp.pdbx_ideal_coordinates_missing_flag N _chem_comp.pdbx_model_coordinates_db_code 1CBS _chem_comp.pdbx_subcomponent_list ? _chem_comp.pdbx_processing_site RCSB # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.alt_atom_id _chem_comp_atom.type_symbol _chem_comp_atom.charge _chem_comp_atom.pdbx_align _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_leaving_atom_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.model_Cartn_x _chem_comp_atom.model_Cartn_y _chem_comp_atom.model_Cartn_z _chem_comp_atom.pdbx_model_Cartn_x_ideal _chem_comp_atom.pdbx_model_Cartn_y_ideal _chem_comp_atom.pdbx_model_Cartn_z_ideal _chem_comp_atom.pdbx_component_atom_id _chem_comp_atom.pdbx_component_comp_id _chem_comp_atom.pdbx_ordinal REA C1 C1 C 0 1 N N N 21.972 29.831 16.739 -4.684 0.932 -0.497 C1 REA 1 REA C2 C2 C 0 1 N N N 20.921 30.524 15.841 -5.837 0.190 -1.176 C2 REA 2 REA C3 C3 C 0 1 N N N 20.245 29.635 14.848 -6.441 -0.798 -0.171 C3 REA 3 REA C4 C4 C 0 1 N N N 19.555 28.479 15.488 -5.418 -1.903 0.100 C4 REA 4 REA C5 C5 C 0 1 N N N 20.389 27.812 16.587 -4.082 -1.301 0.429 C5 REA 5 REA C6 C6 C 0 1 N N N 21.425 28.446 17.218 -3.756 -0.048 0.161 C6 REA 6 REA C7 C7 C 0 1 N N N 22.242 27.851 18.297 -2.457 0.396 0.516 C7 REA 7 REA C8 C8 C 0 1 N N N 21.868 26.977 19.240 -1.363 -0.229 0.007 C8 REA 8 REA C9 C9 C 0 1 N N N 22.705 26.434 20.286 -0.076 0.257 0.298 C9 REA 9 REA C10 C10 C 0 1 N N N 22.159 25.536 21.131 1.022 -0.370 -0.213 C10 REA 10 REA C11 C11 C 0 1 N N N 22.875 24.924 22.234 2.306 0.115 0.077 C11 REA 11 REA C12 C12 C 0 1 N N N 22.237 24.026 22.990 3.405 -0.513 -0.435 C12 REA 12 REA C13 C13 C 0 1 N N N 22.856 23.377 24.125 4.689 -0.028 -0.144 C13 REA 13 REA C14 C14 C 0 1 N N N 22.135 22.473 24.834 5.787 -0.655 -0.656 C14 REA 14 REA C15 C15 C 0 1 N N N 22.563 21.710 26.016 7.077 -0.265 -0.244 C15 REA 15 REA C16 C16 C 0 1 N N N 22.238 30.737 17.948 -5.246 1.886 0.559 C16 REA 16 REA C17 C17 C 0 1 N N N 23.292 29.620 15.948 -3.911 1.737 -1.544 C17 REA 17 REA C18 C18 C 0 1 N N N 19.791 26.449 16.947 -3.056 -2.175 1.103 C18 REA 18 REA C19 C19 C 0 1 N N N 24.181 26.841 20.385 0.090 1.471 1.175 C19 REA 19 REA C20 C20 C 0 1 N N N 24.303 23.747 24.489 4.855 1.186 0.733 C20 REA 20 REA O1 O1 O 0 1 N N N 23.640 21.075 25.978 7.210 0.553 0.648 O1 REA 21 REA O2 O2 O 0 1 N N N 21.840 21.712 27.037 8.166 -0.798 -0.840 O2 REA 22 REA H21 H21 H 0 1 N N N 20.147 30.955 16.494 -6.598 0.905 -1.490 H21 REA 23 REA H22 H22 H 0 1 N N N 21.425 31.330 15.288 -5.462 -0.353 -2.044 H22 REA 24 REA H31 H31 H 0 1 N N N 19.501 30.227 14.295 -6.673 -0.278 0.759 H31 REA 25 REA H32 H32 H 0 1 N N N 21.001 29.250 14.148 -7.349 -1.234 -0.586 H32 REA 26 REA H41 H41 H 0 1 N N N 18.613 28.835 15.931 -5.756 -2.511 0.938 H41 REA 27 REA H42 H42 H 0 1 N N N 19.335 27.730 14.713 -5.322 -2.531 -0.786 H42 REA 28 REA H7 H7 H 0 1 N N N 23.276 28.162 18.329 -2.337 1.230 1.191 H7 REA 29 REA H8 H8 H 0 1 N N N 20.840 26.645 19.217 -1.482 -1.100 -0.622 H8 REA 30 REA H10 H10 H 0 1 N N N 21.127 25.256 20.977 0.903 -1.241 -0.842 H10 REA 31 REA H11 H11 H 0 1 N N N 23.902 25.189 22.440 2.425 0.985 0.706 H11 REA 32 REA H12 H12 H 0 1 N N N 21.216 23.774 22.743 3.286 -1.383 -1.063 H12 REA 33 REA H14 H14 H 0 1 N N N 21.127 22.292 24.490 5.667 -1.451 -1.376 H14 REA 34 REA H161 H161 H 0 0 N N N 22.984 30.265 18.604 -5.802 1.316 1.303 H161 REA 35 REA H162 H162 H 0 0 N N N 22.618 31.709 17.601 -4.426 2.415 1.044 H162 REA 36 REA H163 H163 H 0 0 N N N 21.302 30.887 18.506 -5.911 2.605 0.081 H163 REA 37 REA H171 H171 H 0 0 N N N 24.033 29.127 16.595 -4.598 2.394 -2.077 H171 REA 38 REA H172 H172 H 0 0 N N N 23.095 28.989 15.069 -3.146 2.335 -1.050 H172 REA 39 REA H173 H173 H 0 0 N N N 23.683 30.595 15.620 -3.439 1.054 -2.251 H173 REA 40 REA H181 H181 H 0 0 N N N 20.397 25.979 17.736 -3.448 -3.187 1.201 H181 REA 41 REA H182 H182 H 0 0 N N N 18.761 26.584 17.308 -2.145 -2.194 0.503 H182 REA 42 REA H183 H183 H 0 0 N N N 19.786 25.804 16.056 -2.831 -1.775 2.092 H183 REA 43 REA H191 H191 H 0 0 N N N 24.647 26.327 21.238 0.171 1.159 2.216 H191 REA 44 REA H192 H192 H 0 0 N N N 24.702 26.559 19.458 0.993 2.008 0.885 H192 REA 45 REA H193 H193 H 0 0 N N N 24.252 27.929 20.529 -0.774 2.125 1.058 H193 REA 46 REA H201 H201 H 0 0 N N N 24.620 23.168 25.369 5.026 0.871 1.762 H201 REA 47 REA H202 H202 H 0 0 N N N 24.965 23.516 23.641 5.707 1.771 0.386 H202 REA 48 REA H203 H203 H 0 0 N N N 24.360 24.822 24.717 3.952 1.795 0.685 H203 REA 49 REA HO2 HO2 H 0 1 N N N 22.244 21.180 27.713 9.006 -0.469 -0.490 HO2 REA 50 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal REA C1 C2 SING N N 1 REA C1 C6 SING N N 2 REA C1 C16 SING N N 3 REA C1 C17 SING N N 4 REA C2 C3 SING N N 5 REA C2 H21 SING N N 6 REA C2 H22 SING N N 7 REA C3 C4 SING N N 8 REA C3 H31 SING N N 9 REA C3 H32 SING N N 10 REA C4 C5 SING N N 11 REA C4 H41 SING N N 12 REA C4 H42 SING N N 13 REA C5 C6 DOUB N N 14 REA C5 C18 SING N N 15 REA C6 C7 SING N N 16 REA C7 C8 DOUB N E 17 REA C7 H7 SING N N 18 REA C8 C9 SING N N 19 REA C8 H8 SING N N 20 REA C9 C10 DOUB N E 21 REA C9 C19 SING N N 22 REA C10 C11 SING N N 23 REA C10 H10 SING N N 24 REA C11 C12 DOUB N E 25 REA C11 H11 SING N N 26 REA C12 C13 SING N N 27 REA C12 H12 SING N N 28 REA C13 C14 DOUB N E 29 REA C13 C20 SING N N 30 REA C14 C15 SING N N 31 REA C14 H14 SING N N 32 REA C15 O1 DOUB N N 33 REA C15 O2 SING N N 34 REA C16 H161 SING N N 35 REA C16 H162 SING N N 36 REA C16 H163 SING N N 37 REA C17 H171 SING N N 38 REA C17 H172 SING N N 39 REA C17 H173 SING N N 40 REA C18 H181 SING N N 41 REA C18 H182 SING N N 42 REA C18 H183 SING N N 43 REA C19 H191 SING N N 44 REA C19 H192 SING N N 45 REA C19 H193 SING N N 46 REA C20 H201 SING N N 47 REA C20 H202 SING N N 48 REA C20 H203 SING N N 49 REA O2 HO2 SING N N 50 # loop_ _pdbx_chem_comp_descriptor.comp_id _pdbx_chem_comp_descriptor.type _pdbx_chem_comp_descriptor.program _pdbx_chem_comp_descriptor.program_version _pdbx_chem_comp_descriptor.descriptor REA SMILES ACDLabs 12.01 "C1(CCCC(=C1\C=C\C(=C\C=C\C(=C\C(=O)O)C)C)C)(C)C" REA InChI InChI 1.03 "InChI=1S/C20H28O2/c1-15(8-6-9-16(2)14-19(21)22)11-12-18-17(3)10-7-13-20(18,4)5/h6,8-9,11-12,14H,7,10,13H2,1-5H3,(H,21,22)/b9-6+,12-11+,15-8+,16-14+" REA InChIKey InChI 1.03 SHGAZHPCJJPHSC-YCNIQYBTSA-N REA SMILES_CANONICAL CACTVS 3.385 "CC1=C(\C=C\C(C)=C\C=C\C(C)=C\C(O)=O)C(C)(C)CCC1" REA SMILES CACTVS 3.385 "CC1=C(C=CC(C)=CC=CC(C)=CC(O)=O)C(C)(C)CCC1" REA SMILES_CANONICAL "OpenEye OEToolkits" 1.7.6 "CC1=C(C(CCC1)(C)C)/C=C/C(=C/C=C/C(=C/C(=O)O)/C)/C" REA SMILES "OpenEye OEToolkits" 1.7.6 "CC1=C(C(CCC1)(C)C)C=CC(=CC=CC(=CC(=O)O)C)C" # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier REA "SYSTEMATIC NAME" ACDLabs 12.01 "retinoic acid" REA "SYSTEMATIC NAME" "OpenEye OEToolkits" 1.7.6 "(2E,4E,6E,8E)-3,7-dimethyl-9-(2,6,6-trimethylcyclohexen-1-yl)nona-2,4,6,8-tetraenoic acid" # loop_ _pdbx_chem_comp_audit.comp_id _pdbx_chem_comp_audit.action_type _pdbx_chem_comp_audit.date _pdbx_chem_comp_audit.processing_site REA "Create component" 1999-07-08 RCSB REA "Modify descriptor" 2011-06-04 RCSB REA "Other modification" 2016-10-18 RCSB # data_SER # _chem_comp.id SER _chem_comp.name SERINE _chem_comp.type "L-PEPTIDE LINKING" _chem_comp.pdbx_type ATOMP _chem_comp.formula "C3 H7 N O3" _chem_comp.mon_nstd_parent_comp_id ? _chem_comp.pdbx_synonyms ? _chem_comp.pdbx_formal_charge 0 _chem_comp.pdbx_initial_date 1999-07-08 _chem_comp.pdbx_modified_date 2011-06-04 _chem_comp.pdbx_ambiguous_flag N _chem_comp.pdbx_release_status REL _chem_comp.pdbx_replaced_by ? _chem_comp.pdbx_replaces SEG _chem_comp.formula_weight 105.093 _chem_comp.one_letter_code S _chem_comp.three_letter_code SER _chem_comp.pdbx_model_coordinates_details ? _chem_comp.pdbx_model_coordinates_missing_flag N _chem_comp.pdbx_ideal_coordinates_details ? _chem_comp.pdbx_ideal_coordinates_missing_flag N _chem_comp.pdbx_model_coordinates_db_code ? _chem_comp.pdbx_subcomponent_list ? _chem_comp.pdbx_processing_site RCSB # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.alt_atom_id _chem_comp_atom.type_symbol _chem_comp_atom.charge _chem_comp_atom.pdbx_align _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_leaving_atom_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.model_Cartn_x _chem_comp_atom.model_Cartn_y _chem_comp_atom.model_Cartn_z _chem_comp_atom.pdbx_model_Cartn_x_ideal _chem_comp_atom.pdbx_model_Cartn_y_ideal _chem_comp_atom.pdbx_model_Cartn_z_ideal _chem_comp_atom.pdbx_component_atom_id _chem_comp_atom.pdbx_component_comp_id _chem_comp_atom.pdbx_ordinal SER N N N 0 1 N N N 88.198 -7.658 -9.979 1.525 0.493 -0.608 N SER 1 SER CA CA C 0 1 N N S 87.782 -7.276 -11.358 0.100 0.469 -0.252 CA SER 2 SER C C C 0 1 N N N 88.571 -6.062 -11.818 -0.053 0.004 1.173 C SER 3 SER O O O 0 1 N N N 89.008 -5.296 -10.944 0.751 -0.760 1.649 O SER 4 SER CB CB C 0 1 N N N 86.286 -6.966 -11.391 -0.642 -0.489 -1.184 CB SER 5 SER OG OG O 0 1 N N N 85.543 -8.096 -10.989 -0.496 -0.049 -2.535 OG SER 6 SER OXT OXT O 0 1 N Y N 88.737 -5.884 -13.035 -1.084 0.440 1.913 OXT SER 7 SER H H H 0 1 N N N 87.668 -8.473 -9.670 1.867 -0.449 -0.499 H SER 8 SER H2 HN2 H 0 1 N Y N 88.118 -6.879 -9.325 1.574 0.707 -1.593 H2 SER 9 SER HA HA H 0 1 N N N 87.988 -8.129 -12.045 -0.316 1.471 -0.354 HA SER 10 SER HB2 1HB H 0 1 N N N 86.034 -6.065 -10.783 -0.225 -1.491 -1.081 HB2 SER 11 SER HB3 2HB H 0 1 N N N 85.961 -6.588 -12.388 -1.699 -0.507 -0.920 HB3 SER 12 SER HG HG H 0 1 N N N 84.613 -7.903 -11.009 -0.978 -0.679 -3.088 HG SER 13 SER HXT HXT H 0 1 N Y N 89.230 -5.124 -13.322 -1.183 0.142 2.828 HXT SER 14 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal SER N CA SING N N 1 SER N H SING N N 2 SER N H2 SING N N 3 SER CA C SING N N 4 SER CA CB SING N N 5 SER CA HA SING N N 6 SER C O DOUB N N 7 SER C OXT SING N N 8 SER CB OG SING N N 9 SER CB HB2 SING N N 10 SER CB HB3 SING N N 11 SER OG HG SING N N 12 SER OXT HXT SING N N 13 # loop_ _pdbx_chem_comp_descriptor.comp_id _pdbx_chem_comp_descriptor.type _pdbx_chem_comp_descriptor.program _pdbx_chem_comp_descriptor.program_version _pdbx_chem_comp_descriptor.descriptor SER SMILES ACDLabs 10.04 "O=C(O)C(N)CO" SER SMILES_CANONICAL CACTVS 3.341 "N[C@@H](CO)C(O)=O" SER SMILES CACTVS 3.341 "N[CH](CO)C(O)=O" SER SMILES_CANONICAL "OpenEye OEToolkits" 1.5.0 "C([C@@H](C(=O)O)N)O" SER SMILES "OpenEye OEToolkits" 1.5.0 "C(C(C(=O)O)N)O" SER InChI InChI 1.03 "InChI=1S/C3H7NO3/c4-2(1-5)3(6)7/h2,5H,1,4H2,(H,6,7)/t2-/m0/s1" SER InChIKey InChI 1.03 MTCFGRXMJLQNBG-REOHCLBHSA-N # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier SER "SYSTEMATIC NAME" ACDLabs 10.04 L-serine SER "SYSTEMATIC NAME" "OpenEye OEToolkits" 1.5.0 "(2S)-2-amino-3-hydroxy-propanoic acid" # loop_ _pdbx_chem_comp_audit.comp_id _pdbx_chem_comp_audit.action_type _pdbx_chem_comp_audit.date _pdbx_chem_comp_audit.processing_site SER "Create component" 1999-07-08 RCSB SER "Modify descriptor" 2011-06-04 RCSB # data_THR # _chem_comp.id THR _chem_comp.name THREONINE _chem_comp.type "L-PEPTIDE LINKING" _chem_comp.pdbx_type ATOMP _chem_comp.formula "C4 H9 N O3" _chem_comp.mon_nstd_parent_comp_id ? _chem_comp.pdbx_synonyms ? _chem_comp.pdbx_formal_charge 0 _chem_comp.pdbx_initial_date 1999-07-08 _chem_comp.pdbx_modified_date 2011-06-04 _chem_comp.pdbx_ambiguous_flag N _chem_comp.pdbx_release_status REL _chem_comp.pdbx_replaced_by ? _chem_comp.pdbx_replaces ? _chem_comp.formula_weight 119.119 _chem_comp.one_letter_code T _chem_comp.three_letter_code THR _chem_comp.pdbx_model_coordinates_details ? _chem_comp.pdbx_model_coordinates_missing_flag N _chem_comp.pdbx_ideal_coordinates_details ? _chem_comp.pdbx_ideal_coordinates_missing_flag N _chem_comp.pdbx_model_coordinates_db_code ? _chem_comp.pdbx_subcomponent_list ? _chem_comp.pdbx_processing_site EBI # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.alt_atom_id _chem_comp_atom.type_symbol _chem_comp_atom.charge _chem_comp_atom.pdbx_align _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_leaving_atom_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.model_Cartn_x _chem_comp_atom.model_Cartn_y _chem_comp_atom.model_Cartn_z _chem_comp_atom.pdbx_model_Cartn_x_ideal _chem_comp_atom.pdbx_model_Cartn_y_ideal _chem_comp_atom.pdbx_model_Cartn_z_ideal _chem_comp_atom.pdbx_component_atom_id _chem_comp_atom.pdbx_component_comp_id _chem_comp_atom.pdbx_ordinal THR N N N 0 1 N N N 36.241 32.034 31.861 1.543 -0.702 0.430 N THR 1 THR CA CA C 0 1 N N S 35.010 31.223 31.876 0.122 -0.706 0.056 CA THR 2 THR C C C 0 1 N N N 35.213 30.209 30.769 -0.038 -0.090 -1.309 C THR 3 THR O O O 0 1 N N N 35.564 30.621 29.635 0.732 0.761 -1.683 O THR 4 THR CB CB C 0 1 N N R 33.755 32.073 31.570 -0.675 0.104 1.079 CB THR 5 THR OG1 OG1 O 0 1 N N N 33.730 33.235 32.412 -0.193 1.448 1.103 OG1 THR 6 THR CG2 CG2 C 0 1 N N N 32.482 31.262 31.863 -0.511 -0.521 2.466 CG2 THR 7 THR OXT OXT O 0 1 N Y N 35.042 29.014 31.057 -1.039 -0.488 -2.110 OXT THR 8 THR H H H 0 1 N N N 36.104 32.716 32.606 1.839 0.261 0.434 H THR 9 THR H2 HN2 H 0 1 N Y N 36.457 32.445 30.953 1.593 -1.025 1.385 H2 THR 10 THR HA HA H 0 1 N N N 34.842 30.763 32.878 -0.245 -1.732 0.038 HA THR 11 THR HB HB H 0 1 N N N 33.792 32.367 30.495 -1.729 0.101 0.802 HB THR 12 THR HG1 HG1 H 0 1 N N N 32.959 33.757 32.224 0.740 1.406 1.352 HG1 THR 13 THR HG21 1HG2 H 0 0 N N N 31.577 31.874 31.642 -1.080 0.056 3.194 HG21 THR 14 THR HG22 2HG2 H 0 0 N N N 32.471 30.290 31.315 -0.879 -1.547 2.448 HG22 THR 15 THR HG23 3HG2 H 0 0 N N N 32.471 30.863 32.904 0.542 -0.518 2.743 HG23 THR 16 THR HXT HXT H 0 1 N Y N 35.169 28.378 30.362 -1.143 -0.092 -2.986 HXT THR 17 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal THR N CA SING N N 1 THR N H SING N N 2 THR N H2 SING N N 3 THR CA C SING N N 4 THR CA CB SING N N 5 THR CA HA SING N N 6 THR C O DOUB N N 7 THR C OXT SING N N 8 THR CB OG1 SING N N 9 THR CB CG2 SING N N 10 THR CB HB SING N N 11 THR OG1 HG1 SING N N 12 THR CG2 HG21 SING N N 13 THR CG2 HG22 SING N N 14 THR CG2 HG23 SING N N 15 THR OXT HXT SING N N 16 # loop_ _pdbx_chem_comp_descriptor.comp_id _pdbx_chem_comp_descriptor.type _pdbx_chem_comp_descriptor.program _pdbx_chem_comp_descriptor.program_version _pdbx_chem_comp_descriptor.descriptor THR SMILES ACDLabs 10.04 "O=C(O)C(N)C(O)C" THR SMILES_CANONICAL CACTVS 3.341 "C[C@@H](O)[C@H](N)C(O)=O" THR SMILES CACTVS 3.341 "C[CH](O)[CH](N)C(O)=O" THR SMILES_CANONICAL "OpenEye OEToolkits" 1.5.0 "C[C@H]([C@@H](C(=O)O)N)O" THR SMILES "OpenEye OEToolkits" 1.5.0 "CC(C(C(=O)O)N)O" THR InChI InChI 1.03 "InChI=1S/C4H9NO3/c1-2(6)3(5)4(7)8/h2-3,6H,5H2,1H3,(H,7,8)/t2-,3+/m1/s1" THR InChIKey InChI 1.03 AYFVYJQAPQTCCC-GBXIJSLDSA-N # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier THR "SYSTEMATIC NAME" ACDLabs 10.04 L-threonine THR "SYSTEMATIC NAME" "OpenEye OEToolkits" 1.5.0 "(2S,3R)-2-amino-3-hydroxy-butanoic acid" # loop_ _pdbx_chem_comp_audit.comp_id _pdbx_chem_comp_audit.action_type _pdbx_chem_comp_audit.date _pdbx_chem_comp_audit.processing_site THR "Create component" 1999-07-08 EBI THR "Modify descriptor" 2011-06-04 RCSB # data_TRP # _chem_comp.id TRP _chem_comp.name TRYPTOPHAN _chem_comp.type "L-PEPTIDE LINKING" _chem_comp.pdbx_type ATOMP _chem_comp.formula "C11 H12 N2 O2" _chem_comp.mon_nstd_parent_comp_id ? _chem_comp.pdbx_synonyms ? _chem_comp.pdbx_formal_charge 0 _chem_comp.pdbx_initial_date 1999-07-08 _chem_comp.pdbx_modified_date 2011-06-04 _chem_comp.pdbx_ambiguous_flag N _chem_comp.pdbx_release_status REL _chem_comp.pdbx_replaced_by ? _chem_comp.pdbx_replaces LTR _chem_comp.formula_weight 204.225 _chem_comp.one_letter_code W _chem_comp.three_letter_code TRP _chem_comp.pdbx_model_coordinates_details ? _chem_comp.pdbx_model_coordinates_missing_flag N _chem_comp.pdbx_ideal_coordinates_details ? _chem_comp.pdbx_ideal_coordinates_missing_flag N _chem_comp.pdbx_model_coordinates_db_code ? _chem_comp.pdbx_subcomponent_list ? _chem_comp.pdbx_processing_site EBI # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.alt_atom_id _chem_comp_atom.type_symbol _chem_comp_atom.charge _chem_comp_atom.pdbx_align _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_leaving_atom_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.model_Cartn_x _chem_comp_atom.model_Cartn_y _chem_comp_atom.model_Cartn_z _chem_comp_atom.pdbx_model_Cartn_x_ideal _chem_comp_atom.pdbx_model_Cartn_y_ideal _chem_comp_atom.pdbx_model_Cartn_z_ideal _chem_comp_atom.pdbx_component_atom_id _chem_comp_atom.pdbx_component_comp_id _chem_comp_atom.pdbx_ordinal TRP N N N 0 1 N N N 74.708 60.512 32.843 1.278 1.121 2.059 N TRP 1 TRP CA CA C 0 1 N N S 74.400 61.735 32.114 -0.008 0.417 1.970 CA TRP 2 TRP C C C 0 1 N N N 73.588 61.411 30.840 -0.490 0.076 3.357 C TRP 3 TRP O O O 0 1 N N N 72.939 62.292 30.277 0.308 -0.130 4.240 O TRP 4 TRP CB CB C 0 1 N N N 75.684 62.473 31.706 0.168 -0.868 1.161 CB TRP 5 TRP CG CG C 0 1 Y N N 76.675 62.727 32.832 0.650 -0.526 -0.225 CG TRP 6 TRP CD1 CD1 C 0 1 Y N N 77.753 61.964 33.157 1.928 -0.418 -0.622 CD1 TRP 7 TRP CD2 CD2 C 0 1 Y N N 76.646 63.805 33.777 -0.186 -0.256 -1.396 CD2 TRP 8 TRP NE1 NE1 N 0 1 Y N N 78.403 62.494 34.247 1.978 -0.095 -1.951 NE1 TRP 9 TRP CE2 CE2 C 0 1 Y N N 77.741 63.625 34.650 0.701 0.014 -2.454 CE2 TRP 10 TRP CE3 CE3 C 0 1 Y N N 75.796 64.902 33.974 -1.564 -0.210 -1.615 CE3 TRP 11 TRP CZ2 CZ2 C 0 1 Y N N 78.014 64.499 35.709 0.190 0.314 -3.712 CZ2 TRP 12 TRP CZ3 CZ3 C 0 1 Y N N 76.065 65.776 35.031 -2.044 0.086 -2.859 CZ3 TRP 13 TRP CH2 CH2 C 0 1 Y N N 77.168 65.565 35.884 -1.173 0.348 -3.907 CH2 TRP 14 TRP OXT OXT O 0 1 N Y N 73.495 60.470 30.438 -1.806 0.001 3.610 OXT TRP 15 TRP H H H 0 1 N N N 75.244 60.725 33.684 1.921 0.493 2.518 H TRP 16 TRP H2 HN2 H 0 1 N Y N 75.182 59.827 32.253 1.611 1.237 1.113 H2 TRP 17 TRP HA HA H 0 1 N N N 73.801 62.387 32.790 -0.740 1.058 1.479 HA TRP 18 TRP HB2 1HB H 0 1 N N N 76.185 61.933 30.869 0.900 -1.509 1.652 HB2 TRP 19 TRP HB3 2HB H 0 1 N N N 75.429 63.431 31.197 -0.786 -1.390 1.095 HB3 TRP 20 TRP HD1 HD1 H 0 1 N N N 78.055 61.051 32.616 2.789 -0.564 0.012 HD1 TRP 21 TRP HE1 HE1 H 0 1 N N N 79.240 62.110 34.685 2.791 0.036 -2.462 HE1 TRP 22 TRP HE3 HE3 H 0 1 N N N 74.932 65.074 33.310 -2.248 -0.413 -0.804 HE3 TRP 23 TRP HZ2 HZ2 H 0 1 N N N 78.871 64.351 36.386 0.860 0.521 -4.534 HZ2 TRP 24 TRP HZ3 HZ3 H 0 1 N N N 75.400 66.641 35.193 -3.110 0.116 -3.029 HZ3 TRP 25 TRP HH2 HH2 H 0 1 N N N 77.376 66.257 36.716 -1.567 0.582 -4.885 HH2 TRP 26 TRP HXT HXT H 0 1 N Y N 72.995 60.270 29.654 -2.115 -0.217 4.500 HXT TRP 27 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal TRP N CA SING N N 1 TRP N H SING N N 2 TRP N H2 SING N N 3 TRP CA C SING N N 4 TRP CA CB SING N N 5 TRP CA HA SING N N 6 TRP C O DOUB N N 7 TRP C OXT SING N N 8 TRP CB CG SING N N 9 TRP CB HB2 SING N N 10 TRP CB HB3 SING N N 11 TRP CG CD1 DOUB Y N 12 TRP CG CD2 SING Y N 13 TRP CD1 NE1 SING Y N 14 TRP CD1 HD1 SING N N 15 TRP CD2 CE2 DOUB Y N 16 TRP CD2 CE3 SING Y N 17 TRP NE1 CE2 SING Y N 18 TRP NE1 HE1 SING N N 19 TRP CE2 CZ2 SING Y N 20 TRP CE3 CZ3 DOUB Y N 21 TRP CE3 HE3 SING N N 22 TRP CZ2 CH2 DOUB Y N 23 TRP CZ2 HZ2 SING N N 24 TRP CZ3 CH2 SING Y N 25 TRP CZ3 HZ3 SING N N 26 TRP CH2 HH2 SING N N 27 TRP OXT HXT SING N N 28 # loop_ _pdbx_chem_comp_descriptor.comp_id _pdbx_chem_comp_descriptor.type _pdbx_chem_comp_descriptor.program _pdbx_chem_comp_descriptor.program_version _pdbx_chem_comp_descriptor.descriptor TRP SMILES ACDLabs 10.04 "O=C(O)C(N)Cc2c1ccccc1nc2" TRP SMILES_CANONICAL CACTVS 3.341 "N[C@@H](Cc1c[nH]c2ccccc12)C(O)=O" TRP SMILES CACTVS 3.341 "N[CH](Cc1c[nH]c2ccccc12)C(O)=O" TRP SMILES_CANONICAL "OpenEye OEToolkits" 1.5.0 "c1ccc2c(c1)c(c[nH]2)C[C@@H](C(=O)O)N" TRP SMILES "OpenEye OEToolkits" 1.5.0 "c1ccc2c(c1)c(c[nH]2)CC(C(=O)O)N" TRP InChI InChI 1.03 "InChI=1S/C11H12N2O2/c12-9(11(14)15)5-7-6-13-10-4-2-1-3-8(7)10/h1-4,6,9,13H,5,12H2,(H,14,15)/t9-/m0/s1" TRP InChIKey InChI 1.03 QIVBCDIJIAJPQS-VIFPVBQESA-N # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier TRP "SYSTEMATIC NAME" ACDLabs 10.04 L-tryptophan TRP "SYSTEMATIC NAME" "OpenEye OEToolkits" 1.5.0 "(2S)-2-amino-3-(1H-indol-3-yl)propanoic acid" # loop_ _pdbx_chem_comp_audit.comp_id _pdbx_chem_comp_audit.action_type _pdbx_chem_comp_audit.date _pdbx_chem_comp_audit.processing_site TRP "Create component" 1999-07-08 EBI TRP "Modify descriptor" 2011-06-04 RCSB # data_TYR # _chem_comp.id TYR _chem_comp.name TYROSINE _chem_comp.type "L-PEPTIDE LINKING" _chem_comp.pdbx_type ATOMP _chem_comp.formula "C9 H11 N O3" _chem_comp.mon_nstd_parent_comp_id ? _chem_comp.pdbx_synonyms ? _chem_comp.pdbx_formal_charge 0 _chem_comp.pdbx_initial_date 1999-07-08 _chem_comp.pdbx_modified_date 2011-06-04 _chem_comp.pdbx_ambiguous_flag N _chem_comp.pdbx_release_status REL _chem_comp.pdbx_replaced_by ? _chem_comp.pdbx_replaces ? _chem_comp.formula_weight 181.189 _chem_comp.one_letter_code Y _chem_comp.three_letter_code TYR _chem_comp.pdbx_model_coordinates_details ? _chem_comp.pdbx_model_coordinates_missing_flag N _chem_comp.pdbx_ideal_coordinates_details ? _chem_comp.pdbx_ideal_coordinates_missing_flag N _chem_comp.pdbx_model_coordinates_db_code ? _chem_comp.pdbx_subcomponent_list ? _chem_comp.pdbx_processing_site EBI # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.alt_atom_id _chem_comp_atom.type_symbol _chem_comp_atom.charge _chem_comp_atom.pdbx_align _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_leaving_atom_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.model_Cartn_x _chem_comp_atom.model_Cartn_y _chem_comp_atom.model_Cartn_z _chem_comp_atom.pdbx_model_Cartn_x_ideal _chem_comp_atom.pdbx_model_Cartn_y_ideal _chem_comp_atom.pdbx_model_Cartn_z_ideal _chem_comp_atom.pdbx_component_atom_id _chem_comp_atom.pdbx_component_comp_id _chem_comp_atom.pdbx_ordinal TYR N N N 0 1 N N N 5.005 5.256 15.563 1.320 0.952 1.428 N TYR 1 TYR CA CA C 0 1 N N S 5.326 6.328 16.507 -0.018 0.429 1.734 CA TYR 2 TYR C C C 0 1 N N N 4.742 7.680 16.116 -0.103 0.094 3.201 C TYR 3 TYR O O O 0 1 N N N 4.185 8.411 16.947 0.886 -0.254 3.799 O TYR 4 TYR CB CB C 0 1 N N N 6.836 6.389 16.756 -0.274 -0.831 0.907 CB TYR 5 TYR CG CG C 0 1 Y N N 7.377 5.438 17.795 -0.189 -0.496 -0.559 CG TYR 6 TYR CD1 CD1 C 0 1 Y N N 6.826 5.370 19.075 1.022 -0.589 -1.219 CD1 TYR 7 TYR CD2 CD2 C 0 1 Y N N 8.493 4.624 17.565 -1.324 -0.102 -1.244 CD2 TYR 8 TYR CE1 CE1 C 0 1 Y N N 7.308 4.536 20.061 1.103 -0.282 -2.563 CE1 TYR 9 TYR CE2 CE2 C 0 1 Y N N 9.029 3.816 18.552 -1.247 0.210 -2.587 CE2 TYR 10 TYR CZ CZ C 0 1 Y N N 8.439 3.756 19.805 -0.032 0.118 -3.252 CZ TYR 11 TYR OH OH O 0 1 N N N 8.954 2.936 20.781 0.044 0.420 -4.574 OH TYR 12 TYR OXT OXT O 0 1 N Y N 4.840 8.051 14.829 -1.279 0.184 3.842 OXT TYR 13 TYR H H H 0 1 N N N 5.621 4.925 15.064 1.977 0.225 1.669 H TYR 14 TYR H2 HN2 H 0 1 N Y N 5.288 5.511 14.617 1.365 1.063 0.426 H2 TYR 15 TYR HA HA H 0 1 N N N 4.913 6.081 17.361 -0.767 1.183 1.489 HA TYR 16 TYR HB2 1HB H 0 1 N N N 7.289 6.213 15.916 0.473 -1.585 1.152 HB2 TYR 17 TYR HB3 2HB H 0 1 N N N 7.063 7.294 17.023 -1.268 -1.219 1.134 HB3 TYR 18 TYR HD1 HD1 H 0 1 N N N 6.097 5.913 19.272 1.905 -0.902 -0.683 HD1 TYR 19 TYR HD2 HD2 H 0 1 N N N 8.887 4.627 16.723 -2.269 -0.031 -0.727 HD2 TYR 20 TYR HE1 HE1 H 0 1 N N N 6.886 4.493 20.888 2.049 -0.354 -3.078 HE1 TYR 21 TYR HE2 HE2 H 0 1 N N N 9.788 3.310 18.373 -2.132 0.523 -3.121 HE2 TYR 22 TYR HH HH H 0 1 N N N 8.500 3.001 21.460 -0.123 -0.399 -5.059 HH TYR 23 TYR HXT HXT H 0 1 N Y N 4.475 8.893 14.585 -1.333 -0.030 4.784 HXT TYR 24 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal TYR N CA SING N N 1 TYR N H SING N N 2 TYR N H2 SING N N 3 TYR CA C SING N N 4 TYR CA CB SING N N 5 TYR CA HA SING N N 6 TYR C O DOUB N N 7 TYR C OXT SING N N 8 TYR CB CG SING N N 9 TYR CB HB2 SING N N 10 TYR CB HB3 SING N N 11 TYR CG CD1 DOUB Y N 12 TYR CG CD2 SING Y N 13 TYR CD1 CE1 SING Y N 14 TYR CD1 HD1 SING N N 15 TYR CD2 CE2 DOUB Y N 16 TYR CD2 HD2 SING N N 17 TYR CE1 CZ DOUB Y N 18 TYR CE1 HE1 SING N N 19 TYR CE2 CZ SING Y N 20 TYR CE2 HE2 SING N N 21 TYR CZ OH SING N N 22 TYR OH HH SING N N 23 TYR OXT HXT SING N N 24 # loop_ _pdbx_chem_comp_descriptor.comp_id _pdbx_chem_comp_descriptor.type _pdbx_chem_comp_descriptor.program _pdbx_chem_comp_descriptor.program_version _pdbx_chem_comp_descriptor.descriptor TYR SMILES ACDLabs 10.04 "O=C(O)C(N)Cc1ccc(O)cc1" TYR SMILES_CANONICAL CACTVS 3.341 "N[C@@H](Cc1ccc(O)cc1)C(O)=O" TYR SMILES CACTVS 3.341 "N[CH](Cc1ccc(O)cc1)C(O)=O" TYR SMILES_CANONICAL "OpenEye OEToolkits" 1.5.0 "c1cc(ccc1C[C@@H](C(=O)O)N)O" TYR SMILES "OpenEye OEToolkits" 1.5.0 "c1cc(ccc1CC(C(=O)O)N)O" TYR InChI InChI 1.03 "InChI=1S/C9H11NO3/c10-8(9(12)13)5-6-1-3-7(11)4-2-6/h1-4,8,11H,5,10H2,(H,12,13)/t8-/m0/s1" TYR InChIKey InChI 1.03 OUYCCCASQSFEME-QMMMGPOBSA-N # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier TYR "SYSTEMATIC NAME" ACDLabs 10.04 L-tyrosine TYR "SYSTEMATIC NAME" "OpenEye OEToolkits" 1.5.0 "(2S)-2-amino-3-(4-hydroxyphenyl)propanoic acid" # loop_ _pdbx_chem_comp_audit.comp_id _pdbx_chem_comp_audit.action_type _pdbx_chem_comp_audit.date _pdbx_chem_comp_audit.processing_site TYR "Create component" 1999-07-08 EBI TYR "Modify descriptor" 2011-06-04 RCSB # data_VAL # _chem_comp.id VAL _chem_comp.name VALINE _chem_comp.type "L-PEPTIDE LINKING" _chem_comp.pdbx_type ATOMP _chem_comp.formula "C5 H11 N O2" _chem_comp.mon_nstd_parent_comp_id ? _chem_comp.pdbx_synonyms ? _chem_comp.pdbx_formal_charge 0 _chem_comp.pdbx_initial_date 1999-07-08 _chem_comp.pdbx_modified_date 2011-06-04 _chem_comp.pdbx_ambiguous_flag N _chem_comp.pdbx_release_status REL _chem_comp.pdbx_replaced_by ? _chem_comp.pdbx_replaces ? _chem_comp.formula_weight 117.146 _chem_comp.one_letter_code V _chem_comp.three_letter_code VAL _chem_comp.pdbx_model_coordinates_details ? _chem_comp.pdbx_model_coordinates_missing_flag N _chem_comp.pdbx_ideal_coordinates_details ? _chem_comp.pdbx_ideal_coordinates_missing_flag N _chem_comp.pdbx_model_coordinates_db_code ? _chem_comp.pdbx_subcomponent_list ? _chem_comp.pdbx_processing_site RCSB # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.alt_atom_id _chem_comp_atom.type_symbol _chem_comp_atom.charge _chem_comp_atom.pdbx_align _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_leaving_atom_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.model_Cartn_x _chem_comp_atom.model_Cartn_y _chem_comp_atom.model_Cartn_z _chem_comp_atom.pdbx_model_Cartn_x_ideal _chem_comp_atom.pdbx_model_Cartn_y_ideal _chem_comp_atom.pdbx_model_Cartn_z_ideal _chem_comp_atom.pdbx_component_atom_id _chem_comp_atom.pdbx_component_comp_id _chem_comp_atom.pdbx_ordinal VAL N N N 0 1 N N N 11.009 2.661 48.464 1.564 -0.642 0.454 N VAL 1 VAL CA CA C 0 1 N N S 10.415 3.985 48.550 0.145 -0.698 0.079 CA VAL 2 VAL C C C 0 1 N N N 10.002 4.429 49.975 -0.037 -0.093 -1.288 C VAL 3 VAL O O O 0 1 N N N 9.312 3.707 50.680 0.703 0.784 -1.664 O VAL 4 VAL CB CB C 0 1 N N N 9.230 4.107 47.566 -0.682 0.086 1.098 CB VAL 5 VAL CG1 CG1 C 0 1 N N N 8.585 5.457 47.708 -0.497 -0.528 2.487 CG1 VAL 6 VAL CG2 CG2 C 0 1 N N N 9.689 3.877 46.132 -0.218 1.543 1.119 CG2 VAL 7 VAL OXT OXT O 0 1 N Y N 10.377 5.639 50.362 -1.022 -0.529 -2.089 OXT VAL 8 VAL H H H 0 1 N N N 11.281 2.368 47.525 1.825 0.332 0.455 H VAL 9 VAL H2 HN2 H 0 1 N Y N 10.386 1.968 48.881 1.624 -0.959 1.410 H2 VAL 10 VAL HA HA H 0 1 N N N 11.226 4.692 48.259 -0.186 -1.736 0.064 HA VAL 11 VAL HB HB H 0 1 N N N 8.478 3.321 47.813 -1.736 0.044 0.820 HB VAL 12 VAL HG11 1HG1 H 0 0 N N N 7.729 5.545 46.997 -1.087 0.031 3.214 HG11 VAL 13 VAL HG12 2HG1 H 0 0 N N N 8.279 5.666 48.759 -0.828 -1.566 2.472 HG12 VAL 14 VAL HG13 3HG1 H 0 0 N N N 9.319 6.287 47.584 0.555 -0.486 2.765 HG13 VAL 15 VAL HG21 1HG2 H 0 0 N N N 8.833 3.965 45.421 0.835 1.585 1.397 HG21 VAL 16 VAL HG22 2HG2 H 0 0 N N N 10.527 4.557 45.853 -0.350 1.981 0.130 HG22 VAL 17 VAL HG23 3HG2 H 0 0 N N N 10.218 2.902 46.020 -0.808 2.103 1.845 HG23 VAL 18 VAL HXT HXT H 0 1 N Y N 10.123 5.911 51.236 -1.139 -0.140 -2.967 HXT VAL 19 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal VAL N CA SING N N 1 VAL N H SING N N 2 VAL N H2 SING N N 3 VAL CA C SING N N 4 VAL CA CB SING N N 5 VAL CA HA SING N N 6 VAL C O DOUB N N 7 VAL C OXT SING N N 8 VAL CB CG1 SING N N 9 VAL CB CG2 SING N N 10 VAL CB HB SING N N 11 VAL CG1 HG11 SING N N 12 VAL CG1 HG12 SING N N 13 VAL CG1 HG13 SING N N 14 VAL CG2 HG21 SING N N 15 VAL CG2 HG22 SING N N 16 VAL CG2 HG23 SING N N 17 VAL OXT HXT SING N N 18 # loop_ _pdbx_chem_comp_descriptor.comp_id _pdbx_chem_comp_descriptor.type _pdbx_chem_comp_descriptor.program _pdbx_chem_comp_descriptor.program_version _pdbx_chem_comp_descriptor.descriptor VAL SMILES ACDLabs 10.04 "O=C(O)C(N)C(C)C" VAL SMILES_CANONICAL CACTVS 3.341 "CC(C)[C@H](N)C(O)=O" VAL SMILES CACTVS 3.341 "CC(C)[CH](N)C(O)=O" VAL SMILES_CANONICAL "OpenEye OEToolkits" 1.5.0 "CC(C)[C@@H](C(=O)O)N" VAL SMILES "OpenEye OEToolkits" 1.5.0 "CC(C)C(C(=O)O)N" VAL InChI InChI 1.03 "InChI=1S/C5H11NO2/c1-3(2)4(6)5(7)8/h3-4H,6H2,1-2H3,(H,7,8)/t4-/m0/s1" VAL InChIKey InChI 1.03 KZSNJWFQEVHDMF-BYPYZUCNSA-N # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier VAL "SYSTEMATIC NAME" ACDLabs 10.04 L-valine VAL "SYSTEMATIC NAME" "OpenEye OEToolkits" 1.5.0 "(2S)-2-amino-3-methyl-butanoic acid" # loop_ _pdbx_chem_comp_audit.comp_id _pdbx_chem_comp_audit.action_type _pdbx_chem_comp_audit.date _pdbx_chem_comp_audit.processing_site VAL "Create component" 1999-07-08 RCSB VAL "Modify descriptor" 2011-06-04 RCSB # data_HOH # _chem_comp.id HOH _chem_comp.name WATER _chem_comp.type NON-POLYMER _chem_comp.pdbx_type HETAS _chem_comp.formula "H2 O" _chem_comp.mon_nstd_parent_comp_id ? _chem_comp.pdbx_synonyms ? _chem_comp.pdbx_formal_charge 0 _chem_comp.pdbx_initial_date 1999-07-08 _chem_comp.pdbx_modified_date 2011-06-04 _chem_comp.pdbx_ambiguous_flag N _chem_comp.pdbx_release_status REL _chem_comp.pdbx_replaced_by ? _chem_comp.pdbx_replaces MTO _chem_comp.formula_weight 18.015 _chem_comp.one_letter_code ? _chem_comp.three_letter_code HOH _chem_comp.pdbx_model_coordinates_details ? _chem_comp.pdbx_model_coordinates_missing_flag N _chem_comp.pdbx_ideal_coordinates_details ? _chem_comp.pdbx_ideal_coordinates_missing_flag N _chem_comp.pdbx_model_coordinates_db_code 1NHE _chem_comp.pdbx_subcomponent_list ? _chem_comp.pdbx_processing_site RCSB # # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.alt_atom_id _chem_comp_atom.type_symbol _chem_comp_atom.charge _chem_comp_atom.pdbx_align _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_leaving_atom_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.model_Cartn_x _chem_comp_atom.model_Cartn_y _chem_comp_atom.model_Cartn_z _chem_comp_atom.pdbx_model_Cartn_x_ideal _chem_comp_atom.pdbx_model_Cartn_y_ideal _chem_comp_atom.pdbx_model_Cartn_z_ideal _chem_comp_atom.pdbx_component_atom_id _chem_comp_atom.pdbx_component_comp_id _chem_comp_atom.pdbx_ordinal HOH O O O 0 1 N N N -23.107 18.401 -21.626 -0.064 0.000 0.000 O HOH 1 HOH H1 1H H 0 1 N N N -22.157 18.401 -21.626 0.512 0.000 -0.776 H1 HOH 2 HOH H2 2H H 0 1 N N N -23.424 18.401 -20.730 0.512 0.000 0.776 H2 HOH 3 # # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal HOH O H1 SING N N 1 HOH O H2 SING N N 2 # # loop_ _pdbx_chem_comp_descriptor.comp_id _pdbx_chem_comp_descriptor.type _pdbx_chem_comp_descriptor.program _pdbx_chem_comp_descriptor.program_version _pdbx_chem_comp_descriptor.descriptor HOH SMILES ACDLabs 10.04 O HOH SMILES_CANONICAL CACTVS 3.341 O HOH SMILES CACTVS 3.341 O HOH SMILES_CANONICAL "OpenEye OEToolkits" 1.5.0 O HOH SMILES "OpenEye OEToolkits" 1.5.0 O HOH InChI InChI 1.03 InChI=1S/H2O/h1H2 HOH InChIKey InChI 1.03 XLYOFNOQVPJJNP-UHFFFAOYSA-N # # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier HOH "SYSTEMATIC NAME" ACDLabs 10.04 water HOH "SYSTEMATIC NAME" "OpenEye OEToolkits" 1.5.0 oxidane # # loop_ _pdbx_chem_comp_audit.comp_id _pdbx_chem_comp_audit.action_type _pdbx_chem_comp_audit.date _pdbx_chem_comp_audit.processing_site HOH "Create component" 1999-07-08 RCSB HOH "Modify descriptor" 2011-06-04 RCSB ## PDB-REDO-dssp-ca06797/test/pdb1cbs.ent.gz000066400000000000000000000715001516741327300176170ustar00rootroot00000000000000Ipdb1cbs.ent̜Y8+2T2X^9 c"/b @ۧJwbDA*DgynyG*xV"ËR i+w?Uq2,.eRV9΅ "I /,@FNE^8+ILx8&qF<=%⃼Ց$Jѷ L-I᤼d>6BEr_PLޓ8z%*,!QD{N鹺oHu9 o@Gg?IBgB}{e~.B'a d$/d6mmVHؙ͝u$am6]I adtgY̸f6}t91;gZ |M'N0taN5AK`=f`0P]1й>pJ2t]  Y&VAöCƶ̷nVm߸k!PFsvFڰTc!6A8N8a?=|tgwׁZf._ts@(n*K =6yAuܔ j*y{Jn<5pWO$>$0 >A% @LpGgiMw a.6*kKR@+ylm仲fZ^> TK?!_eB``,Lfb>d0D%-aTc="/OH/U07u2!Ց tAJ?uw6Ѩd`+, E-䔲Ƒ:~yT_yDd8^h ۤzqDX=\-I"QDU>y\8r<բj˝0+RhzG"Ykj )ayLnRv(뻈^Kx(I՜2bTgEJ逻m$}߯/x3ɮk*?I~tϸ4`Q, ,C9S+rzCp2t8XBVǸ$uŅyIvFVCQBv$"P|@eDaGT;뒽 aR ?y.4+|Hl`M&we}Z9g\df׻*IDZ s3]Tv@RI`g9v"D,p5~Mw&(ij%ˮH8ؿ`ظ KS [`ʳ36vz}r3.[|u(WX9i?%!2\~d~ "آ]#4BD,Yx~T;@+wK:6F_ه\T__/b9iΡ6 XZ-1 ;zG [NIaOf:7Ws=G`J[.m ئvD޹SVh\D)s:;͓O6Kaub!oX"Ay%m|c ,Z~'ˁ~b}gM_чIKHJj% ̉R.)w1I։a,gS_ɉ0Zwk1S, KHxZ$)+l/Z psQGvZk|? Rkozxh93%*RpMAG{ȯ@|<H~}=W,,R6%PDg8&ˑDnjh}k20Q|"ǔe+ud <^)|uS>§u Tq*$< S7,fLu~m2< O8ȓ7#"HjW$lYNBk拓>`HP:gq>ީ)m/?2km'qAz up9su`|%8=Δn8]|HB;8fAxP:3ZWco8~ Io$6SBw9C"jD\S$>_7!f/"R*Pc[tc ϷO6vWrAԹ*c^hH_OeGuhloqjjh$D{@WxrECrP%-ulmyy`svۖRk1%: pd L? t e_Kݐ#dVK0lKX"'Jn|o^du P(%c.ݷ7H x֔kJ%FCp80dLLp܍=hKJ=y-Uʲ$5d<|H1kbLY!aDl׻ng/b*z:wg!PG+}:o׉dwI2,k{L쌽zF= AySkȟ}(1$š~<d-'쑯K5~c yJHA}l$oF7"XVTB~f@ ()]qh|Y=@W* /m?m=,:5}}*' n44w@_P xׂI ~,PƌA&S67I 7&5+e+&4, k1w}: pI`VO|"K8|:/ZLBBf#=Rv@K(BP|92On"?𕚮\ V fUA|_r,< gSS \_+LnZDtu!ׇ?]gh@ 4qJ`N!)]e% `=ʀwZ@JGљZ UwP*`S@*c4hZH{!$ӔBMm4*Z4o$Tֲ21\w 4|բ/6OˣD}|i7M3_WJSRYIiuW>]ۻ8; k,bʝZ ͠-5˽q} r91\餶g83\GjP=Y?E|~Ե.2k'jZf40݇,&K{W-0ocM nsQ/6ܤ% mC¾c5~4 ;coP4Om_+0@- 븘ӟvt '2r;u ԅ&Mk@hOp `mµ.!'7Y7@LX MN) l1c U @>d tf*̰MC 4Y#!GslS4/vJ,J,f3a)elNHzN3zkUYڧӧ5AKU͓`n =4Z+I*֧uWԶU!Qfuæ= "@u=\_djjJA#K/c o \o6|aQ!h-m2ͬ,;}tUppa|:>$6O@ñ,u:T ͧ ,:#c =u.CeQUJсSXBߐ'%A Mv}K9X)aۓ@iٚCO^3 &sKocAIf}m]o vW@۵; zC ? EC =f!~U>(/s hlCLt&d9E:>?]Ue]qu%,LVvΰi Η@wU<4Yö10"mmٰ4Q3Rh]*f]#S>bn T J thKPQeF{@/ D(Lf5,-8ڡmR lz.j‚0\CR ġT 8]GlCpٜ=/: ]T  P 3[O-X&/Tn+!DټFX5Y!H詜b(f61h8 @5 #4++m5lf@W`Zs^mm NH%W-/˂s=w}ece&Ce—7])!j,nQ( 4Ywu$(jgĴGΏڗ-[rF+L[c[9fR_3f2 "+$Sy.Cs(/)4}ͽ))un@@+p"6]z-b[.@wq}.;`afV]wKŞjQTwvG+>"pÎ>rsZ& + Qf#Ut}wf)[w6s2/68Ϧ)=ؽs/3&]n%aΡZሒv)`׌iΡZaŦ\ϖCМ9Ԁؔ,ؾ EќC) 3?#s#s):=#sVșuJ$^qRT?Hx"*'r7,\vE\CO09h+|XaeTp)S7&a a؏eE\CO pp8Ai.F/8T$\Oz4s˾]"CLu_oOz*??}r$~â卺C|§ CހPHJ:)!4vtS.Mw8VX'_XMvMR(DZ9aϡl&)8ةpR-oRM``hɜ Mݔ6sdg1p)gޜ&V5ɴks_qVd݀Q'6vI(}{U".QTtGh47>*U_h`MGR wd?É> r8>~`)>W}x}r]s {K{R ]^9Z@aH )CP;g`adAVqyaj760.Ќ6%n>6՗]\rl =I0R6s3Mi6M'.Ba3F9KOF"&@<$Ե՞ùa\}`9sxAAHxv~CǮݞHuȯN0wr>wp^.7$ǶpsoΪ ]IlU L $Z6ATROnў d<|Ya|2I DMˆjt {}r"ZB} C Xl0%M=̴k*6aH/P"*5U+j 8z7m!b+3"w wxKIn/sP>urd /ePaMIiE%T,Yhx0c@ft'7g!ew`K/UvD25?3.cF7~rċM~bqK@H9Ã6n6 :6Ε*]nC 'rR/NEv@5q\i".7! 瓫zzS\oS}=fI<&Eʣ#0~K 9lx_7@Vc*9x_MM̩6}`G5vYp$I ͮ{龇 jSxG7 +M+dFgS|<Ɨ\PqQP i[sjq]7|Lvz9 bJ* v3Z22M꙾zf g&`v>I>?65 p06-?_XplEs9Y P+gnfM)T߫|IQMImlIHF[֥%+,LM"vo@&JfҪ;s xsH D|)/Bg]y}p"OFDqVD\98;i,_.lMH²LEݔL?+,\)P";` 0%ꍢC/uDO@p{UGL[BJQ"'L=#EmNkSRtDulfP4`ظOv\Cs7%EIL&jRǷis`xQ% apzRnz?dDT2=WΙs`ފ$nqOOvFREL)*}Ә|"YB^ER 4|䰢N.*j*ZB)EW$VRG dW#(]IɊ _#S$1Ni(rz-nt9i蟟 R<=}lu;[Ӫ8YzЦ]y>;0gF?q Ņژ9~2#91e<~Za(aE>EGR 5Cހu@c=mFIxD?"xONJb&h6S\XZr|{hUFS\؀dI3jgiǦ$S\P=pX"eQ)=6%?9L6 0WS\P+4 îT*.l@*]Jׇl>6.qcU\X7 "Yrs}yG x]̀HScvyLl@ʊ׃=M"o%N}ؔ'`wr>Fc?\ڴotU ͂0WpꣿR}Nݓ>_ h OH%LZݎ´蟀`V#c5 ] ȪwRq7'Ls'1;o8!>Z8eԼE ö4oY!d`𫖰*~'gy)S"xAJH?A]-_D|([]b1׷~JOR-h&5+n`or&_?9hbyoNB;_ȫR_2Հ,7`R~n? ؔ q ie3OA: QJ>._C)ĦWعvtK2;6PPJ w]&|c\ (Yo4&>OɷUcaxV>k.9ؼjw@J3 $Jj00]>wXU6IH6a G\=6FdWPFBvZqur$$Z)N{#)8}*/'o&!tIh?ua/ |*{o'cdǎvS,k֭;Q 7 ? {h9Tzn>>5餪@FF|h ϫ irEZ?ثx,d<GL\;H'P.uͱY}OF3/e;s"Yrzy? ۚ{ W<*@4PVJɛu`mϣ>6v<=LqP2}0ҺG3 *.ê 3C^Zw7GZ m).3/OBB<vsyi??9+ "Y&MR ҺFvdZ2Z;,1s,`6Պ HD$|PVr8R,`5 Va3 =aJ\2T&Ϲj%> Q i`vwhp,QrIT4 ЕϫF/fM)"M9iደU: Ƒ"/Ȫ?~K}\jw"Bҝ~l<_/=>o.jŵeXr_7@bb |G?;V$n ;M[ ljQ/UwSr_`wcO6RJF@Fh0Mmuꓺp.n,\>)!0:[}R.x_jC Zk&R*y蟀C8lUtͪq-~a"̓t.$P\8B?@:BJ,}{hpKFw,κEŒB׌hd3&U8yQh ]je%+KXm :,p13iZ%8T EFɰ93p"Sj|pΡ~vnHI x4Rn3?C;󦜆FQxW\GzKdRhyI' #cTGiqB$C2F=V83Wsdy_ý裧Qn\aY.w} 'Kؐm5̕8( 镩 ;2&":zO@(Հ2x|_(E0*n(LS QŅ/RWb? :K|:'󼨾 3Z.1jb=\!0Tl=Ö?,`7B0g0a(0L;q*.pgЎ^N%x*.(@,ؔÊ7).OB>A}rWNRGsԂ$%fS\؀e[" ){H+D>=ط'^RVPhZLV_a3@f")/mLުOA˔w ^5J' k _C|f. ?++BJ Qq;\eyɴmk%xȧܢKxecP~.jf{}m&)6Vn&p>X})@v2ޟ|r2l8,Jdy\)6yvC~W&jm؜f,pI3uݹl8dqVq]ͦ,Ѓ7hݔr)prkI'6liգsi(zLtcr)?rAڠI4 o6tOJB]C_!.G2Ʉ+"] |vFlP$ͮ[U)wʝ86EJIХ v#pr9xWJT)Onoְ9-z?Z)(!# ѧ+idD09(Դ$ $IzJYZw@}fɵ+pk< p[ҺV ^5/Һ&f8їutBB1mdnSyi&`/Q|_(|gUW,LW96BvFa{_ɧ"x4 9d̓W <34$}߶ {SV^L E<>vc5`⻌5z&˪3`]Cd10~X16b)!Cj/Q}nM r&o@i"uFhWCuG̣?^̀΍D>>6*{*xSzP\zdڻ"ȷQRM7kh\GX!!f*.HW;GM}cبGZhdw3بR#E_p Na ïT;,1El'̹I4Fx ~>MV9]|$D'ݛ2 n@"F5;=>%4;H Dy q .@˃sY>9'mS|@~Sfpt x>cE.h9UnLd},]pF)).\'R5c"׺O+D]u트\T􋲁l 4{Hl̨/M#!7u\N`7@QԗO"mR x)R(i XD 1 I4(iz| znL H+@ĕf:3m|\J;l fQ\! (+( \|Xa`i=JfQN#O̼/%#|o Xa 2q8Η%^rS|jO*mMn|Y!ݔÝSM`H  BpwNr;I6xŝۀYxT~`[x}?7%d 4Vզ$6݀R|l A3 .sPI ,NiƂ9l@TTp6Ow`) |#R<,kvQvr!xz1h-y-+RQ ؘBR'י8̆c=YM!@ ySLa;KLAX ;%x]pWd^Vq (  xUqa6N;rK0BjWUqA:U.[Oџ ;КC35, HU\X,E.*`Q֝\$G6vr;ژ Q31dɵH1`F ]?>`s3/䬈XϿ?&)_7eLTA{۬P"#(@TsyPKPqKAGCm EJ ڦ#S"Q)7ɧ"WLNΧZQ_v)&EE W̭hV\v)瓡aJ,)2M Jڦ,SgLio6B%p k^~) r;m%I3LM9+vIqy_YG׏M,(aҞ1{A>]w.p7l`k@!Y ~z_.S>; dD]}vWϧ;-ݧ=% < #WOS:C+d<GOeBe"H/hݫ}V!*3ld#ϵ̰g\Y4GsG\ppIqg4:w&4G-ʷqOHQSQr%[lxT_\c?y\fI2_r 9畤38`ڀyTaAR 1sBܸ <6%ǜGe|vC)TS4b%l"*0(QlGDG`A6}QLUKU}7@oR^b~VgU4-FJ7d.FhZ0Hc>Mxaѷu/95QT|7]så2tZwu84j4ZޖsaŠGhx[Z%_YJεPL}fC'p(Z&Ӯ7E) mֺ M8-`eH,})@W ݱI'r74k[X!|yaGmjVOeaZ, 8jZa%uM{.{I /1zC; '-f{Sbd,qs*Twbe<-"(]YVdN3ihD R0q<; Q~J"TVV7k3qNHoF<' pFHDWyO$jIIX pWX!)]ma4)黀KOR0t67`yWmƩVtŋ[5;`cRUU-|W[5'`T Ԣj+jOgX4^E+jO@i,E]&}5-pRpJʾq S)&o*FT%!X52}1ݷȀE+vRd?0s4ʳ(r_n|)U,q8AAC6`fQ :H +^F bU6 V&.7Pؠu˧Bqz+cH}Bt^I+xi*vD .XQ[X%G3FAV:>mQx ٪jG@q\\,.G?)+@BV9U'Կ<X$[r3r4 HfG_}-L ߼XI[9\+nڙ`g;l](~ֿ@cB7s8xyܼHMS)jFiO.7r p?I1k+ؖpp"$Qu>Ũ-' 8& tem_9 [DMqҺ,CMZZw)t{KP}]~p&y(oC|#Z>|T[Z7@hLEZ|sSfc6)$L@pҺ02 3wrec7K> diwstS~0JyC`iSO 5ߟ+ SR>c?~}zQMFqh2$r F2$ hCYh!;?!pI3U Gi5ipJ9pW&9UvN_E$ӛkWA<ً2*WHVؑ]+f F\ 8ft˖vn֦|@ː\ᐓ (r.`I ]\H_R:Ks_Z7@ qI_PZUMbuL6nj]_ZO@N(K}iX!2R2L4HiȮp$)eCDְy\Ĭ~]|Zy#z̭~YӱBcj > ϐ {Β9g# O +ԭs0$E=_!@-@vK^=_j^G>fÝrN]|O|_RLYz6 M%Ν `9a%$|)@q9ĜǪ/2 =NE (7Mg|%<+<Ѹ8uu}#hGZՕ_@@j#|GiL)Dpv$/w$;`g >RPcYX4fhJy<xBJ=F}26x8kM7iuQBl[fU>nvyO@ *xݬH_TߑFʼ1k0r- H_K[k0) XLErކjQ2~X!*=$3W=G>l a%P>EZO/~蟀F5r0 %K|"88Klڐ?Z!9um^F\U"#q h~E ֦¼6FŠS]śhwyXh`1*w}蟀I&?^^5' 7r8Ri S'gaU]J/*F}Yz) P|lpRϝ{lF2䫈LWf=?GخHf "s!%FqY?L9ӗEBRP!B,v"PStzH=ϙ"C'P' ?M^!<(%Nfʑ_ ;ZU/h1|vN\U3׌S/gII;'_m1.ICzouXK-o *@[9C')*Fw- hKέ>z;BʜN˃,ʀW2ps}}?67?z9v8ź[}t,d?+%W_hCW??IRm{6ޮjC}RdRVY .kY9%aN{o+#~Ѐ۴EI k@[aP 9>P=-qw,ѡ)#- 8]×j>k'=؊?>0qqvp(@y*7zds#f[ -1G$5ay88풘<&ņ9yRe8uM@~)C`yYes)y6Cg[t`o}vCm`( W~~ܞGPOf=%favK ⓷рH ĺ_ G602+][խ&_ q8 /,g Dhn*sSiC2l*V\&qPmM23M9o>6ڨ?R=یY<P:MqW!h57pQ ֟bC}=sfߚݸw{]Nz6Yb*6-S}CR?F֫6T;K8Y‰"ճ{c,; SٷF 5z]84Ջ<S~oJs`> "{,e%;Koe<6y'Ӫ..dF 4B=؇!xǥƁ:$ɴۘcS%N8ZE2yVSnR\W蚀4&߀EMfS0$o N.͎l&Q ܛ?>$d=%45^r j^r74\WkeA1a@2<;ҦpCW r,B2 '1O^蟟$ycU7X>~ 8 W-Ί-`RpܐΧ G޵zn8)h$*ś~ZabD}hRin87cHgkPW H7O+Lb>a-V+t n8OLRvɦqx "O98ZY:LfD\:b\ 8>OFi1`{qz4$:쾠rڔ+whp 4z6Zq?'+ta@rE'$/߂f]g ZـGMCKIcOHziƸY;p~u$!NHWulP"+28[\ ݖmƾ?Vi,^GymsЀ3q-Dw[V6`of"LDU)/+,%da=? `.q9+m,B[kjZs?qC(ֆY)o%SUM0XxzI?.*v}X8@90T-$NG>0t͋MMqE6u҆17.`L[()w)浡Wk3J@h #Zq'(}@$wȀE.ӿ?jĻYsG`d8tkaso`(V+st x_+Dȡ҃#IjЫG& * O~öȴyvNS'Mc5QKe<8<}z&%g@'n飿%`#&} 7O0JJGoW+( Y9DaBRu`gq X+A5[&wiYx05?8%M ɬ;llc`CkU}#UBlq}Xd[,. 01a2cC߰XoFy ([BY@ױY!!É 49*aM?0 M%8w3/^ ~|Xal\ӍsUOA$ *-!;5'JMA()b±އ7@Jw>V>vY!eqY@Z\$ʊO`\+5)Tz`\Y$!ۮ[yZ OWbtݜC/xr3eWϨslKr0TWsh>Qd ĐŭQJz)pIѸcjg/ɜvwi m+.XYv@u=6R5J.pݘtPualIՍ}m*| QcAܗZaYw|mKCS5+66G"D"B%QKK'n{QlW~Ƒ:ve?L6Ru)~CTk;OJ:5H>7rH<]oC5HK+lZD@)?bR(O%2vv!/1HͰcYnQ*[ђ l,6 0O\W͹\xldfSb<~ö'^TETjũbN; 6R7 IJjE{W)ӷzsS+$n5kug1yl9Ciw"hݔ]O2(2HR6>sS,`-ڇ#ߚlc&)`~Ɋ@ bUޜg95~F䬣CAsxDkˑJѥO_31]VKaͣ;G/B>U` O"ŌoIslWW2_\UDsxZr]>6ebD\T} D6ܧ Fʏlf\L(EIz q9z0ۙNiROyr>j3f)9>x4m.@}=NG6k ^#f&T_i?R"юl 7e&R0 ΋ÚGcmxB[)r5x.U+Dsk)۾xVF&<;[d^(`Xi){l=67BB~Co*DD ciBsyR=6.ÔYG꫹5VJzky|ޔU&5d AU~COȄƝKvjb%.ǩ^l?"?lF!@\Ŧ/_9P+oSDLJ8u9kR\YaNwvn;Ŧ<1  .-E>y?Ԧp\xfpr)hCppfi)#}Л"j#>cVQJ֤h^/تC6E6d+,C9PO3< wn *iQR\4 ،;Q:BC*WI;W2 owC*exu+øs0Nu pwNov[L{ u? H)%?tG9>s*!571 (g({P:ML#ao]Vn"πŕ?>p=qD"`O]1'1ݦ CU&=屜~0A]֭2:b0oE2MRg)bʟ{FD 5` Y|)C'`o@XAFcW,tx)Fq4uYM'SIک_(:-sRi${ȁ?zVyȫwEIP~ן\DKH\ dqʊl kFh.pn|Xa+NG˧0snf[|w8 ݔ`>hHb~; ќcC7W?CH>PUH7w# Eɼ>>_LB]+2lB!uL+6((n jyS M0:M QYu7OM{e<|)QD"Zq'C`ր-(.zHfu%Oz[S@#B2ueZaS()F)%8-L,y IMeң0 x""'L7YClP~}?Hk؞AC w& 7 xy y0[@Es)s o6m<C4ѫJIݗ1 q7efib?7e' 7"[X+lEkŞ9<'@{S6w.K8e@ x+lWGeuylcboJ@M)|SkMwiZS\PR}m)R|2–vk؛7=|ـޔ6Pa7eeAy'M!-]B*AsMY/:w21VڌRMYi}i6ޔwt;mWtMYƇʔ\w[ [RMYq0X>̳љAJڛB.eFQDuz+KRM) 08r2^a7eqK9$tX孞>:[)˻GJM&XK4{Sv#2#'ҒeZ29l. m\$dwMhMYrnM>sޔEnhheEyJLe$@{SV9@{]~az9ޔ=Dn0Z)XGeS|ho(U9h&@?sSj[ڌU{ihޔeol *ї7R&_=$u>+;b>"ED?Ed,&8]E&}R<_ޔUG!F#&~OkXyd{S @]%l*z %+gp=7&J hoCE)H:[7eX"7K [ ͗MYe#jOT+j)%4F" )ˀ b-p؛xH3$BmbMY,4esL jt7e؛'$Tix{Sm7e0tHB7\^ M)o9aoA\oT&Jt@{SU7|rt7egwf)xOcMx_e/LP᭟(#UGLM!?cע.PDڛjMTArR5˻PH^)؛ 4>c`o*DCcӄKWɴrS@nՀ|%"}Z@ܬ{rڽ b^ pJf/0`|Ȅ^FBF.k ͽ)ͪ%X@{S)8Kk@=>Э`o:k[+ߚV2i@)R~Q83EObhoʪ~Po=, 9K[ ;K۸;ڛݴ(;7ٹsՀcHv0)T`%Z@{SVݸSR<bfdCɡ(Q?X7j?gF}E.8g#-_JUQ?X6Bm8m[n eaE@)? pc0[wL_=1w&orpǤO7@ Je.ʮ3]PDB-REDO-dssp-ca06797/test/test-python.py000066400000000000000000000052561516741327300200270ustar00rootroot00000000000000from mkdssp import dssp, TestBond, helix_type, chain_break_type, helix_type, helix_position_type, structure_type import gzip import unittest class TestDssp(unittest.TestCase): def setUp(self): with gzip.open("1cbs.cif.gz", "rt") as f: file_content = f.read() self.dssp = dssp(file_content) def test_dssp(self): stats = self.dssp.statistics self.assertEqual(stats.residues, 137) def test_count(self): count = 0 for r in self.dssp: count += 1 self.assertEqual(count, 137) def test_bond(self): a = self.dssp.get('A', 137) b = self.dssp.get('A', 6) self.assertTrue(TestBond(a, b)) def test_one_residue(self): r = self.dssp.get("A", 15) self.assertEqual(r.asym_id, "A") self.assertEqual(r.seq_id, 15) self.assertEqual(r.compound_letter, "F") self.assertEqual(r.auth_asym_id, "A") self.assertEqual(r.auth_seq_id, 15) self.assertEqual(r.pdb_strand_id, "A") self.assertEqual(r.pdb_seq_num, 15) self.assertEqual(r.pdb_ins_code, '') self.assertAlmostEqual(r.alpha, 44.76425552368164) self.assertAlmostEqual(r.kappa, 73.85977935791016) self.assertAlmostEqual(r.phi, -66.86814880371094) self.assertAlmostEqual(r.psi, -48.56082534790039) self.assertAlmostEqual(r.tco, 0.9395495057106018) self.assertAlmostEqual(r.omega, 179.16152954101562) self.assertEqual(r.is_pre_pro, False) self.assertEqual(r.is_cis, False) self.assertEqual(r.chiral_volume, 0.0) # self.assertAlmostEqual(r.chi, [-170.86489868164062, 59.921932220458984]) # self.assertAlmostEqual(r.ca_location, {'x': 22.385000228881836, 'y': 17.197999954223633, 'z': 17.680999755859375}) self.assertEqual(r.chain_break, chain_break_type.NoGap) self.assertEqual(r.nr, 15) self.assertEqual(r.type, structure_type.Alphahelix) self.assertEqual(r.ssBridgeNr, 0) self.assertEqual(r.helix(helix_type._3_10), helix_position_type.NoHelix) self.assertEqual(r.helix(helix_type.alpha), helix_position_type.Start) self.assertEqual(r.helix(helix_type.pi), helix_position_type.NoHelix) self.assertEqual(r.helix(helix_type.pp), helix_position_type.NoHelix) self.assertEqual(r.is_alpha_helix_end_before_start, False) self.assertEqual(r.bend, True) self.assertEqual(r.sheet, 0) self.assertEqual(r.strand, 0) (acceptor, energy) = r.acceptor(0) self.assertEqual(acceptor.seq_id, 17) self.assertAlmostEqual(energy, -0.2) if __name__ == "__main__": unittest.main()PDB-REDO-dssp-ca06797/test/test_numpy2_compat.py000066400000000000000000000123661516741327300213650ustar00rootroot00000000000000""" DSSP numpy 2.x compatibility test script This script tests whether the DSSP module works correctly with numpy 2.x """ import sys import os import gzip import traceback def find_test_file(): """Find the test CIF file in the repository""" # Possible paths relative to script location possible_paths = [ "test/1cbs.cif.gz", # From repository root "../test/1cbs.cif.gz", # From python-module directory "1cbs.cif.gz", # From test directory ] for path in possible_paths: if os.path.exists(path): return path return None def test_numpy_version(): """Check numpy version""" try: import numpy as np print(f"✓ numpy version: {np.__version__}") major_version = int(np.__version__.split('.')[0]) if major_version >= 2: print("✓ numpy 2.x detected") else: print(f"⚠ numpy {np.__version__} detected (not 2.x)") return True except ImportError as e: print(f"✗ Failed to import numpy: {e}") return False def test_mkdssp_import(): """Test mkdssp module import""" try: import mkdssp print("✓ Successfully imported mkdssp module") return True except ImportError as e: print(f"✗ Failed to import mkdssp: {e}") traceback.print_exc() return False def test_basic_functionality(): """Test basic functionality""" try: from mkdssp import dssp, TestBond, helix_type, chain_break_type, helix_position_type, structure_type print("✓ Successfully imported all mkdssp classes/functions") # Find test file test_file = find_test_file() if test_file is None: print("✗ Could not find test file (1cbs.cif.gz)") print(" Please run this script from the repository root or test directory") return False print(f"✓ Found test file: {test_file}") # Read test file try: with gzip.open(test_file, "rt") as f: file_content = f.read() print("✓ Successfully read test file") except Exception as e: print(f"✗ Failed to read test file: {e}") return False # Test DSSP object creation try: dssp_obj = dssp(file_content) print("✓ Successfully created DSSP object") except Exception as e: print(f"✗ Failed to create DSSP object: {e}") traceback.print_exc() return False # Test statistics try: stats = dssp_obj.statistics print(f"✓ Successfully retrieved statistics") print(f" - Residues: {stats.residues}") print(f" - Chains: {stats.chains}") print(f" - H-bonds: {stats.H_bonds}") except Exception as e: print(f"✗ Failed to retrieve statistics: {e}") traceback.print_exc() return False # Test iteration try: count = 0 for res in dssp_obj: count += 1 if count == 1: # Check first residue print(f" - First residue: {res.asym_id} {res.seq_id} {res.compound_id}") print(f"✓ Successfully iterated through {count} residues") except Exception as e: print(f"✗ Failed to iterate through residues: {e}") traceback.print_exc() return False # Test TestBond function try: a = dssp_obj.get('A', 137) b = dssp_obj.get('A', 6) result = TestBond(a, b) print(f"✓ Successfully tested TestBond function: {result}") except Exception as e: print(f"✗ Failed to test TestBond function: {e}") traceback.print_exc() return False return True except Exception as e: print(f"✗ Basic functionality test failed: {e}") traceback.print_exc() return False def main(): """Main test function""" print("=" * 60) print("DSSP numpy 2.x Compatibility Test") print("=" * 60) print() all_passed = True # Test 1: Check numpy version print("Test 1: Check numpy version") if not test_numpy_version(): all_passed = False print() # Test 2: Import mkdssp print("Test 2: Import mkdssp module") if not test_mkdssp_import(): all_passed = False print("\n⚠ Cannot import mkdssp, skipping remaining tests") print_summary(False) return 1 print() # Test 3: Basic functionality print("Test 3: Test basic functionality") if not test_basic_functionality(): all_passed = False print() # Summary print_summary(all_passed) return 0 if all_passed else 1 def print_summary(all_passed): """Print test summary""" print("=" * 60) if all_passed: print("✓ All tests passed!") print("✓ DSSP appears to be compatible with numpy 2.x") else: print("✗ Some tests failed") print("✗ There may be compatibility issues with numpy 2.x") print("=" * 60) if __name__ == "__main__": sys.exit(main()) PDB-REDO-dssp-ca06797/test/unit-test-dssp.cpp000066400000000000000000000172641516741327300205700ustar00rootroot00000000000000/*- * SPDX-License-Identifier: BSD-2-Clause * * Copyright (c) 2020 NKI/AVL, Netherlands Cancer Institute * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions are met: * * 1. Redistributions of source code must retain the above copyright notice, this * list of conditions and the following disclaimer * 2. Redistributions in binary form must reproduce the above copyright notice, * this list of conditions and the following disclaimer in the documentation * and/or other materials provided with the distribution. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS "AS IS" AND * ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED * WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE * DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS BE LIABLE FOR * ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES * (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; * LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND * ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT * (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS * SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. */ #define CATCH_CONFIG_RUNNER #include "../libdssp/src/dssp-io.hpp" #include "../src/revision.hpp" #include "dssp.hpp" #include #include namespace fs = std::filesystem; // -------------------------------------------------------------------- cif::file operator""_cf(const char *text, size_t length) { struct membuf : public std::streambuf { membuf(char *text, size_t length) { this->setg(text, text, text + length); } } buffer(const_cast(text), length); std::istream is(&buffer); return cif::file(is); } // -------------------------------------------------------------------- std::filesystem::path gTestDir; int main(int argc, char *argv[]) { gTestDir = std::filesystem::current_path(); Catch::Session session; // There must be exactly one instance // Build a new parser on top of Catch2's using namespace Catch::Clara; std::filesystem::path rsrc_dir; auto cli = session.cli() // Get Catch2's command line parser | Opt(gTestDir, "data-dir") // bind variable to a new option, with a hint string ["-D"]["--data-dir"] // the option names it will respond to | Opt(rsrc_dir, "rsrc-dir") // bind variable to a new option, with a hint string ["-D"]["--rsrc-dir"] // the option names it will respond to ("The directory containing the data files"); // description string for the help output // Now pass the new composite back to Catch2 so it uses that session.cli(cli); // Let Catch2 (using Clara) parse the command line int returnCode = session.applyCommandLine(argc, argv); if (returnCode != 0) // Indicates a command line error return returnCode; if (not rsrc_dir.empty() and std::filesystem::exists(rsrc_dir)) cif::add_data_directory(rsrc_dir); cif::add_data_directory(gTestDir / "libdssp" / "mmcif_pdbx"); cif::add_file_resource("components.cif", gTestDir / "minimal-components.cif"); return session.run(); } // -------------------------------------------------------------------- TEST_CASE("ut_dssp") { using namespace std::literals; auto f = cif::pdb::read(gTestDir / "1cbs.cif.gz"); REQUIRE(f.is_valid()); dssp dssp(f.front(), 1, 3, true); std::stringstream test; writeDSSP(dssp, test); std::ifstream reference(gTestDir / "1cbs.dssp"); CHECK(reference.is_open()); std::string line_t, line_r; CHECK((std::getline(test, line_t) and std::getline(reference, line_r))); char kHeaderLineStart[] = "==== Secondary Structure Definition by the program DSSP, NKI version 4.5.4 ===="; memcpy(kHeaderLineStart + 69, kVersionNumber, strlen(kVersionNumber)); CHECK(line_t.compare(0, std::strlen(kHeaderLineStart), kHeaderLineStart) == 0); // CHECK(line_r.compare(0, std::strlen(kHeaderLineStart), kHeaderLineStart) == 0); for (int line_nr = 2;; ++line_nr) { bool done_t = not std::getline(test, line_t); bool done_r = not std::getline(reference, line_r); CHECK(done_r == done_t); if (done_r) break; if (line_t != line_r) { if (cif::starts_with(line_t, "REFERENCE ") and cif::starts_with(line_r, "REFERENCE ")) continue; // std::cerr << line_nr << '\n' // << line_t << '\n' // << line_r << '\n'; } REQUIRE(line_t == line_r); } CHECK(test.eof()); CHECK(reference.eof()); } TEST_CASE("ut_mmcif_2") { using namespace std::literals; using namespace cif::literals; auto f = cif::pdb::read(gTestDir / "1cbs.cif.gz"); REQUIRE(f.is_valid()); dssp dssp(f.front(), 1, 3, true); dssp.annotate(f.front(), true, true); cif::file rf(gTestDir / "1cbs-dssp.cif"); auto &db1 = f.front(); auto &db2 = rf.front(); db1["software"].erase("name"_key == "DSSP"); std::erase_if(db1, [](cif::category &cat) { return cat.name() == "audit_conform"; }); db2["software"].erase("name"_key == "DSSP"); std::erase_if(db2, [](cif::category &cat) { return cat.name() == "audit_conform"; }); if (not (f.front() == rf.front())) { // std::ofstream a(std::filesystem::temp_directory_path() / "dssp-test-a.cif"); // a << f.front(); // a.close(); // std::ofstream b(std::filesystem::temp_directory_path() / "dssp-test-b.cif"); // b << rf.front(); // b.close(); CHECK(false); } } // -------------------------------------------------------------------- TEST_CASE("dssp_1") { auto f = cif::pdb::read(gTestDir / "1cbs.cif.gz"); REQUIRE(f.is_valid()); std::ifstream t(gTestDir / "1cbs-dssp-test.tsv"); dssp dssp(f.front(), 1, 3, true); for (auto residue : dssp) { std::string line; getline(t, line); // std::cout << line << '\n'; auto fld = cif::split(line, "\t"); CHECK(fld.size() == 3); if (fld.size() != 3) continue; int seqID; std::from_chars(fld[0].data(), fld[0].data() + fld[0].length(), seqID); std::string asymID{ fld[1] }; std::string secstr{ fld[2] }; if (secstr == "_") secstr = " "; CHECK(residue.asym_id() == asymID); CHECK(residue.seq_id() == seqID); CHECK((char)residue.type() == secstr.front()); } } // -------------------------------------------------------------------- TEST_CASE("dssp_2") { auto f = cif::pdb::read(gTestDir / "1cbs.cif.gz"); REQUIRE(f.is_valid()); dssp dssp(f.front(), 1, 3, true); std::ifstream t(gTestDir / "1cbs-dssp-test.tsv"); std::string line; while (getline(t, line)) { auto fld = cif::split(line, "\t"); CHECK(fld.size() == 3); if (fld.size() != 3) continue; int seqID; std::from_chars(fld[0].data(), fld[0].data() + fld[0].length(), seqID); std::string asymID{ fld[1] }; std::string secstr{ fld[2] }; if (secstr == "_") secstr = " "; dssp::key_type key{ asymID, seqID }; auto ri = dssp[key]; CHECK(ri.asym_id() == asymID); CHECK(ri.seq_id() == seqID); CHECK((char)ri.type() == secstr.front()); } } // -------------------------------------------------------------------- TEST_CASE("dssp_3") { auto f = cif::pdb::read(gTestDir / "1cbs.cif.gz"); REQUIRE(f.is_valid()); dssp dssp(f.front(), 1, 3, true); dssp.annotate(f.front(), true, true); // CHECK(f.is_valid()); } // -------------------------------------------------------------------- TEST_CASE("dssp_pdb") { auto f = cif::pdb::read(gTestDir / "pdb1cbs.ent.gz"); REQUIRE(f.is_valid()); dssp dssp(f.front(), 1, 3, true); dssp.annotate(f.front(), true, true); }PDB-REDO-dssp-ca06797/tools/000077500000000000000000000000001516741327300153305ustar00rootroot00000000000000PDB-REDO-dssp-ca06797/tools/depends.cmd000066400000000000000000000014101516741327300174330ustar00rootroot00000000000000@ECHO OFF SET ZLIB_VERSION=1.3 IF NOT EXIST build_ci\libs ( MKDIR build_ci\libs ) CD build_ci\libs @REM Install ZLib IF NOT EXIST zlib-%ZLIB_VERSION%.zip ( ECHO Downloading https://github.com/libarchive/zlib/archive/v%ZLIB_VERSION%.zip curl -L -o zlib-%ZLIB_VERSION%.zip https://github.com/libarchive/zlib/archive/v%ZLIB_VERSION%.zip || EXIT /b 1 ) IF NOT EXIST zlib-%ZLIB_VERSION% ( ECHO Unpacking zlib-%ZLIB_VERSION%.zip C:\windows\system32\tar.exe -x -f zlib-%ZLIB_VERSION%.zip || EXIT /b 1 ) CD zlib-%ZLIB_VERSION% cmake -B build || EXIT /b 1 cmake --build build --target ALL_BUILD --config Release || EXIT /b 1 cmake --build build --target RUN_TESTS --config Release || EXIT /b 1 cmake --build build --target INSTALL --config Release || EXIT /b 1 @EXIT /b 0